Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9DVHC0)

DOT Name Apoptosis regulator Bcl-2 (BCL2)
Gene Name BCL2
UniProt ID
BCL2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1G5M ; 1GJH ; 1YSW ; 2O21 ; 2O22 ; 2O2F ; 2W3L ; 2XA0 ; 4AQ3 ; 4IEH ; 4LVT ; 4LXD ; 4MAN ; 5AGW ; 5AGX ; 5FCG ; 5JSN ; 5VAU ; 5VAX ; 5VAY ; 6GL8 ; 6IWB ; 6O0K ; 6O0L ; 6O0M ; 6O0O ; 6O0P ; 7LHB ; 7Y90 ; 7YA5 ; 8HLL ; 8HLM ; 8HLN ; 8U27
Pfam ID
PF00452 ; PF02180
Sequence
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Function
Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). Also acts as an inhibitor of autophagy: interacts with BECN1 and AMBRA1 during non-starvation conditions and inhibits their autophagy function. May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release.
Tissue Specificity Expressed in a variety of tissues.
KEGG Pathway
EGFR tyrosine ki.se inhibitor resistance (hsa01521 )
Endocrine resistance (hsa01522 )
Platinum drug resistance (hsa01524 )
NF-kappa B sig.ling pathway (hsa04064 )
HIF-1 sig.ling pathway (hsa04066 )
Sphingolipid sig.ling pathway (hsa04071 )
p53 sig.ling pathway (hsa04115 )
Autophagy - animal (hsa04140 )
Protein processing in endoplasmic reticulum (hsa04141 )
PI3K-Akt sig.ling pathway (hsa04151 )
Apoptosis (hsa04210 )
Apoptosis - multiple species (hsa04215 )
Necroptosis (hsa04217 )
Adrenergic sig.ling in cardiomyocytes (hsa04261 )
Hedgehog sig.ling pathway (hsa04340 )
Focal adhesion (hsa04510 )
NOD-like receptor sig.ling pathway (hsa04621 )
JAK-STAT sig.ling pathway (hsa04630 )
Neurotrophin sig.ling pathway (hsa04722 )
Cholinergic sy.pse (hsa04725 )
Estrogen sig.ling pathway (hsa04915 )
Parathyroid hormone synthesis, secretion and action (hsa04928 )
AGE-RAGE sig.ling pathway in diabetic complications (hsa04933 )
Amyotrophic lateral sclerosis (hsa05014 )
Pathways of neurodegeneration - multiple diseases (hsa05022 )
Shigellosis (hsa05131 )
Salmonella infection (hsa05132 )
Toxoplasmosis (hsa05145 )
Tuberculosis (hsa05152 )
Hepatitis B (hsa05161 )
Measles (hsa05162 )
Herpes simplex virus 1 infection (hsa05168 )
Epstein-Barr virus infection (hsa05169 )
Human immunodeficiency virus 1 infection (hsa05170 )
Pathways in cancer (hsa05200 )
MicroR.s in cancer (hsa05206 )
Chemical carcinogenesis - receptor activation (hsa05207 )
Colorectal cancer (hsa05210 )
Prostate cancer (hsa05215 )
Small cell lung cancer (hsa05222 )
Gastric cancer (hsa05226 )
Lipid and atherosclerosis (hsa05417 )
Fluid shear stress and atherosclerosis (hsa05418 )
Reactome Pathway
BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members (R-HSA-111453 )
Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807 )
The NLRP1 inflammasome (R-HSA-844455 )
Estrogen-dependent gene expression (R-HSA-9018519 )
Estrogen-dependent nuclear events downstream of ESR-membrane signaling (R-HSA-9634638 )
NFE2L2 regulating tumorigenic genes (R-HSA-9818030 )
Activation of BAD and translocation to mitochondria (R-HSA-111447 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 14 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Dexamethasone DMMWZET Approved Apoptosis regulator Bcl-2 (BCL2) decreases the response to substance of Dexamethasone. [100]
Etoposide DMNH3PG Approved Apoptosis regulator Bcl-2 (BCL2) increases the Gene mutation ADR of Etoposide. [101]
Irinotecan DMP6SC2 Approved Apoptosis regulator Bcl-2 (BCL2) affects the response to substance of Irinotecan. [102]
Paclitaxel DMLB81S Approved Apoptosis regulator Bcl-2 (BCL2) decreases the response to substance of Paclitaxel. [103]
Fluoxetine DM3PD2C Approved Apoptosis regulator Bcl-2 (BCL2) decreases the response to substance of Fluoxetine. [104]
Deoxycholic acid DM3GYAL Approved Apoptosis regulator Bcl-2 (BCL2) decreases the response to substance of Deoxycholic acid. [105]
Amsacrine DMZKYIV Approved Apoptosis regulator Bcl-2 (BCL2) decreases the response to substance of Amsacrine. [106]
Ropivacaine DMSPJG2 Approved Apoptosis regulator Bcl-2 (BCL2) decreases the response to substance of Ropivacaine. [107]
ABT-737 DML0DBV Terminated Apoptosis regulator Bcl-2 (BCL2) decreases the response to substance of ABT-737. [108]
Chrysin DM7V2LG Investigative Apoptosis regulator Bcl-2 (BCL2) decreases the response to substance of Chrysin. [109]
THIOCTIC ACID DMNFCXW Investigative Apoptosis regulator Bcl-2 (BCL2) decreases the response to substance of THIOCTIC ACID. [110]
Borrelidin DMBSQTR Investigative Apoptosis regulator Bcl-2 (BCL2) decreases the response to substance of Borrelidin. [111]
Azide DM5XZYB Investigative Apoptosis regulator Bcl-2 (BCL2) decreases the response to substance of Azide. [112]
10-hydroxycamptothecin DM9WLN4 Investigative Apoptosis regulator Bcl-2 (BCL2) decreases the response to substance of 10-hydroxycamptothecin. [113]
------------------------------------------------------------------------------------
⏷ Show the Full List of 14 Drug(s)
99 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [6]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [7]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [8]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [9]
Arsenic DMTL2Y1 Approved Arsenic increases the expression of Apoptosis regulator Bcl-2 (BCL2). [10]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [11]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [12]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [13]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [14]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [15]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [16]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [17]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [18]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [19]
Decitabine DMQL8XJ Approved Decitabine decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [20]
Zoledronate DMIXC7G Approved Zoledronate decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [21]
Selenium DM25CGV Approved Selenium decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [22]
Menadione DMSJDTY Approved Menadione decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [23]
Fluorouracil DMUM7HZ Approved Fluorouracil decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [24]
Panobinostat DM58WKG Approved Panobinostat decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [25]
Folic acid DMEMBJC Approved Folic acid increases the expression of Apoptosis regulator Bcl-2 (BCL2). [26]
Niclosamide DMJAGXQ Approved Niclosamide decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [27]
Cannabidiol DM0659E Approved Cannabidiol decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [28]
Isotretinoin DM4QTBN Approved Isotretinoin increases the expression of Apoptosis regulator Bcl-2 (BCL2). [29]
Bortezomib DMNO38U Approved Bortezomib decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [30]
Troglitazone DM3VFPD Approved Troglitazone decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [31]
Hydroquinone DM6AVR4 Approved Hydroquinone increases the expression of Apoptosis regulator Bcl-2 (BCL2). [32]
Rosiglitazone DMILWZR Approved Rosiglitazone decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [33]
Ethanol DMDRQZU Approved Ethanol decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [34]
Cytarabine DMZD5QR Approved Cytarabine decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [35]
Aspirin DM672AH Approved Aspirin decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [36]
Diclofenac DMPIHLS Approved Diclofenac increases the expression of Apoptosis regulator Bcl-2 (BCL2). [37]
Nicotine DMWX5CO Approved Nicotine increases the expression of Apoptosis regulator Bcl-2 (BCL2). [38]
Dasatinib DMJV2EK Approved Dasatinib decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [39]
DTI-015 DMXZRW0 Approved DTI-015 decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [40]
Malathion DMXZ84M Approved Malathion increases the expression of Apoptosis regulator Bcl-2 (BCL2). [41]
Indomethacin DMSC4A7 Approved Indomethacin decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [42]
Menthol DMG2KW7 Approved Menthol decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [43]
Mitomycin DMH0ZJE Approved Mitomycin increases the expression of Apoptosis regulator Bcl-2 (BCL2). [44]
Permethrin DMZ0Q1G Approved Permethrin increases the expression of Apoptosis regulator Bcl-2 (BCL2). [45]
Cidofovir DMA13GD Approved Cidofovir decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [46]
Simvastatin DM30SGU Approved Simvastatin decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [47]
Topotecan DMP6G8T Approved Topotecan decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [19]
Gemcitabine DMSE3I7 Approved Gemcitabine decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [48]
Melphalan DMOLNHF Approved Melphalan decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [49]
Obeticholic acid DM3Q1SM Approved Obeticholic acid increases the expression of Apoptosis regulator Bcl-2 (BCL2). [50]
Fenofibrate DMFKXDY Approved Fenofibrate decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [51]
Rifampicin DM5DSFZ Approved Rifampicin increases the expression of Apoptosis regulator Bcl-2 (BCL2). [52]
Mitoxantrone DMM39BF Approved Mitoxantrone decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [53]
Cyclophosphamide DM4O2Z7 Approved Cyclophosphamide increases the expression of Apoptosis regulator Bcl-2 (BCL2). [54]
Mifepristone DMGZQEF Approved Mifepristone decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [55]
Zidovudine DM4KI7O Approved Zidovudine decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [56]
Sulindac DM2QHZU Approved Sulindac decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [57]
Capsaicin DMGMF6V Approved Capsaicin increases the expression of Apoptosis regulator Bcl-2 (BCL2). [58]
Alitretinoin DMME8LH Approved Alitretinoin decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [59]
Methamphetamine DMPM4SK Approved Methamphetamine decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [60]
Daunorubicin DMQUSBT Approved Daunorubicin decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [61]
Acocantherin DM7JT24 Approved Acocantherin decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [62]
Thalidomide DM70BU5 Approved Thalidomide decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [63]
Liothyronine DM6IR3P Approved Liothyronine increases the expression of Apoptosis regulator Bcl-2 (BCL2). [64]
Lindane DMB8CNL Approved Lindane increases the expression of Apoptosis regulator Bcl-2 (BCL2). [65]
Bicalutamide DMZMSPF Approved Bicalutamide increases the expression of Apoptosis regulator Bcl-2 (BCL2). [66]
Colchicine DM2POTE Approved Colchicine decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [67]
Vitamin C DMXJ7O8 Approved Vitamin C decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [68]
Sorafenib DMS8IFC Approved Sorafenib decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [69]
Ursodeoxycholic acid DMCUT21 Approved Ursodeoxycholic acid decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [70]
Beta-carotene DM0RXBT Approved Beta-carotene decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [71]
Imatinib DM7RJXL Approved Imatinib decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [72]
Sertraline DM0FB1J Approved Sertraline decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [73]
Ritonavir DMU764S Approved Ritonavir decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [74]
Dinoprostone DMTYOPD Approved Dinoprostone increases the expression of Apoptosis regulator Bcl-2 (BCL2). [75]
Dactinomycin DM2YGNW Approved Dactinomycin decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [76]
Docetaxel DMDI269 Approved Docetaxel decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [77]
Cholecalciferol DMGU74E Approved Cholecalciferol decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [78]
Dopamine DMPGUCF Approved Dopamine decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [79]
Nitric Oxide DM1RBYG Approved Nitric Oxide decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [80]
Lovastatin DM9OZWQ Approved Lovastatin decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [81]
Ardeparin DMYRX8B Approved Ardeparin increases the expression of Apoptosis regulator Bcl-2 (BCL2). [82]
Propofol DMB4OLE Approved Propofol decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [83]
Melatonin DMKWFBT Approved Melatonin decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [84]
Artesunate DMR27C8 Approved Artesunate decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [85]
Sevoflurane DMC9O43 Approved Sevoflurane decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [86]
Isoniazid DM5JVS3 Approved Isoniazid decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [87]
Morphine DMRMS0L Approved Morphine decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [88]
Eicosapentaenoic acid/docosa-hexaenoic acid DMMUCG4 Approved Eicosapentaenoic acid/docosa-hexaenoic acid decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [89]
Ximelegatran DMU8ANS Approved Ximelegatran increases the expression of Apoptosis regulator Bcl-2 (BCL2). [90]
Penicillamine DM40EF6 Approved Penicillamine decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [91]
Cantharidin DMBP5N3 Approved Cantharidin decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [92]
Cimetidine DMH61ZB Approved Cimetidine decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [94]
Hesperetin DMKER83 Approved Hesperetin decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [95]
Fructose DM43AN2 Approved Fructose increases the expression of Apoptosis regulator Bcl-2 (BCL2). [96]
Nifedipine DMSVOZT Approved Nifedipine decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [97]
Nilotinib DM7HXWT Approved Nilotinib decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [98]
Lapatinib DM3BH1Y Approved Lapatinib decreases the expression of Apoptosis regulator Bcl-2 (BCL2). [99]
------------------------------------------------------------------------------------
⏷ Show the Full List of 99 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Mebendazole DMO14SG Approved Mebendazole increases the phosphorylation of Apoptosis regulator Bcl-2 (BCL2). [93]
------------------------------------------------------------------------------------

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Enhancement by cyclosporin A of taxol-induced apoptosis of human urinary bladder cancer cells. Urol Res. 2002 May;30(2):102-11. doi: 10.1007/s00240-002-0239-4.
3 Par-4 transcriptionally regulates Bcl-2 through a WT1-binding site on the bcl-2 promoter. J Biol Chem. 2003 May 30;278(22):19995-20005. doi: 10.1074/jbc.M205865200. Epub 2003 Mar 17.
4 Paracetamol inhibits cell cycling and induces apoptosis in HL-60 cells. Pharmacol Toxicol. 1997 Dec;81(6):285-93.
5 Adriamycin-induced cardiomyocyte and endothelial cell apoptosis: in vitro and in vivo studies. J Mol Cell Cardiol. 2002 Dec;34(12):1595-607. doi: 10.1006/jmcc.2002.2110.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Breast cancer cells response to the antineoplastic agents cisplatin, carboplatin, and doxorubicin at the mRNA expression levels of distinct apoptosis-related genes, including the new member, BCL2L12. Ann N Y Acad Sci. 2007 Jan;1095:35-44. doi: 10.1196/annals.1397.005.
8 (4-Picolylamino)-17-Estradiol derivative and analogues induce apoptosis with death receptor trail R2/DR5 in MCF-7. Chem Biol Interact. 2023 Jan 5;369:110286. doi: 10.1016/j.cbi.2022.110286. Epub 2022 Nov 29.
9 Ivermectin accelerates autophagic death of glioma cells by inhibiting glycolysis through blocking GLUT4 mediated JAK/STAT signaling pathway activation. Environ Toxicol. 2022 Apr;37(4):754-764. doi: 10.1002/tox.23440. Epub 2021 Dec 14.
10 Transcriptomics and methylomics of CD4-positive T cells in arsenic-exposed women. Arch Toxicol. 2017 May;91(5):2067-2078. doi: 10.1007/s00204-016-1879-4. Epub 2016 Nov 12.
11 Quercetin down-regulated bcl-2 gene expression in human leukemia HL-60 cells. Zhongguo Yao Li Xue Bao. 1998 Nov;19(6):551-3.
12 Pyrrolotetrazinones deazaanalogues of temozolomide induce apoptosis in Jurkat cell line: involvement of tubulin polymerization inhibition. Cancer Chemother Pharmacol. 2009 Nov;64(6):1235-51. doi: 10.1007/s00280-009-0994-9. Epub 2009 Apr 11.
13 Overexpression of Bcl-2 partly inhibits apoptosis of human cervical cancer SiHa cells induced by arsenic trioxide. Chin Med J (Engl). 2000 Jan;113(1):84-8.
14 NF-B potentiates caspase independent hydrogen peroxide induced cell death. PLoS One. 2011 Feb 15;6(2):e16815. doi: 10.1371/journal.pone.0016815.
15 Genistein potentiates the growth inhibitory effects of 1,25-dihydroxyvitamin D3 in DU145 human prostate cancer cells: role of the direct inhibition of CYP24 enzyme activity. Mol Cell Endocrinol. 2005 Sep 28;241(1-2):49-61.
16 Suberoylanilide hydroxamic acid (Zolinza/vorinostat) sensitizes TRAIL-resistant breast cancer cells orthotopically implanted in BALB/c nude mice. Mol Cancer Ther. 2009 Jun;8(6):1596-605. doi: 10.1158/1535-7163.MCT-08-1004. Epub 2009 Jun 9.
17 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
18 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
19 Topotecan and methotrexate alter expression of the apoptosis-related genes BCL2, FAS and BCL2L12 in leukemic HL-60 cells. Biol Chem. 2006 Dec;387(12):1629-33. doi: 10.1515/BC.2006.203.
20 DNA demethylation by 5-aza-2-deoxycytidine treatment abrogates 17 beta-estradiol-induced cell growth and restores expression of DNA repair genes in human breast cancer cells. Cancer Lett. 2012 Mar;316(1):62-9. doi: 10.1016/j.canlet.2011.10.022. Epub 2011 Oct 23.
21 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
22 Lack of effect of oral selenite on p53 associated gene expression during TL01 therapy of psoriasis patients. Photodermatol Photoimmunol Photomed. 2007 Apr-Jun;23(2-3):98-100. doi: 10.1111/j.1600-0781.2007.00277.x.
23 Modulation of notch signaling pathway to prevent H2O2/menadione-induced SK-N-MC cells death by EUK134. Cell Mol Neurobiol. 2014 Oct;34(7):1037-45. doi: 10.1007/s10571-014-0079-0. Epub 2014 Jul 9.
24 DNA damaging drugs-induced down-regulation of Bcl-2 is essential for induction of apoptosis in high-risk HPV-positive HEp-2 and KB cells. Cancer Lett. 2006 May 18;236(2):213-21. doi: 10.1016/j.canlet.2005.05.024. Epub 2005 Jul 5.
25 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
26 Higher Concentrations of Folic Acid Cause Oxidative Stress, Acute Cytotoxicity, and Long-Term Fibrogenic Changes in Kidney Epithelial Cells. Chem Res Toxicol. 2022 Nov 21;35(11):2168-2179. doi: 10.1021/acs.chemrestox.2c00258. Epub 2022 Nov 10.
27 Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
28 Cannabidiol enhances cytotoxicity of anti-cancer drugs in human head and neck squamous cell carcinoma. Sci Rep. 2020 Nov 26;10(1):20622. doi: 10.1038/s41598-020-77674-y.
29 Antagonism of cytotoxic chemotherapy in neuroblastoma cell lines by 13-cis-retinoic acid is mediated by the antiapoptotic Bcl-2 family proteins. Mol Cancer Ther. 2010 Dec;9(12):3164-74. doi: 10.1158/1535-7163.MCT-10-0078.
30 Reduction in BCL-2 levels by 26S proteasome inhibition with bortezomib is associated with induction of apoptosis in small cell lung cancer. Lung Cancer. 2005 Aug;49(2):163-70. doi: 10.1016/j.lungcan.2005.01.006.
31 Activation of peroxisome proliferator-activated receptor-gamma by troglitazone (TGZ) inhibits human lung cell growth. J Cell Biochem. 2005 Nov 1;96(4):760-74. doi: 10.1002/jcb.20474.
32 Hydroquinone-induced malignant transformation of TK6 cells by facilitating SIRT1-mediated p53 degradation and up-regulating KRAS. Toxicol Lett. 2016 Sep 30;259:133-142. doi: 10.1016/j.toxlet.2016.08.006. Epub 2016 Aug 8.
33 Inhibition of COX-2 and activation of peroxisome proliferator-activated receptor gamma synergistically inhibits proliferation and induces apoptosis of human pancreatic carcinoma cells. Cancer Lett. 2009 Mar 18;275(2):247-55. doi: 10.1016/j.canlet.2008.10.023. Epub 2008 Dec 3.
34 miR-497 and miR-302b regulate ethanol-induced neuronal cell death through BCL2 protein and cyclin D2. J Biol Chem. 2011 Oct 28;286(43):37347-57. doi: 10.1074/jbc.M111.235531. Epub 2011 Aug 30.
35 Granulocyte-macrophage colony-stimulating factor/interleukin-3 fusion protein (pIXY 321) enhances high-dose Ara-C-induced programmed cell death or apoptosis in human myeloid leukemia cells. Blood. 1992 Dec 1;80(11):2883-90.
36 Pretreatment of acetylsalicylic acid promotes tumor necrosis factor-related apoptosis-inducing ligand-induced apoptosis by down-regulating BCL-2 gene expression. J Biol Chem. 2005 Dec 9;280(49):41047-56. doi: 10.1074/jbc.M503713200. Epub 2005 Sep 30.
37 Development of an alternative zebrafish model for drug-induced intestinal toxicity. J Appl Toxicol. 2018 Feb;38(2):259-273. doi: 10.1002/jat.3520. Epub 2017 Oct 13.
38 Long term effects of cigarette smoke extract or nicotine on nerve growth factor and its receptors in a bronchial epithelial cell line. Toxicol In Vitro. 2018 Dec;53:29-36. doi: 10.1016/j.tiv.2018.07.020. Epub 2018 Aug 1.
39 Dasatinib induces autophagic cell death in human ovarian cancer. Cancer. 2010 Nov 1;116(21):4980-90. doi: 10.1002/cncr.25426.
40 BCNU down-regulates anti-apoptotic proteins bcl-xL and Bcl-2 in association with cell death in oligodendroglioma-derived cells. J Neurooncol. 2004 Jul;68(3):233-41. doi: 10.1023/b:neon.0000033382.40601.5a.
41 Different Toxic Effects of Racemate, Enantiomers, and Metabolite of Malathion on HepG2 Cells Using High-Performance Liquid Chromatography-Quadrupole-Time-of-Flight-Based Metabolomics. J Agric Food Chem. 2019 Feb 20;67(7):1784-1794. doi: 10.1021/acs.jafc.8b04536. Epub 2019 Feb 8.
42 Indomethacin induces apoptosis and inhibits proliferation in chronic myeloid leukemia cells. Leuk Res. 2000 May;24(5):385-92. doi: 10.1016/s0145-2126(99)00198-8.
43 Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
44 The growth-inhibition effect of tamoxifen in the combination chemotherapeutics on the human cholangiocarcinoma cell line QBC939. Mol Biol Rep. 2010 Jul;37(6):2693-701. doi: 10.1007/s11033-009-9801-2. Epub 2009 Sep 13.
45 "Exposure to the insecticides permethrin and malathion induces leukemia and lymphoma-associated gene aberrations in vitro". Toxicol In Vitro. 2017 Oct;44:17-26. doi: 10.1016/j.tiv.2017.06.013. Epub 2017 Jun 15.
46 Antiviral agent cidofovir decreases Epstein-Barr virus (EBV) oncoproteins and enhances the radiosensitivity in EBV-related malignancies. Oncogene. 2003 Apr 17;22(15):2260-71. doi: 10.1038/sj.onc.1206402.
47 Inhibition of Barret's adenocarcinoma cell growth by simvastatin: involvement of COX-2 and apoptosis-related proteins. J Physiol Pharmacol. 2007 Aug;58 Suppl 3:141-8.
48 Extracellular signal-regulated kinase activation and Bcl-2 downregulation mediate apoptosis after gemcitabine treatment partly via a p53-independent pathway. Eur J Pharmacol. 2004 Oct 19;502(3):169-83. doi: 10.1016/j.ejphar.2004.09.006.
49 Increased expression of VDAC1 sensitizes carcinoma cells to apoptosis induced by DNA cross-linking agents. Biochem Pharmacol. 2012 May 1;83(9):1172-82. doi: 10.1016/j.bcp.2012.01.017. Epub 2012 Jan 21.
50 Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
51 Fenofibrate induces apoptotic injury in cultured human hepatocytes by inhibiting phosphorylation of Akt. Apoptosis. 2005 Mar;10(2):349-58. doi: 10.1007/s10495-005-0809-3.
52 Rifampicin inhibits CD95-mediated apoptosis of Jurkat T cells via glucocorticoid receptors by modifying the expression of molecules regulating apoptosis. J Clin Immunol. 2002 Jan;22(1):37-47. doi: 10.1023/a:1014256603539.
53 High-dose mitoxantrone induces programmed cell death or apoptosis in human myeloid leukemia cells. Blood. 1993 Nov 15;82(10):3133-40.
54 The differential effects of cyclophosphamide, epirubicin and 5-fluorouracil on apoptotic marker (CPP-32), pro-apoptotic protein (p21(WAF-1)) and anti-apoptotic protein (bcl-2) in breast cancer cells. Breast Cancer Res Treat. 2003 Aug;80(3):239-44. doi: 10.1023/A:1024995202135.
55 Effect of mifepristone on proliferation and apoptosis of Ishikawa endometrial adenocarcinoma cells. Fertil Steril. 2005 Jul;84(1):202-11. doi: 10.1016/j.fertnstert.2005.01.126.
56 Effects of AZT and RNA-protein complex (FA-2-b-beta) extracted from Liang Jin mushroom on apoptosis of gastric cancer cells. World J Gastroenterol. 2007 Aug 21;13(31):4185-91. doi: 10.3748/wjg.v13.i31.4185.
57 Apoptosis of human gastric cancer SGC-7901 cells induced by mitomycin combined with sulindac. World J Gastroenterol. 2005 Mar 28;11(12):1829-32.
58 Triggering of transient receptor potential vanilloid type 1 (TRPV1) by capsaicin induces Fas/CD95-mediated apoptosis of urothelial cancer cells in an ATM-dependent manner. Carcinogenesis. 2009 Aug;30(8):1320-9. doi: 10.1093/carcin/bgp138. Epub 2009 Jun 5.
59 Retinoids cause apoptosis in pancreatic cancer cells via activation of RAR-gamma and altered expression of Bcl-2/Bax. Br J Cancer. 2002 Aug 27;87(5):555-61. doi: 10.1038/sj.bjc.6600496.
60 An insight into the hepatocellular death induced by amphetamines, individually and in combination: the involvement of necrosis and apoptosis. Arch Toxicol. 2013 Dec;87(12):2165-85. doi: 10.1007/s00204-013-1082-9. Epub 2013 Jul 3.
61 Reversal of multidrug resistance by magnetic Fe3O4 nanoparticle copolymerizating daunorubicin and 5-bromotetrandrine in xenograft nude-mice. Int J Nanomedicine. 2009;4:73-8. doi: 10.2147/ijn.s5093. Epub 2009 Apr 1.
62 Ouabain induces apoptotic cell death in human prostate DU 145 cancer cells through DNA damage and TRAIL pathways. Environ Toxicol. 2019 Dec;34(12):1329-1339. doi: 10.1002/tox.22834. Epub 2019 Aug 21.
63 Thalidomide inhibits growth of tumors through COX-2 degradation independent of antiangiogenesis. Vascul Pharmacol. 2005 Aug;43(2):112-9. doi: 10.1016/j.vph.2005.04.003.
64 3,5,3'-triiodothyronine (T3) is a survival factor for pancreatic beta-cells undergoing apoptosis. J Cell Physiol. 2006 Feb;206(2):309-21. doi: 10.1002/jcp.20460.
65 Low dose induction of micronuclei by lindane. Carcinogenesis. 2004 Apr;25(4):613-22. doi: 10.1093/carcin/bgh048. Epub 2003 Dec 19.
66 Androgen sensitivity related proteins in hormone-sensitive and hormone-insensitive prostate cancer cell lines treated by androgen antagonist bicalutamide. Neoplasma. 2001;48(5):419-24.
67 Colchicine-induced apoptosis in human normal liver L-02 cells by mitochondrial mediated pathways. Toxicol In Vitro. 2012 Aug;26(5):649-55. doi: 10.1016/j.tiv.2012.01.024. Epub 2012 Feb 8.
68 Pharmacologic doses of ascorbic acid repress specificity protein (Sp) transcription factors and Sp-regulated genes in colon cancer cells. Nutr Cancer. 2011;63(7):1133-42. doi: 10.1080/01635581.2011.605984. Epub 2011 Sep 15.
69 Novel carbocyclic curcumin analog CUR3d modulates genes involved in multiple apoptosis pathways in human hepatocellular carcinoma cells. Chem Biol Interact. 2015 Dec 5;242:107-22.
70 Mechanism of apoptotic effects induced selectively by ursodeoxycholic acid on human hepatoma cell lines. World J Gastroenterol. 2007 Mar 21;13(11):1652-8. doi: 10.3748/wjg.v13.i11.1652.
71 -Carotene Induces Apoptosis in Human Esophageal Squamous Cell Carcinoma Cell Lines via the Cav-1/AKT/NF-B Signaling Pathway. J Biochem Mol Toxicol. 2016 Mar;30(3):148-57. doi: 10.1002/jbt.21773. Epub 2016 Jan 6.
72 Saikosaponin D disrupts platelet-derived growth factor- receptor/p38 pathway leading to mitochondrial apoptosis in human LO2 hepatocyte cells: a potential mechanism of hepatotoxicity. Chem Biol Interact. 2013 Oct 25;206(1):76-82. doi: 10.1016/j.cbi.2013.08.006. Epub 2013 Aug 28.
73 Sertraline, an antidepressant, induces apoptosis in hepatic cells through the mitogen-activated protein kinase pathway. Toxicol Sci. 2014 Feb;137(2):404-15. doi: 10.1093/toxsci/kft254. Epub 2013 Nov 5.
74 Ritonavir blocks AKT signaling, activates apoptosis and inhibits migration and invasion in ovarian cancer cells. Mol Cancer. 2009 Apr 22;8:26. doi: 10.1186/1476-4598-8-26.
75 Modulation of apoptosis and Bcl-2 expression by prostaglandin E2 in human colon cancer cells. Cancer Res. 1998 Jan 15;58(2):362-6.
76 Actinomycin D upregulates proapoptotic protein Puma and downregulates Bcl-2 mRNA in normal peripheral blood lymphocytes. Anticancer Drugs. 2007 Aug;18(7):763-72. doi: 10.1097/CAD.0b013e3280adc905.
77 Enhanced chemotherapeutic efficacy of docetaxel in human lung cancer cell line via GLUT1 inhibitor. J Biochem Mol Toxicol. 2023 Jun;37(6):e23348. doi: 10.1002/jbt.23348. Epub 2023 Mar 31.
78 Vitamin D ameliorates diethylnitrosamine-induced liver preneoplasia: A pivotal role of CYP3A4/CYP2E1 via DPP-4 enzyme inhibition. Toxicol Appl Pharmacol. 2023 Jan 1;458:116324. doi: 10.1016/j.taap.2022.116324. Epub 2022 Nov 25.
79 Resveratrol protects SH-SY5Y neuroblastoma cells from apoptosis induced by dopamine. Exp Mol Med. 2007 Jun 30;39(3):376-84. doi: 10.1038/emm.2007.42.
80 Apoptotic signaling pathways induced by nitric oxide in human lymphoblastoid cells expressing wild-type or mutant p53. Cancer Res. 2004 May 1;64(9):3022-9. doi: 10.1158/0008-5472.can-03-1880.
81 Lovastatin augments apoptosis induced by chemotherapeutic agents in colon cancer cells. Clin Cancer Res. 1999 Aug;5(8):2223-9.
82 Effect of heparin on apoptosis in human nasopharyngeal carcinoma CNE2 cells. Cell Res. 2001 Dec;11(4):311-5. doi: 10.1038/sj.cr.7290101.
83 Evaluation of cytotoxicity of propofol and its related mechanism in glioblastoma cells and astrocytes. Environ Toxicol. 2017 Dec;32(12):2440-2454.
84 Melatonin increases the anticancer potential of doxorubicin in Caco-2 colorectal cancer cells. Environ Toxicol. 2021 Jun;36(6):1061-1069. doi: 10.1002/tox.23105. Epub 2021 Jan 28.
85 Artesunate induces apoptosis through caspase-dependent and -independent mitochondrial pathways in human myelodysplastic syndrome SKM-1 cells. Chem Biol Interact. 2014 Aug 5;219:28-36. doi: 10.1016/j.cbi.2014.03.011. Epub 2014 Apr 3.
86 4.8% sevoflurane induces activation of autophagy in human neuroblastoma SH-SY5Y cells by the AMPK/mTOR signaling pathway. Neurotoxicology. 2022 May;90:256-264. doi: 10.1016/j.neuro.2022.04.008. Epub 2022 Apr 23.
87 Isoniazid-induced apoptosis in HepG2 cells: generation of oxidative stress and Bcl-2 down-regulation. Toxicol Mech Methods. 2010 Jun;20(5):242-51. doi: 10.3109/15376511003793325.
88 Morphine promotes apoptosis in Jurkat cells. J Leukoc Biol. 1999 Oct;66(4):650-8. doi: 10.1002/jlb.66.4.650.
89 Docosahexaenoic acid is a potent inducer of apoptosis in HT-29 colon cancer cells. Prostaglandins Leukot Essent Fatty Acids. 2000 Nov;63(5):301-8. doi: 10.1054/plef.2000.0218.
90 Pharmacological inhibition of Rho-kinase (ROCK) signaling enhances cisplatin resistance in neuroblastoma cells. Int J Oncol. 2010 Nov;37(5):1297-305. doi: 10.3892/ijo_00000781.
91 D-Penicillamine targets metastatic melanoma cells with induction of the unfolded protein response (UPR) and Noxa (PMAIP1)-dependent mitochondrial apoptosis. Apoptosis. 2012 Oct;17(10):1079-94.
92 [Apoptosis induced by cantharidin in human pulmonary carcinoma cells A549 and its molecular mechanisms]. Zhonghua Zhong Liu Za Zhi. 2005 Jun;27(6):330-4.
93 Mebendazole induces apoptosis via Bcl-2 inactivation in chemoresistant melanoma cells. Mol Cancer Res. 2008 Aug;6(8):1308-15. doi: 10.1158/1541-7786.MCR-07-2159. Epub 2008 Jul 30.
94 Cimetidine induces apoptosis in gastric cancer cells in vitro and inhibits tumor growth in vivo. Oncol Rep. 2010 Mar;23(3):693-700. doi: 10.3892/or_00000686.
95 Role of hesperetin (a natural flavonoid) and its analogue on apoptosis in HT-29 human colon adenocarcinoma cell line--a comparative study. Food Chem Toxicol. 2012 Mar;50(3-4):660-71.
96 Non-nutritional sweeteners effects on endothelial vascular function. Toxicol In Vitro. 2020 Feb;62:104694. doi: 10.1016/j.tiv.2019.104694. Epub 2019 Oct 23.
97 Reduced bcl-2 concentrations in hypertensive patients after lisinopril or nifedipine administration. Am J Hypertens. 1999 Jan;12(1 Pt 1):73-5. doi: 10.1016/s0895-7061(98)00217-9.
98 Nilotinib reduced the viability of human ovarian cancer cells via mitochondria-dependent apoptosis, independent of JNK activation. Toxicol In Vitro. 2016 Mar;31:1-11. doi: 10.1016/j.tiv.2015.11.002. Epub 2015 Nov 6.
99 Effects of lapatinib on cell proliferation and apoptosis in NB4 cells. Oncol Lett. 2018 Jan;15(1):235-242. doi: 10.3892/ol.2017.7342. Epub 2017 Nov 3.
100 IMP dehydrogenase inhibitor mycophenolate mofetil induces caspase-dependent apoptosis and cell cycle inhibition in multiple myeloma cells. Mol Cancer Ther. 2006 Feb;5(2):457-66. doi: 10.1158/1535-7163.MCT-05-0340.
101 ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
102 Oncoprotein Bcl-2 and microsatellite instability are associated with disease-free survival and treatment response in colorectal cancer. Oncol Rep. 2008 Nov;20(5):999-1004.
103 cDNA microarray analysis of isogenic paclitaxel- and doxorubicin-resistant breast tumor cell lines reveals distinct drug-specific genetic signatures of resistance. Breast Cancer Res Treat. 2006 Mar;96(1):17-39. doi: 10.1007/s10549-005-9026-6. Epub 2005 Dec 2.
104 Lymphoma cells protected from apoptosis by dysregulated bcl-2 continue to bind annexin V in response to B-cell receptor engagement: a cautionary tale. Leuk Res. 2006 Jan;30(1):77-80. doi: 10.1016/j.leukres.2005.05.018. Epub 2005 Aug 1.
105 Development and molecular characterization of HCT-116 cell lines resistant to the tumor promoter and multiple stress-inducer, deoxycholate. Carcinogenesis. 2002 Dec;23(12):2063-80. doi: 10.1093/carcin/23.12.2063.
106 [Studies on programmed cell death induced by amsacrine and expression of bcl-2 in leukemia cell lines]. Zhonghua Zhong Liu Za Zhi. 1997 Sep;19(5):346-9.
107 Ectopic expression of clusterin/apolipoprotein J or Bcl-2 decreases the sensitivity of HaCaT cells to toxic effects of ropivacaine. Cell Res. 2004 Oct;14(5):415-22. doi: 10.1038/sj.cr.7290242.
108 Mechanisms of apoptosis sensitivity and resistance to the BH3 mimetic ABT-737 in acute myeloid leukemia. Cancer Cell. 2006 Nov;10(5):375-88. doi: 10.1016/j.ccr.2006.10.006.
109 Bcl-2 attenuates anticancer agents-induced apoptosis by sustained activation of Akt/protein kinase B in U937 cells. Apoptosis. 2005 Dec;10(6):1333-43. doi: 10.1007/s10495-005-2763-5.
110 Reactive oxygen species mediate caspase activation and apoptosis induced by lipoic acid in human lung epithelial cancer cells through Bcl-2 down-regulation. J Pharmacol Exp Ther. 2006 Dec;319(3):1062-9. doi: 10.1124/jpet.106.110965. Epub 2006 Sep 21.
111 Borrelidin has limited anti-cancer effects in bcl-2 overexpressing breast cancer and leukemia cells and reveals toxicity in non-malignant breast epithelial cells. J Appl Toxicol. 2014 Oct;34(10):1109-13. doi: 10.1002/jat.2946. Epub 2013 Oct 24.
112 Fragmented mitochondria are sensitized to Bax insertion and activation during apoptosis. Am J Physiol Cell Physiol. 2011 Mar;300(3):C447-55. doi: 10.1152/ajpcell.00402.2010. Epub 2010 Dec 15.
113 siRNA-mediated Bcl-2 and Bcl-xl gene silencing sensitizes human hepatoblastoma cells to chemotherapeutic drugs. Clin Exp Pharmacol Physiol. 2007 May-Jun;34(5-6):450-6. doi: 10.1111/j.1440-1681.2007.04593.x.