Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8H2YY7)

DOT Name RAC-alpha serine/threonine-protein kinase (AKT1)
Synonyms EC 2.7.11.1; Protein kinase B; PKB; Protein kinase B alpha; PKB alpha; Proto-oncogene c-Akt; RAC-PK-alpha
Gene Name AKT1
Related Disease
Proteus syndrome ( )
Cowden disease ( )
Cowden syndrome 6 ( )
UniProt ID
AKT1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1H10 ; 1UNP ; 1UNQ ; 1UNR ; 2UVM ; 2UZR ; 2UZS ; 3CQU ; 3CQW ; 3MV5 ; 3MVH ; 3O96 ; 3OCB ; 3OW4 ; 3QKK ; 3QKL ; 3QKM ; 4EJN ; 4EKK ; 4EKL ; 4GV1 ; 5KCV ; 6BUU ; 6CCY ; 6HHF ; 6HHG ; 6HHH ; 6HHI ; 6HHJ ; 6NPZ ; 6S9W ; 6S9X ; 7APJ ; 7MYX ; 7NH4 ; 7NH5
EC Number
2.7.11.1
Pfam ID
PF00169 ; PF00069 ; PF00433
Sequence
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
Function
AKT1 is one of 3 closely related serine/threonine-protein kinases (AKT1, AKT2 and AKT3) called the AKT kinase, and which regulate many processes including metabolism, proliferation, cell survival, growth and angiogenesis. This is mediated through serine and/or threonine phosphorylation of a range of downstream substrates. Over 100 substrate candidates have been reported so far, but for most of them, no isoform specificity has been reported. AKT is responsible of the regulation of glucose uptake by mediating insulin-induced translocation of the SLC2A4/GLUT4 glucose transporter to the cell surface. Phosphorylation of PTPN1 at 'Ser-50' negatively modulates its phosphatase activity preventing dephosphorylation of the insulin receptor and the attenuation of insulin signaling. Phosphorylation of TBC1D4 triggers the binding of this effector to inhibitory 14-3-3 proteins, which is required for insulin-stimulated glucose transport. AKT regulates also the storage of glucose in the form of glycogen by phosphorylating GSK3A at 'Ser-21' and GSK3B at 'Ser-9', resulting in inhibition of its kinase activity. Phosphorylation of GSK3 isoforms by AKT is also thought to be one mechanism by which cell proliferation is driven. AKT regulates also cell survival via the phosphorylation of MAP3K5 (apoptosis signal-related kinase). Phosphorylation of 'Ser-83' decreases MAP3K5 kinase activity stimulated by oxidative stress and thereby prevents apoptosis. AKT mediates insulin-stimulated protein synthesis by phosphorylating TSC2 at 'Ser-939' and 'Thr-1462', thereby activating the mTORC1 signaling pathway, and leading to both phosphorylation of 4E-BP1 and in activation of RPS6KB1. Also regulates the mTORC1 signaling pathway by catalyzing phosphorylation of CASTOR1 and DEPDC5. AKT is involved in the phosphorylation of members of the FOXO factors (Forkhead family of transcription factors), leading to binding of 14-3-3 proteins and cytoplasmic localization. In particular, FOXO1 is phosphorylated at 'Thr-24', 'Ser-256' and 'Ser-319'. FOXO3 and FOXO4 are phosphorylated on equivalent sites. AKT has an important role in the regulation of NF-kappa-B-dependent gene transcription and positively regulates the activity of CREB1 (cyclic AMP (cAMP)-response element binding protein). The phosphorylation of CREB1 induces the binding of accessory proteins that are necessary for the transcription of pro-survival genes such as BCL2 and MCL1. AKT phosphorylates 'Ser-454' on ATP citrate lyase (ACLY), thereby potentially regulating ACLY activity and fatty acid synthesis. Activates the 3B isoform of cyclic nucleotide phosphodiesterase (PDE3B) via phosphorylation of 'Ser-273', resulting in reduced cyclic AMP levels and inhibition of lipolysis. Phosphorylates PIKFYVE on 'Ser-318', which results in increased PI(3)P-5 activity. The Rho GTPase-activating protein DLC1 is another substrate and its phosphorylation is implicated in the regulation cell proliferation and cell growth. AKT plays a role as key modulator of the AKT-mTOR signaling pathway controlling the tempo of the process of newborn neurons integration during adult neurogenesis, including correct neuron positioning, dendritic development and synapse formation. Signals downstream of phosphatidylinositol 3-kinase (PI(3)K) to mediate the effects of various growth factors such as platelet-derived growth factor (PDGF), epidermal growth factor (EGF), insulin and insulin-like growth factor I (IGF-I). AKT mediates the antiapoptotic effects of IGF-I. Essential for the SPATA13-mediated regulation of cell migration and adhesion assembly and disassembly. May be involved in the regulation of the placental development. Phosphorylates STK4/MST1 at 'Thr-120' and 'Thr-387' leading to inhibition of its: kinase activity, nuclear translocation, autophosphorylation and ability to phosphorylate FOXO3. Phosphorylates STK3/MST2 at 'Thr-117' and 'Thr-384' leading to inhibition of its: cleavage, kinase activity, autophosphorylation at Thr-180, binding to RASSF1 and nuclear translocation. Phosphorylates SRPK2 and enhances its kinase activity towards SRSF2 and ACIN1 and promotes its nuclear translocation. Phosphorylates RAF1 at 'Ser-259' and negatively regulates its activity. Phosphorylation of BAD stimulates its pro-apoptotic activity. Phosphorylates KAT6A at 'Thr-369' and this phosphorylation inhibits the interaction of KAT6A with PML and negatively regulates its acetylation activity towards p53/TP53. Phosphorylates palladin (PALLD), modulating cytoskeletal organization and cell motility. Phosphorylates prohibitin (PHB), playing an important role in cell metabolism and proliferation. Phosphorylates CDKN1A, for which phosphorylation at 'Thr-145' induces its release from CDK2 and cytoplasmic relocalization. These recent findings indicate that the AKT1 isoform has a more specific role in cell motility and proliferation. Phosphorylates CLK2 thereby controlling cell survival to ionizing radiation. Phosphorylates PCK1 at 'Ser-90', reducing the binding affinity of PCK1 to oxaloacetate and changing PCK1 into an atypical protein kinase activity using GTP as donor. Also acts as an activator of TMEM175 potassium channel activity in response to growth factors: forms the lysoK(GF) complex together with TMEM175 and acts by promoting TMEM175 channel activation, independently of its protein kinase activity. Acts as an inhibitor of tRNA methylation by mediating phosphorylation of the N-terminus of METTL1, thereby inhibiting METTL1 methyltransferase activity. In response to LPAR1 receptor pathway activation, phosphorylates Rabin8/RAB3IP which alters its activity and phosphorylates WDR44 which induces WDR44 binding to Rab11, thereby switching Rab11 vesicular function from preciliary trafficking to endocytic recycling.
Tissue Specificity
Expressed in prostate cancer and levels increase from the normal to the malignant state (at protein level). Expressed in all human cell types so far analyzed. The Tyr-176 phosphorylated form shows a significant increase in expression in breast cancers during the progressive stages i.e. normal to hyperplasia (ADH), ductal carcinoma in situ (DCIS), invasive ductal carcinoma (IDC) and lymph node metastatic (LNMM) stages.
KEGG Pathway
EGFR tyrosine ki.se inhibitor resistance (hsa01521 )
Endocrine resistance (hsa01522 )
Platinum drug resistance (hsa01524 )
MAPK sig.ling pathway (hsa04010 )
ErbB sig.ling pathway (hsa04012 )
Ras sig.ling pathway (hsa04014 )
Rap1 sig.ling pathway (hsa04015 )
cGMP-PKG sig.ling pathway (hsa04022 )
cAMP sig.ling pathway (hsa04024 )
Chemokine sig.ling pathway (hsa04062 )
HIF-1 sig.ling pathway (hsa04066 )
FoxO sig.ling pathway (hsa04068 )
Sphingolipid sig.ling pathway (hsa04071 )
Phospholipase D sig.ling pathway (hsa04072 )
Autophagy - animal (hsa04140 )
mTOR sig.ling pathway (hsa04150 )
PI3K-Akt sig.ling pathway (hsa04151 )
AMPK sig.ling pathway (hsa04152 )
Apoptosis (hsa04210 )
Longevity regulating pathway (hsa04211 )
Longevity regulating pathway - multiple species (hsa04213 )
Cellular senescence (hsa04218 )
Adrenergic sig.ling in cardiomyocytes (hsa04261 )
VEGF sig.ling pathway (hsa04370 )
Apelin sig.ling pathway (hsa04371 )
Osteoclast differentiation (hsa04380 )
Focal adhesion (hsa04510 )
Sig.ling pathways regulating pluripotency of stem cells (hsa04550 )
Platelet activation (hsa04611 )
Neutrophil extracellular trap formation (hsa04613 )
Toll-like receptor sig.ling pathway (hsa04620 )
C-type lectin receptor sig.ling pathway (hsa04625 )
JAK-STAT sig.ling pathway (hsa04630 )
T cell receptor sig.ling pathway (hsa04660 )
B cell receptor sig.ling pathway (hsa04662 )
Fc epsilon RI sig.ling pathway (hsa04664 )
Fc gamma R-mediated phagocytosis (hsa04666 )
TNF sig.ling pathway (hsa04668 )
Neurotrophin sig.ling pathway (hsa04722 )
Cholinergic sy.pse (hsa04725 )
Dopaminergic sy.pse (hsa04728 )
Regulation of actin cytoskeleton (hsa04810 )
Insulin sig.ling pathway (hsa04910 )
Progesterone-mediated oocyte maturation (hsa04914 )
Estrogen sig.ling pathway (hsa04915 )
Prolactin sig.ling pathway (hsa04917 )
Thyroid hormone sig.ling pathway (hsa04919 )
Adipocytokine sig.ling pathway (hsa04920 )
Glucagon sig.ling pathway (hsa04922 )
Regulation of lipolysis in adipocytes (hsa04923 )
Relaxin sig.ling pathway (hsa04926 )
GnRH secretion (hsa04929 )
Insulin resistance (hsa04931 )
Non-alcoholic fatty liver disease (hsa04932 )
AGE-RAGE sig.ling pathway in diabetic complications (hsa04933 )
Growth hormone synthesis, secretion and action (hsa04935 )
Alcoholic liver disease (hsa04936 )
Carbohydrate digestion and absorption (hsa04973 )
Alzheimer disease (hsa05010 )
Spinocerebellar ataxia (hsa05017 )
Shigellosis (hsa05131 )
Salmonella infection (hsa05132 )
Yersinia infection (hsa05135 )
Chagas disease (hsa05142 )
Toxoplasmosis (hsa05145 )
Tuberculosis (hsa05152 )
Hepatitis C (hsa05160 )
Hepatitis B (hsa05161 )
Measles (hsa05162 )
Human cytomegalovirus infection (hsa05163 )
Influenza A (hsa05164 )
Human papillomavirus infection (hsa05165 )
Human T-cell leukemia virus 1 infection (hsa05166 )
Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
Herpes simplex virus 1 infection (hsa05168 )
Epstein-Barr virus infection (hsa05169 )
Human immunodeficiency virus 1 infection (hsa05170 )
Pathways in cancer (hsa05200 )
Proteoglycans in cancer (hsa05205 )
Chemical carcinogenesis - receptor activation (hsa05207 )
Chemical carcinogenesis - reactive oxygen species (hsa05208 )
Colorectal cancer (hsa05210 )
Re.l cell carcinoma (hsa05211 )
Pancreatic cancer (hsa05212 )
Endometrial cancer (hsa05213 )
Glioma (hsa05214 )
Prostate cancer (hsa05215 )
Melanoma (hsa05218 )
Chronic myeloid leukemia (hsa05220 )
Acute myeloid leukemia (hsa05221 )
Small cell lung cancer (hsa05222 )
Non-small cell lung cancer (hsa05223 )
Breast cancer (hsa05224 )
Hepatocellular carcinoma (hsa05225 )
Gastric cancer (hsa05226 )
Central carbon metabolism in cancer (hsa05230 )
Choline metabolism in cancer (hsa05231 )
PD-L1 expression and PD-1 checkpoint pathway in cancer (hsa05235 )
Diabetic cardiomyopathy (hsa05415 )
Lipid and atherosclerosis (hsa05417 )
Fluid shear stress and atherosclerosis (hsa05418 )
Reactome Pathway
PIP3 activates AKT signaling (R-HSA-1257604 )
Downregulation of ERBB2 (R-HSA-1358803 )
Translocation of SLC2A4 (GLUT4) to the plasma membrane (R-HSA-1445148 )
Tetrahydrobiopterin (BH4) synthesis, recycling, salvage and regulation (R-HSA-1474151 )
MTOR signalling (R-HSA-165159 )
AKT phosphorylates targets in the cytosol (R-HSA-198323 )
AKT phosphorylates targets in the nucleus (R-HSA-198693 )
Negative regulation of the PI3K/AKT network (R-HSA-199418 )
eNOS activation (R-HSA-203615 )
AKT-mediated inactivation of FOXO1A (R-HSA-211163 )
Integrin signaling (R-HSA-354192 )
Deactivation of the beta-catenin transactivating complex (R-HSA-3769402 )
CD28 dependent PI3K/Akt signaling (R-HSA-389357 )
CTLA4 inhibitory signaling (R-HSA-389513 )
G beta (R-HSA-392451 )
Butyrate Response Factor 1 (BRF1) binds and destabilizes mRNA (R-HSA-450385 )
KSRP (KHSRP) binds and destabilizes mRNA (R-HSA-450604 )
VEGFR2 mediated vascular permeability (R-HSA-5218920 )
TP53 Regulates Metabolic Genes (R-HSA-5628897 )
Constitutive Signaling by AKT1 E17K in Cancer (R-HSA-5674400 )
Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807 )
Regulation of TP53 Degradation (R-HSA-6804757 )
Regulation of TP53 Activity through Acetylation (R-HSA-6804758 )
Regulation of TP53 Activity through Association with Co-factors (R-HSA-6804759 )
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling (R-HSA-6811558 )
Cyclin E associated events during G1/S transition (R-HSA-69202 )
Cyclin A (R-HSA-69656 )
PTK6 Regulates RTKs and Their Effectors AKT1 and DOK1 (R-HSA-8849469 )
RAB GEFs exchange GTP for GDP on RABs (R-HSA-8876198 )
RUNX2 regulates genes involved in cell migration (R-HSA-8941332 )
Regulation of PTEN stability and activity (R-HSA-8948751 )
Extra-nuclear estrogen signaling (R-HSA-9009391 )
Negative regulation of NOTCH4 signaling (R-HSA-9604323 )
FLT3 Signaling (R-HSA-9607240 )
Regulation of localization of FOXO transcription factors (R-HSA-9614399 )
Estrogen-dependent nuclear events downstream of ESR-membrane signaling (R-HSA-9634638 )
KEAP1-NFE2L2 pathway (R-HSA-9755511 )
SARS-CoV-2 targets host intracellular signalling and regulatory pathways (R-HSA-9755779 )
Activation of BAD and translocation to mitochondria (R-HSA-111447 )

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Proteus syndrome DISJ3VXH Definitive Autosomal dominant [1]
Cowden disease DISMYKCE Supportive Autosomal dominant [2]
Cowden syndrome 6 DISRESVP Limited Unknown [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 16 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved RAC-alpha serine/threonine-protein kinase (AKT1) decreases the response to substance of Tretinoin. [100]
Etoposide DMNH3PG Approved RAC-alpha serine/threonine-protein kinase (AKT1) increases the response to substance of Etoposide. [101]
Paclitaxel DMLB81S Approved RAC-alpha serine/threonine-protein kinase (AKT1) decreases the response to substance of Paclitaxel. [102]
DTI-015 DMXZRW0 Approved RAC-alpha serine/threonine-protein kinase (AKT1) affects the response to substance of DTI-015. [103]
Gemcitabine DMSE3I7 Approved RAC-alpha serine/threonine-protein kinase (AKT1) affects the response to substance of Gemcitabine. [104]
Methamphetamine DMPM4SK Approved RAC-alpha serine/threonine-protein kinase (AKT1) increases the response to substance of Methamphetamine. [105]
Daunorubicin DMQUSBT Approved RAC-alpha serine/threonine-protein kinase (AKT1) decreases the response to substance of Daunorubicin. [106]
Olanzapine DMPFN6Y Approved RAC-alpha serine/threonine-protein kinase (AKT1) increases the response to substance of Olanzapine. [107]
Dobutamine DMD1B8Z Approved RAC-alpha serine/threonine-protein kinase (AKT1) affects the response to substance of Dobutamine. [108]
Mannitol DMSCDY9 Approved RAC-alpha serine/threonine-protein kinase (AKT1) increases the Apoptosis ADR of Mannitol. [109]
Buparlisib DM1WEHC Phase 3 RAC-alpha serine/threonine-protein kinase (AKT1) decreases the response to substance of Buparlisib. [110]
AR-12 DM4RK6P Phase 1 RAC-alpha serine/threonine-protein kinase (AKT1) decreases the response to substance of AR-12. [111]
PMID26394986-Compound-22 DM43Z1G Patented RAC-alpha serine/threonine-protein kinase (AKT1) decreases the response to substance of PMID26394986-Compound-22. [112]
Nickel chloride DMI12Y8 Investigative RAC-alpha serine/threonine-protein kinase (AKT1) decreases the response to substance of Nickel chloride. [113]
TTNPB DMSABD0 Investigative RAC-alpha serine/threonine-protein kinase (AKT1) decreases the response to substance of TTNPB. [114]
Leptin DM5LY1H Investigative RAC-alpha serine/threonine-protein kinase (AKT1) increases the Ovarian cancer ADR of Leptin. [109]
------------------------------------------------------------------------------------
⏷ Show the Full List of 16 Drug(s)
61 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of RAC-alpha serine/threonine-protein kinase (AKT1). [3]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [6]
Arsenic DMTL2Y1 Approved Arsenic increases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [10]
Temozolomide DMKECZD Approved Temozolomide increases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [12]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [14]
Testosterone DM7HUNW Approved Testosterone increases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [16]
Marinol DM70IK5 Approved Marinol decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [20]
Progesterone DMUY35B Approved Progesterone increases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [22]
Fluorouracil DMUM7HZ Approved Fluorouracil increases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [23]
Dexamethasone DMMWZET Approved Dexamethasone decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [24]
Hydroquinone DM6AVR4 Approved Hydroquinone decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [28]
Rosiglitazone DMILWZR Approved Rosiglitazone decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [29]
Testosterone enanthate DMB6871 Approved Testosterone enanthate increases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [32]
Dasatinib DMJV2EK Approved Dasatinib decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [34]
Sulindac DM2QHZU Approved Sulindac decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [41]
Capsaicin DMGMF6V Approved Capsaicin increases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [42]
Alitretinoin DMME8LH Approved Alitretinoin decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [43]
Palbociclib DMD7L94 Approved Palbociclib increases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [44]
Thalidomide DM70BU5 Approved Thalidomide decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [45]
Liothyronine DM6IR3P Approved Liothyronine increases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [46]
Ursodeoxycholic acid DMCUT21 Approved Ursodeoxycholic acid increases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [48]
Gefitinib DM15F0X Approved Gefitinib decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [49]
Beta-carotene DM0RXBT Approved Beta-carotene decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [50]
Estrone DM5T6US Approved Estrone increases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [52]
Dinoprostone DMTYOPD Approved Dinoprostone increases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [53]
Docetaxel DMDI269 Approved Docetaxel decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [54]
Lovastatin DM9OZWQ Approved Lovastatin decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [29]
Propofol DMB4OLE Approved Propofol decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [56]
Melatonin DMKWFBT Approved Melatonin increases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [57]
Glucosamine DM4ZLFD Approved Glucosamine affects the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [58]
Eicosapentaenoic acid/docosa-hexaenoic acid DMMUCG4 Approved Eicosapentaenoic acid/docosa-hexaenoic acid decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [60]
Crizotinib DM4F29C Approved Crizotinib decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [62]
Ciprofloxacin XR DM2NLS9 Approved Ciprofloxacin XR increases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [63]
Cantharidin DMBP5N3 Approved Cantharidin increases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [64]
Methimazole DM25FL8 Approved Methimazole decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [65]
Romidepsin DMT5GNL Approved Romidepsin increases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [66]
Trovafloxacin DM6AN32 Approved Trovafloxacin increases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [69]
Propranolol DM79NTF Approved Propranolol decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [70]
Masoprocol DMMVNZ0 Approved Masoprocol decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [71]
Vandetanib DMRICNP Approved Vandetanib decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [72]
Teriflunomide DMQ2FKJ Approved Teriflunomide decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [73]
Omacetaxine mepesuccinate DMPU2WX Approved Omacetaxine mepesuccinate decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [74]
Ropivacaine DMSPJG2 Approved Ropivacaine decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [75]
AC220 DM8Y4JS Approved AC220 decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [77]
Cotinine DMCEZ1B Approved Cotinine increases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [78]
Cilostazol DMZMSCT Approved Cilostazol increases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [79]
Osimertinib DMRJLAT Approved Osimertinib decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [49]
Imiquimod DM1TMA3 Approved Imiquimod increases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [80]
Furazolidone DM3P6V7 Approved Furazolidone decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [81]
Miconazole DMPMYE8 Approved Miconazole decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [82]
Trametinib DM2JGQ3 Approved Trametinib increases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [84]
Momelotinib DMF98Q0 Approved Momelotinib decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [86]
Procaine DM4LSNE Approved Procaine increases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [87]
Phloroglucinol DMUKMC8 Approved Phloroglucinol decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [88]
Idelalisib DM602WT Approved Idelalisib decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [89]
AZD5363 DM9SKW8 Approved AZD5363 increases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [90]
Minodronate DM50PMY Approved Minodronate decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [91]
Prilocaine DMI7DZ2 Approved Prilocaine increases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [93]
Bay 80-6946 DMLOS5R Approved Bay 80-6946 decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [94]
Naftopidil DMQ8R4E Approved Naftopidil decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [95]
Berberine DMC5Q8X Phase 4 Berberine decreases the phosphorylation of RAC-alpha serine/threonine-protein kinase (AKT1). [96]
------------------------------------------------------------------------------------
⏷ Show the Full List of 61 Drug(s)
38 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [5]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [7]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [8]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [9]
Quercetin DM3NC4M Approved Quercetin decreases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [11]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [13]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [15]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [17]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [18]
Decitabine DMQL8XJ Approved Decitabine decreases the activity of RAC-alpha serine/threonine-protein kinase (AKT1). [19]
Selenium DM25CGV Approved Selenium increases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [21]
Niclosamide DMJAGXQ Approved Niclosamide increases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [25]
Cannabidiol DM0659E Approved Cannabidiol decreases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [26]
Bortezomib DMNO38U Approved Bortezomib decreases the activity of RAC-alpha serine/threonine-protein kinase (AKT1). [27]
Ethanol DMDRQZU Approved Ethanol decreases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [30]
Aspirin DM672AH Approved Aspirin increases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [31]
Diclofenac DMPIHLS Approved Diclofenac affects the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [17]
Nicotine DMWX5CO Approved Nicotine increases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [33]
Clozapine DMFC71L Approved Clozapine increases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [35]
Indomethacin DMSC4A7 Approved Indomethacin decreases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [36]
Menthol DMG2KW7 Approved Menthol decreases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [37]
Mitomycin DMH0ZJE Approved Mitomycin decreases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [38]
Simvastatin DM30SGU Approved Simvastatin decreases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [39]
Obeticholic acid DM3Q1SM Approved Obeticholic acid decreases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [40]
Sorafenib DMS8IFC Approved Sorafenib decreases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [47]
Imatinib DM7RJXL Approved Imatinib decreases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [51]
Adenosine triphosphate DM79F6G Approved Adenosine triphosphate decreases the activity of RAC-alpha serine/threonine-protein kinase (AKT1). [55]
Morphine DMRMS0L Approved Morphine decreases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [59]
Ximelegatran DMU8ANS Approved Ximelegatran increases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [61]
Nifedipine DMSVOZT Approved Nifedipine decreases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [67]
Lapatinib DM3BH1Y Approved Lapatinib decreases the activity of RAC-alpha serine/threonine-protein kinase (AKT1). [68]
Fludarabine DMVRLT7 Approved Fludarabine increases the activity of RAC-alpha serine/threonine-protein kinase (AKT1). [76]
Phosphate DMUXQG7 Approved Phosphate decreases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [83]
Romiplostim DM3U7SZ Approved Romiplostim decreases the activity of RAC-alpha serine/threonine-protein kinase (AKT1). [85]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [97]
Epigallocatechin gallate DMCGWBJ Phase 3 Epigallocatechin gallate decreases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [98]
Curcumin DMQPH29 Phase 3 Curcumin decreases the expression of RAC-alpha serine/threonine-protein kinase (AKT1). [99]
------------------------------------------------------------------------------------
⏷ Show the Full List of 38 Drug(s)
1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Novobiocin DMRFWGK Approved Novobiocin increases the degradation of RAC-alpha serine/threonine-protein kinase (AKT1). [92]
------------------------------------------------------------------------------------

References

1 A mosaic activating mutation in AKT1 associated with the Proteus syndrome. N Engl J Med. 2011 Aug 18;365(7):611-9. doi: 10.1056/NEJMoa1104017. Epub 2011 Jul 27.
2 Germline PIK3CA and AKT1 mutations in Cowden and Cowden-like syndromes. Am J Hum Genet. 2013 Jan 10;92(1):76-80. doi: 10.1016/j.ajhg.2012.10.021. Epub 2012 Dec 13.
3 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
4 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Insulin-like modulation of Akt/FoxO signaling by copper ions is independent of insulin receptor. Arch Biochem Biophys. 2014 Sep 15;558:42-50. doi: 10.1016/j.abb.2014.06.004. Epub 2014 Jun 13.
7 DeltaNp63alpha confers tumor cell resistance to cisplatin through the AKT1 transcriptional regulation. Cancer Res. 2011 Feb 1;71(3):1167-76. doi: 10.1158/0008-5472.CAN-10-1481. Epub 2011 Jan 25.
8 Molecular mechanism of action of bisphenol and bisphenol A mediated by oestrogen receptor alpha in growth and apoptosis of breast cancer cells. Br J Pharmacol. 2013 May;169(1):167-78.
9 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
10 Reactive oxygen species contribute to arsenic-induced EZH2 phosphorylation in human bronchial epithelial cells and lung cancer cells. Toxicol Appl Pharmacol. 2014 May 1;276(3):165-70. doi: 10.1016/j.taap.2014.02.005. Epub 2014 Feb 25.
11 Quercetin potentiates apoptosis by inhibiting nuclear factor-kappaB signaling in H460 lung cancer cells. Biol Pharm Bull. 2013;36(6):944-51. doi: 10.1248/bpb.b12-01004.
12 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
13 Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
14 Oxidative stress induces parallel autophagy and mitochondria dysfunction in human glioma U251 cells. Toxicol Sci. 2009 Aug;110(2):376-88. doi: 10.1093/toxsci/kfp101. Epub 2009 May 18.
15 Activity of suberoylanilide hydroxamic Acid against human breast cancer cells with amplification of her-2. Clin Cancer Res. 2005 Sep 1;11(17):6382-9. doi: 10.1158/1078-0432.CCR-05-0344.
16 Testosterone or 17{beta}-estradiol exposure reveals sex-specific effects on glucose and lipid metabolism in human myotubes. J Endocrinol. 2011 Aug;210(2):219-29. doi: 10.1530/JOE-10-0497. Epub 2011 Jun 1.
17 Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
18 Functional gene expression profile underlying methotrexate-induced senescence in human colon cancer cells. Tumour Biol. 2011 Oct;32(5):965-76.
19 Evidence that tumor necrosis factor-related apoptosis-inducing ligand induction by 5-Aza-2'-deoxycytidine sensitizes human breast cancer cells to adriamycin. Cancer Res. 2007 Feb 1;67(3):1203-11. doi: 10.1158/0008-5472.CAN-06-2310.
20 Stimulation of the midkine/ALK axis renders glioma cells resistant to cannabinoid antitumoral action. Cell Death Differ. 2011 Jun;18(6):959-73. doi: 10.1038/cdd.2010.170. Epub 2011 Jan 14.
21 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
22 Differential signal transduction of progesterone and medroxyprogesterone acetate in human endothelial cells. Endocrinology. 2004 Dec;145(12):5745-56.
23 Inhibition of Src tyrosine kinase reverts chemoresistance toward 5-fluorouracil in human pancreatic carcinoma cells: an involvement of epidermal growth factor receptor signaling. Oncogene. 2008 Dec 4;27(57):7212-22.
24 Dexamethasone induces apoptosis in proliferative chondrocytes through activation of caspases and suppression of the Akt-phosphatidylinositol 3'-kinase signaling pathway. Endocrinology. 2005 Mar;146(3):1391-7. doi: 10.1210/en.2004-1152. Epub 2004 Dec 2.
25 Niclosamide Exhibits Potent Anticancer Activity and Synergizes with Sorafenib in Human Renal Cell Cancer Cells. Cell Physiol Biochem. 2018;47(3):957-971. doi: 10.1159/000490140. Epub 2018 May 24.
26 Role of miRNA in the regulation of cannabidiol-mediated apoptosis in neuroblastoma cells. Oncotarget. 2019 Jan 1;10(1):45-59. doi: 10.18632/oncotarget.26534. eCollection 2019 Jan 1.
27 Mitochondrial Bax translocation partially mediates synergistic cytotoxicity between histone deacetylase inhibitors and proteasome inhibitors in glioma cells. Neuro Oncol. 2008 Jun;10(3):309-19. doi: 10.1215/15228517-2007-063. Epub 2008 Apr 29.
28 Hydroquinone-induced endoplasmic reticulum stress affects TK6 cell autophagy and apoptosis via ATF6-mTOR. Environ Toxicol. 2023 Aug;38(8):1874-1890. doi: 10.1002/tox.23814. Epub 2023 May 6.
29 Increased PTEN expression due to transcriptional activation of PPARgamma by Lovastatin and Rosiglitazone. Int J Cancer. 2006 May 15;118(10):2390-8. doi: 10.1002/ijc.21799.
30 Prenatal ethanol exposure-induced a low level of foetal blood cholesterol and its mechanism of IGF1-related placental cholesterol transport dysfunction. Toxicology. 2019 Aug 1;424:152237. doi: 10.1016/j.tox.2019.152237. Epub 2019 Jun 18.
31 Lunasin, a novel seed peptide, sensitizes human breast cancer MDA-MB-231 cells to aspirin-arrested cell cycle and induced apoptosis. Chem Biol Interact. 2010 Jul 30;186(2):127-34. doi: 10.1016/j.cbi.2010.04.027. Epub 2010 May 21.
32 Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
33 Nicotine-induced survival signaling in lung cancer cells is dependent on their p53 status while its down-regulation by curcumin is independent. Mol Cancer. 2010 Aug 20;9:220.
34 Combination of arsenic trioxide and Dasatinib: a new strategy to treat Philadelphia chromosome-positive acute lymphoblastic leukaemia. J Cell Mol Med. 2018 Mar;22(3):1614-1626.
35 Early effects of mood stabilizers on the Akt/GSK-3beta signaling pathway and on cell survival and proliferation. Psychopharmacology (Berl). 2009 Aug;205(3):419-29. doi: 10.1007/s00213-009-1551-2. Epub 2009 May 14.
36 Thioredoxin-1 attenuates indomethacin-induced gastric mucosal injury in mice. Free Radic Res. 2007 Aug;41(8):861-9. doi: 10.1080/10715760701199618.
37 Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
38 Mitomycin-C induces the apoptosis of human Tenon's capsule fibroblast by activation of c-Jun N-terminal kinase 1 and caspase-3 protease. Invest Ophthalmol Vis Sci. 2005 Oct;46(10):3545-52. doi: 10.1167/iovs.04-1358.
39 Simvastatin induces apoptosis in human breast cancer cells in a NFkappaB-dependent manner and abolishes the anti-apoptotic signaling of TF/FVIIa and TF/FVIIa/FXa. Thromb Res. 2008;122(2):191-202. doi: 10.1016/j.thromres.2007.09.017. Epub 2007 Nov 26.
40 Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
41 NO-sulindac inhibits the hypoxia response of PC-3 prostate cancer cells via the Akt signalling pathway. Int J Cancer. 2009 Jan 1;124(1):223-32. doi: 10.1002/ijc.23934.
42 Capsaicin induces heme oxygenase-1 expression in HepG2 cells via activation of PI3K-Nrf2 signaling: NAD(P)H:quinone oxidoreductase as a potential target. Antioxid Redox Signal. 2007 Dec;9(12):2087-98.
43 Investigation of the mechanisms by which EB1089 abrogates apoptosis induced by 9-cis retinoic acid in pancreatic cancer cells. Pancreas. 2006 Jan;32(1):93-100.
44 CDK4/6 and IGF1 receptor inhibitors synergize to suppress the growth of p16INK4A-deficient pancreatic cancers. Cancer Res. 2014 Jul 15;74(14):3947-58. doi: 10.1158/0008-5472.CAN-13-2923. Epub 2014 Jul 1.
45 Antimyeloma activity of two novel N-substituted and tetraflourinated thalidomide analogs. Leukemia. 2005 Jul;19(7):1253-61. doi: 10.1038/sj.leu.2403776.
46 3,5,3'-triiodothyronine (T3) is a survival factor for pancreatic beta-cells undergoing apoptosis. J Cell Physiol. 2006 Feb;206(2):309-21. doi: 10.1002/jcp.20460.
47 Therapeutic targeting of hepatocellular carcinoma cells with antrocinol, a novel, dual-specificity, small-molecule inhibitor of the KRAS and ERK oncogenic signaling pathways. Chem Biol Interact. 2023 Jan 25;370:110329. doi: 10.1016/j.cbi.2022.110329. Epub 2022 Dec 22.
48 Ursodeoxycholic acid induces glutathione synthesis through activation of PI3K/Akt pathway in HepG2 cells. Biochem Pharmacol. 2009 Mar 1;77(5):858-66. doi: 10.1016/j.bcp.2008.11.012. Epub 2008 Nov 25.
49 Dihydromyricetin suppresses tumor growth via downregulation of the EGFR/Akt/survivin signaling pathway. J Biochem Mol Toxicol. 2023 Jun;37(6):e23328. doi: 10.1002/jbt.23328. Epub 2023 Feb 19.
50 -Carotene Induces Apoptosis in Human Esophageal Squamous Cell Carcinoma Cell Lines via the Cav-1/AKT/NF-B Signaling Pathway. J Biochem Mol Toxicol. 2016 Mar;30(3):148-57. doi: 10.1002/jbt.21773. Epub 2016 Jan 6.
51 A systems biology understanding of the synergistic effects of arsenic sulfide and Imatinib in BCR/ABL-associated leukemia. Proc Natl Acad Sci U S A. 2009 Mar 3;106(9):3378-83.
52 LC, a novel estrone-rhein hybrid compound, promotes proliferation and differentiation and protects against cell death in human osteoblastic MG-63 cells. Mol Cell Endocrinol. 2011 Sep 15;344(1-2):59-68. doi: 10.1016/j.mce.2011.06.027. Epub 2011 Jul 13.
53 Hydrocortisone and indomethacin negatively modulate EGF-R signaling in human fetal intestine. Pediatr Res. 2007 Nov;62(5):570-5. doi: 10.1203/PDR.0b013e318155ac3b.
54 Cyclooxygenase-2 inhibitor celecoxib augments chemotherapeutic drug-induced apoptosis by enhancing activation of caspase-3 and -9 in prostate cancer cells. Int J Cancer. 2005 Jun 20;115(3):484-92. doi: 10.1002/ijc.20878.
55 Interactive effects of in vitro binge-like alcohol and ATP on umbilical endothelial nitric oxide synthase post-translational modifications and redox modulation. Reprod Toxicol. 2014 Jan;43:94-101.
56 Propofol suppresses proliferation, migration, invasion, and tumor growth of liver cancer cells via suppressing cancer susceptibility candidate 9/phosphatase and tensin homolog/AKT serine/threonine kinase/mechanistic target of rapamycin kinase axis. Hum Exp Toxicol. 2022 Jan-Dec;41:9603271211065972. doi: 10.1177/09603271211065972.
57 Melatonin prevents nitric oxide-induced apoptosis by increasing the interaction between 14-3-3beta and p-Bad in SK-N-MC cells. J Pineal Res. 2008 Jan;44(1):95-100. doi: 10.1111/j.1600-079X.2007.00494.x.
58 Disease-modifying effects of glucosamine HCl involving regulation of metalloproteinases and chemokines activated by interleukin-1beta in human primary synovial fibroblasts. J Cell Biochem. 2008 May 1;104(1):38-50. doi: 10.1002/jcb.21597.
59 beta-arrestin2 inhibits opioid-induced breast cancer cell death through Akt and caspase-8 pathways. Neoplasma. 2009;56(2):108-13. doi: 10.4149/neo_2009_02_108.
60 A novel biologically active acid stable liposomal formulation of docosahexaenoic acid in human breast cancer cell lines. Chem Biol Interact. 2016 May 25;252:1-8. doi: 10.1016/j.cbi.2016.03.035. Epub 2016 Apr 1.
61 Asbestos induces nitric oxide synthesis in mesothelioma cells via Rho signaling inhibition. Am J Respir Cell Mol Biol. 2007 Jun;36(6):746-56. doi: 10.1165/rcmb.2006-0011OC. Epub 2007 Feb 22.
62 Paracrine receptor activation by microenvironment triggers bypass survival signals and ALK inhibitor resistance in EML4-ALK lung cancer cells. Clin Cancer Res. 2012 Jul 1;18(13):3592-602. doi: 10.1158/1078-0432.CCR-11-2972. Epub 2012 May 2.
63 Ciprofloxacin mediates cancer stem cell phenotypes in lung cancer cells through caveolin-1-dependent mechanism. Chem Biol Interact. 2016 Apr 25;250:1-11.
64 Anticancer effects of cantharidin in A431 human skin cancer (Epidermoid carcinoma) cells in vitro and in vivo. Environ Toxicol. 2017 Mar;32(3):723-738. doi: 10.1002/tox.22273. Epub 2016 Apr 25.
65 Low-expressional IGF1 mediated methimazole-induced liver developmental toxicity in fetal mice. Toxicology. 2018 Sep 1;408:70-79. doi: 10.1016/j.tox.2018.07.004. Epub 2018 Jul 7.
66 Blocking downstream signaling pathways in the context of HDAC inhibition promotes apoptosis preferentially in cells harboring mutant Ras. Oncotarget. 2016 Oct 25;7(43):69804-69815. doi: 10.18632/oncotarget.12001.
67 Nifedipine inhibits vascular smooth muscle cell dedifferentiation via downregulation of Akt signaling. Hypertension. 2010 Aug;56(2):247-52. doi: 10.1161/HYPERTENSIONAHA.110.149781. Epub 2010 Jun 7.
68 The dual ErbB1/ErbB2 inhibitor, lapatinib (GW572016), cooperates with tamoxifen to inhibit both cell proliferation- and estrogen-dependent gene expression in antiestrogen-resistant breast cancer. Cancer Res. 2005 Jan 1;65(1):18-25.
69 TNF enhances trovafloxacin-induced in vitro hepatotoxicity by inhibiting protective autophagy. Toxicol Lett. 2021 May 15;342:73-84. doi: 10.1016/j.toxlet.2021.02.009. Epub 2021 Feb 17.
70 Propranolol inhibits proliferation and invasion of hemangioma-derived endothelial cells by suppressing the DLL4/Notch1/Akt pathway. Chem Biol Interact. 2018 Oct 1;294:28-33. doi: 10.1016/j.cbi.2018.08.018. Epub 2018 Aug 18.
71 Reactive oxygen species and lipoxygenases regulate the oncogenicity of NPM-ALK-positive anaplastic large cell lymphomas. Oncogene. 2009 Jul 23;28(29):2690-6.
72 Autophagy inhibition induces enhanced proapoptotic effects of ZD6474 in glioblastoma. Br J Cancer. 2013 Jul 9;109(1):164-71. doi: 10.1038/bjc.2013.306. Epub 2013 Jun 25.
73 Dihydroorotate dehydrogenase inhibitor A771726 (leflunomide) induces apoptosis and diminishes proliferation of multiple myeloma cells. Mol Cancer Ther. 2009 Feb;8(2):366-75. doi: 10.1158/1535-7163.MCT-08-0664. Epub 2009 Jan 27.
74 Homoharringtonine suppresses LoVo cell growth by inhibiting EphB4 and the PI3K/AKT and MAPK/EKR1/2 signaling pathways. Food Chem Toxicol. 2020 Feb;136:110960. doi: 10.1016/j.fct.2019.110960. Epub 2019 Nov 11.
75 Ropivacaine inhibits proliferation?and invasion?and promotes apoptosis and autophagy in bladder cancer cells via inhibiting PI3K/AKT pathway. J Biochem Mol Toxicol. 2023 Jan;37(1):e23233. doi: 10.1002/jbt.23233. Epub 2022 Oct 3.
76 The histone deacetylase inhibitor MS-275 interacts synergistically with fludarabine to induce apoptosis in human leukemia cells. Cancer Res. 2004 Apr 1;64(7):2590-600. doi: 10.1158/0008-5472.can-03-2631.
77 BET protein antagonist JQ1 is synergistically lethal with FLT3 tyrosine kinase inhibitor (TKI) and overcomes resistance to FLT3-TKI in AML cells expressing FLT-ITD. Mol Cancer Ther. 2014 Oct;13(10):2315-27. doi: 10.1158/1535-7163.MCT-14-0258. Epub 2014 Jul 22.
78 Lung tumorigenesis promoted by anti-apoptotic effects of cotinine, a nicotine metabolite through activation of PI3K/Akt pathway. J Toxicol Sci. 2012;37(3):555-63. doi: 10.2131/jts.37.555.
79 Cilostazol inhibits oxidative stress-induced premature senescence via upregulation of Sirt1 in human endothelial cells. Arterioscler Thromb Vasc Biol. 2008 Sep;28(9):1634-9. doi: 10.1161/ATVBAHA.108.164368. Epub 2008 Jun 12.
80 Effect of toll-like receptor 7 and 9 targeted therapy to prevent the development of hepatocellular carcinoma. Liver Int. 2015 Mar;35(3):1063-76. doi: 10.1111/liv.12626. Epub 2014 Jul 30.
81 P21(Waf1/Cip1) plays a critical role in furazolidone-induced apoptosis in HepG2 cells through influencing the caspase-3 activation and ROS generation. Food Chem Toxicol. 2016 Feb;88:1-12. doi: 10.1016/j.fct.2015.12.004. Epub 2015 Dec 11.
82 Miconazole induces protective autophagy in bladder cancer cells. Environ Toxicol. 2021 Feb;36(2):185-193. doi: 10.1002/tox.23024. Epub 2020 Sep 27.
83 High expression of the Pi-transporter SLC20A1/Pit1 in calcific aortic valve disease promotes mineralization through regulation of Akt-1. PLoS One. 2013;8(1):e53393. doi: 10.1371/journal.pone.0053393. Epub 2013 Jan 4.
84 Combination small molecule MEK and PI3K inhibition enhances uveal melanoma cell death in a mutant GNAQ- and GNA11-dependent manner. Clin Cancer Res. 2012 Aug 15;18(16):4345-55. doi: 10.1158/1078-0432.CCR-11-3227. Epub 2012 Jun 25.
85 SU5416 inhibited VEGF and HIF-1alpha expression through the PI3K/AKT/p70S6K1 signaling pathway. Biochem Biophys Res Commun. 2004 Nov 12;324(2):471-80. doi: 10.1016/j.bbrc.2004.09.082.
86 The effect of quercetin nanoparticle on cervical cancer progression by inducing apoptosis, autophagy and anti-proliferation via JAK2 suppression. Biomed Pharmacother. 2016 Aug;82:595-605. doi: 10.1016/j.biopha.2016.05.029. Epub 2016 Jun 9.
87 H(1)R mediates local anesthetic-induced vascular permeability in angioedema. Toxicol Appl Pharmacol. 2020 Apr 1;392:114921. doi: 10.1016/j.taap.2020.114921. Epub 2020 Feb 12.
88 Aspidin PB, a phloroglucinol derivative, induces apoptosis in human hepatocarcinoma HepG2 cells by modulating PI3K/Akt/GSK3 pathway. Chem Biol Interact. 2013 Jan 25;201(1-3):1-8. doi: 10.1016/j.cbi.2012.11.005. Epub 2012 Nov 21.
89 Induction of prolonged early G1 arrest by CDK4/CDK6 inhibition reprograms lymphoma cells for durable PI3K inhibition through PIK3IP1. Cell Cycle. 2013 Jun 15;12(12):1892-900. doi: 10.4161/cc.24928. Epub 2013 May 15.
90 Inhibition of cholesterol metabolism underlies synergy between mTOR pathway inhibition and chloroquine in bladder cancer cells. Oncogene. 2016 Aug 25;35(34):4518-28. doi: 10.1038/onc.2015.511. Epub 2016 Feb 8.
91 Efficacy of a nitrogen-containing bisphosphonate, minodronate, in conjunction with a p38 mitogen activated protein kinase inhibitor or doxorubicin against malignant bone tumor cells. Cancer Chemother Pharmacol. 2008 Jun;62(1):111-6. doi: 10.1007/s00280-007-0580-y. Epub 2007 Sep 15.
92 Inhibiting heat-shock protein 90 reverses sensory hypoalgesia in diabetic mice. ASN Neuro. 2010 Aug 11;2(4):e00040. doi: 10.1042/AN20100015.
93 Inflammatory signal transduction pathways induced by prilocaine toxicity in cultured ARPE-19 cells. J Biochem Mol Toxicol. 2023 Dec;37(12):e23491. doi: 10.1002/jbt.23491. Epub 2023 Aug 10.
94 PI3K/AKT inhibitors aggravate death receptor-mediated hepatocyte apoptosis and liver injury. Toxicol Appl Pharmacol. 2019 Oct 15;381:114729. doi: 10.1016/j.taap.2019.114729. Epub 2019 Aug 22.
95 Autophagy Induced by Naftopidil Inhibits Apoptosis of Human Gastric Cancer Cells. Anticancer Res. 2018 Feb;38(2):803-809. doi: 10.21873/anticanres.12287.
96 Dual down-regulation of EGFR and ErbB2 by berberine contributes to suppression of migration and invasion of human ovarian cancer cells. Environ Toxicol. 2021 May;36(5):737-747. doi: 10.1002/tox.23076. Epub 2020 Dec 16.
97 Biochemical and cellular evidence demonstrating AKT-1 as a binding partner for resveratrol targeting protein NQO2. PLoS One. 2014 Jun 26;9(6):e101070. doi: 10.1371/journal.pone.0101070. eCollection 2014.
98 Low dose epigallocatechin-3-gallate revives doxorubicin responsiveness by a redox-sensitive pathway in A549 lung adenocarcinoma cells. J Biochem Mol Toxicol. 2022 Apr;36(4):e22999. doi: 10.1002/jbt.22999. Epub 2022 Feb 26.
99 Novel carbocyclic curcumin analog CUR3d modulates genes involved in multiple apoptosis pathways in human hepatocellular carcinoma cells. Chem Biol Interact. 2015 Dec 5;242:107-22.
100 The phosphoinositide 3-kinase/AKT1 pathway involvement in drug and all-trans-retinoic acid resistance of leukemia cells. Mol Cancer Res. 2003 Jan;1(3):234-46.
101 Selective cell death of oncogenic Akt-transduced brain cancer cells by etoposide through reactive oxygen species mediated damage. Mol Cancer Ther. 2007 Aug;6(8):2178-87. doi: 10.1158/1535-7163.MCT-07-0111.
102 Differential roles of phosphoinositide-dependent protein kinase-1 and akt1 expression and phosphorylation in breast cancer cell resistance to Paclitaxel, Doxorubicin, and gemcitabine. Mol Pharmacol. 2006 Sep;70(3):1045-52. doi: 10.1124/mol.106.023333. Epub 2006 Jun 16.
103 Carmustine-resistant cancer cells are sensitized to temozolomide as a result of enhanced mismatch repair during the development of carmustine resistance. Mol Pharmacol. 2008 Jul;74(1):82-91. doi: 10.1124/mol.107.041988. Epub 2008 Apr 22.
104 RNA interference demonstrates a novel role for integrin-linked kinase as a determinant of pancreatic adenocarcinoma cell gemcitabine chemoresistance. Clin Cancer Res. 2005 May 1;11(9):3433-8. doi: 10.1158/1078-0432.CCR-04-1510.
105 Positive association of AKT1 haplotype to Japanese methamphetamine use disorder. Int J Neuropsychopharmacol. 2006 Feb;9(1):77-81. doi: 10.1017/S1461145705005481. Epub 2005 Jun 28.
106 Daunorubicin induces cell death via activation of apoptotic signalling pathway and inactivation of survival pathway in muscle-derived stem cells. Cell Biol Toxicol. 2012 Apr;28(2):103-14. doi: 10.1007/s10565-011-9210-x. Epub 2012 Jan 18.
107 DRD2/AKT1 interaction on D2 c-AMP independent signaling, attentional processing, and response to olanzapine treatment in schizophrenia. Proc Natl Acad Sci U S A. 2011 Jan 18;108(3):1158-63. doi: 10.1073/pnas.1013535108. Epub 2010 Dec 27.
108 Adenoviral gene transfer of Akt enhances myocardial contractility and intracellular calcium handling. Gene Ther. 2006 Jan;13(1):8-19. doi: 10.1038/sj.gt.3302589.
109 ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
110 Characterization of the mechanism of action of the pan class I PI3K inhibitor NVP-BKM120 across a broad range of concentrations. Mol Cancer Ther. 2012 Aug;11(8):1747-57. doi: 10.1158/1535-7163.MCT-11-1021. Epub 2012 May 31.
111 From the cyclooxygenase-2 inhibitor celecoxib to a novel class of 3-phosphoinositide-dependent protein kinase-1 inhibitors. Cancer Res. 2004 Jun 15;64(12):4309-18. doi: 10.1158/0008-5472.CAN-03-4063.
112 The cyclooxygenase-2 inhibitor celecoxib induces apoptosis by blocking Akt activation in human prostate cancer cells independently of Bcl-2. J Biol Chem. 2000 Apr 14;275(15):11397-403. doi: 10.1074/jbc.275.15.11397.
113 Anti-apoptotic proteins and catalase-dependent apoptosis resistance in nickel chloride-transformed human lung epithelial cells. Int J Oncol. 2013 Sep;43(3):936-46. doi: 10.3892/ijo.2013.2004. Epub 2013 Jul 3.
114 Akt phosphorylates and suppresses the transactivation of retinoic acid receptor alpha. Biochem J. 2006 May 1;395(3):653-62. doi: 10.1042/BJ20051794.