Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDHHN7O)

• DOT Name: POU domain, class 5, transcription factor 1 (POU5F1)
• Synonyms: Octamer-binding protein 3; Oct-3; Octamer-binding protein 4; Oct-4; Octamer-binding transcription factor 3; OTF-3
• Gene Name: POU5F1
• Related Disease:
  Bladder cancer
  Lung cancer
  Lung carcinoma
  Ovarian neoplasm
  Adult glioblastoma
  Alzheimer disease
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Cervical carcinoma
  Crohn disease
  Embryonal neoplasm
  Epithelial ovarian cancer
  Epstein barr virus infection
  Esophageal squamous cell carcinoma
  Germ cell tumor
  Gestational trophoblastic neoplasia
  Glioblastoma multiforme
  Glioma
  Hepatocellular carcinoma
  Membranous glomerulonephritis
  Metastatic malignant neoplasm
  Multiple sclerosis
  Myasthenia gravis
  Non-small-cell lung cancer
  Osteosarcoma
  Plasma cell myeloma
  Prostate cancer
  Prostate carcinoma
  Rheumatoid arthritis
  Squamous cell carcinoma
  Stevens-Johnson syndrome
  Teratoma
  Toxic epidermal necrolysis
  Type-1 diabetes
  Urinary bladder cancer
  Urinary bladder neoplasm
  Vitiligo
  Female hypogonadism
  Gastric cancer
  Pancreatic cancer
  Seminoma
  Stomach cancer
  Non-insulin dependent diabetes
  Psoriatic arthritis
• UniProt ID: PO5F1_HUMAN
• PDB ID: 6T90; 6YOV; 7U0G; 7U0I; 8G87; 8G88; 8G8B; 8G8E; 8G8G; 8OTS; 8SPS; 8SPU
• Pfam ID: PF00046 ; PF00157
• Sequence:
  MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPGVGPGSEVWGI
  PPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVESNSDGASPEPCTVTPG
  AVKLEKEKLEQNPEESQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFS
  QTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENR
  VRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEA
  AGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN
• Function: Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Forms a trimeric complex with SOX2 or SOX15 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency.
• Tissue Specificity: Expressed in developing brain. Highest levels found in specific cell layers of the cortex, the olfactory bulb, the hippocampus and the cerebellum. Low levels of expression in adult tissues.
• KEGG Pathway: Sig.ling pathways regulating pluripotency of stem cells (hsa04550)
• Reactome Pathway:
  POU5F1 (OCT4), SOX2, NANOG activate genes related to proliferation (R-HSA-2892247)
  Transcriptional regulation of pluripotent stem cells (R-HSA-452723)
  Germ layer formation at gastrulation (R-HSA-9754189)
  Formation of the anterior neural plate (R-HSA-9823739)
  Specification of primordial germ cells (R-HSA-9827857)
  POU5F1 (OCT4), SOX2, NANOG repress genes related to differentiation (R-HSA-2892245)

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Bladder cancer	DISUHNM0	Definitive	Altered Expression	[1]
Lung cancer	DISCM4YA	Definitive	Biomarker	[2]
Lung carcinoma	DISTR26C	Definitive	Biomarker	[2]
Ovarian neoplasm	DISEAFTY	Definitive	Altered Expression	[3]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[4]
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[5]
Bone osteosarcoma	DIST1004	Strong	Biomarker	[6]
Breast cancer	DIS7DPX1	Strong	Biomarker	[7]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[7]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[8]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[9]
Crohn disease	DIS2C5Q8	Strong	Biomarker	[10]
Embryonal neoplasm	DIS5MQSB	Strong	Genetic Variation	[11]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[12]
Epstein barr virus infection	DISOO0WT	Strong	Genetic Variation	[13]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[14]
Germ cell tumor	DIS62070	Strong	Altered Expression	[15]
Gestational trophoblastic neoplasia	DIS4EJNA	Strong	Biomarker	[16]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[17]
Glioma	DIS5RPEH	Strong	Altered Expression	[18]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[19]
Membranous glomerulonephritis	DISFSUKQ	Strong	Genetic Variation	[20]
Metastatic malignant neoplasm	DIS86UK6	Strong	Altered Expression	[3]
Multiple sclerosis	DISB2WZI	Strong	Genetic Variation	[21]
Myasthenia gravis	DISELRCI	Strong	Genetic Variation	[22]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[23]
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[6]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[24]
Prostate cancer	DISF190Y	Strong	Biomarker	[25]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[25]
Rheumatoid arthritis	DISTSB4J	Strong	Genetic Variation	[26]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[27]
Stevens-Johnson syndrome	DISZG4YX	Strong	Genetic Variation	[28]
Teratoma	DIS6ICY4	Strong	Altered Expression	[29]
Toxic epidermal necrolysis	DISIWPFR	Strong	Genetic Variation	[28]
Type-1 diabetes	DIS7HLUB	Strong	Genetic Variation	[30]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[1]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[1]
Vitiligo	DISR05SL	Strong	Genetic Variation	[31]
Female hypogonadism	DISWASB4	moderate	Altered Expression	[32]
Gastric cancer	DISXGOUK	moderate	Biomarker	[33]
Pancreatic cancer	DISJC981	moderate	Biomarker	[34]
Seminoma	DIS3J8LJ	moderate	Biomarker	[35]
Stomach cancer	DISKIJSX	moderate	Biomarker	[33]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Genetic Variation	[36]
Psoriatic arthritis	DISLWTG2	Limited	Genetic Variation	[37]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Methamphetamine	DMPM4SK	Approved	POU domain, class 5, transcription factor 1 (POU5F1) affects the response to substance of Methamphetamine.	[87]

52 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[38]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[39]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[40]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[41]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[42]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[43]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[45]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[46]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[47]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[48]
Carbamazepine	DMZOLBI	Approved	Carbamazepine decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[49]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[50]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[51]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[53]
Etoposide	DMNH3PG	Approved	Etoposide increases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[54]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[55]
Gemcitabine	DMSE3I7	Approved	Gemcitabine decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[56]
Ibuprofen	DM8VCBE	Approved	Ibuprofen decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[57]
Vitamin C	DMXJ7O8	Approved	Vitamin C increases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[58]
Melatonin	DMKWFBT	Approved	Melatonin decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[59]
Ciprofloxacin XR	DM2NLS9	Approved	Ciprofloxacin XR increases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[60]
Lamotrigine	DM8SXYG	Approved	Lamotrigine decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[49]
Afatinib	DMTKD7Q	Approved	Afatinib decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[61]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[51]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[62]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[63]
Chlorpromazine	DMBGZI3	Phase 3 Trial	Chlorpromazine decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[64]
Napabucasin	DMDZ6Q3	Phase 3	Napabucasin decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[65]
Thymoquinone	DMVDTR2	Phase 2/3	Thymoquinone decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[66]
Belinostat	DM6OC53	Phase 2	Belinostat increases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[51]
Ym155	DM5Q1W4	Phase 2	Ym155 decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[61]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[68]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[69]
Eugenol	DM7US1H	Patented	Eugenol decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[70]
CHIR-99021	DMB8MNU	Patented	CHIR-99021 decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[71]
MG-132	DMKA2YS	Preclinical	MG-132 increases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[72]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[59]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[73]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate increases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[74]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[75]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[76]
Lithium chloride	DMHYLQ2	Investigative	Lithium chloride increases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[78]
Cordycepin	DM72Y01	Investigative	Cordycepin affects the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[79]
Kaempferol	DMHEMUB	Investigative	Kaempferol decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[56]
Apigenin	DMI3491	Investigative	Apigenin decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[80]
GW-3965	DMG60ET	Investigative	GW-3965 decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[81]
Ginsenoside RG3	DMFN58T	Investigative	Ginsenoside RG3 decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[82]
SU 6656	DMF1P6W	Investigative	SU 6656 decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[83]
QUINPIROLE	DMDNHEP	Investigative	QUINPIROLE decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[84]
RGD	DMFASRB	Investigative	RGD decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[85]
Phenolsulfonphthalein	DMCTUAD	Investigative	Phenolsulfonphthalein increases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[42]
SD-208	DMQXUYH	Investigative	SD-208 decreases the expression of POU domain, class 5, transcription factor 1 (POU5F1).	[86]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of POU domain, class 5, transcription factor 1 (POU5F1).	[44]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the phosphorylation of POU domain, class 5, transcription factor 1 (POU5F1).	[52]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of POU domain, class 5, transcription factor 1 (POU5F1).	[67]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
D-glucose	DMMG2TO	Investigative	D-glucose affects the localization of POU domain, class 5, transcription factor 1 (POU5F1).	[77]

References

• [1] Chemotherapeutics-induced Oct4 expression contributes to drug resistance and tumor recurrence in bladder cancer.Oncotarget. 2017 May 9;8(19):30844-30858. doi: 10.18632/oncotarget.9602.
• [2] The Prognostic and Clinicopathologic Characteristics of OCT4 and Lung Cancer: A Meta-Analysis.Curr Mol Med. 2019;19(1):54-75. doi: 10.2174/1566524019666190308163315.
• [3] SOX2 and SOX9 are markers of clinically aggressive disease in metastatic high-grade serous carcinoma.Gynecol Oncol. 2019 Jun;153(3):651-660. doi: 10.1016/j.ygyno.2019.03.099. Epub 2019 Mar 21.
• [4] Conversion of glioma cells to glioma stem-like cells by angiocrine factors.Biochem Biophys Res Commun. 2018 Feb 19;496(4):1013-1018. doi: 10.1016/j.bbrc.2017.02.076. Epub 2017 Feb 17.
• [5] Lymphoblast-derived integration-free iPSC line AD-TREM2-1 from a 67year-old Alzheimer's disease patient expressing the TREM2 p.R47H variant.Stem Cell Res. 2018 May;29:60-63. doi: 10.1016/j.scr.2018.03.011. Epub 2018 Mar 20.
• [6] Overexpression of FER1L4 promotes the apoptosis and suppresses epithelial-mesenchymal transition and stemness markers via activating PI3K/AKT signaling pathway in osteosarcoma cells.Pathol Res Pract. 2019 Jun;215(6):152412. doi: 10.1016/j.prp.2019.04.004. Epub 2019 Apr 6.
• [7] Hypoxia modulates stem cell properties and induces EMT through N-glycosylation of EpCAM in breast cancer cells.J Cell Physiol. 2020 Apr;235(4):3626-3633. doi: 10.1002/jcp.29252. Epub 2019 Oct 4.
• [8] Post-translational modification of OCT4 in breast cancer tumorigenesis.Cell Death Differ. 2018 Nov;25(10):1781-1795. doi: 10.1038/s41418-018-0079-6. Epub 2018 Mar 6.
• [9] Upregulation of stem cell markers ALDH1A1 and OCT4 as potential biomarkers for the early detection of cervical carcinoma.Oncol Lett. 2018 Nov;16(5):5525-5534. doi: 10.3892/ol.2018.9381. Epub 2018 Sep 3.
• [10] Genetic determinants associated with early age of diagnosis of IBD.Dis Colon Rectum. 2015 Mar;58(3):321-7. doi: 10.1097/DCR.0000000000000274.
• [11] Expression analysis of stem cell-related genes reveal OCT4 as a predictor of poor clinical outcome in medulloblastoma.J Neurooncol. 2012 Jan;106(1):71-9. doi: 10.1007/s11060-011-0647-9. Epub 2011 Jul 2.
• [12] MicroRNA-299-3p regulates proliferation, migration and invasion of human ovarian cancer cells by modulating the expression of OCT4.Arch Biochem Biophys. 2018 Aug 1;651:21-27. doi: 10.1016/j.abb.2018.05.007. Epub 2018 May 31.
• [13] Genetic factors affecting EBV copy number in lymphoblastoid cell lines derived from the 1000 Genome Project samples.PLoS One. 2017 Jun 27;12(6):e0179446. doi: 10.1371/journal.pone.0179446. eCollection 2017.
• [14] Gli1, a potential regulator of esophageal cancer stem cell, is identified as an independent adverse prognostic factor in esophageal squamous cell carcinoma.J Cancer Res Clin Oncol. 2017 Feb;143(2):243-254. doi: 10.1007/s00432-016-2273-6. Epub 2016 Sep 28.
• [15] Potential Role of OCT4 in Leukemogenesis.Stem Cells Dev. 2017 Nov 15;26(22):1637-1647. doi: 10.1089/scd.2017.0134. Epub 2017 Oct 16.
• [16] Oct4 is epigenetically regulated by methylation in normal placenta and gestational trophoblastic disease.Placenta. 2008 Jun;29(6):549-54. doi: 10.1016/j.placenta.2008.03.003. Epub 2008 Apr 28.
• [17] Enhanced Hsa-miR-181d/p-STAT3 and Hsa-miR-181d/p-STAT5A Ratios Mediate the Anticancer Effect of Garcinol in STAT3/5A-Addicted Glioblastoma.Cancers (Basel). 2019 Nov 27;11(12):1888. doi: 10.3390/cancers11121888.
• [18] MiR-9 promotes tumorigenesis and angiogenesis and is activated by MYC and OCT4 in human glioma.J Exp Clin Cancer Res. 2019 Feb 22;38(1):99. doi: 10.1186/s13046-019-1078-2.
• [19] Multiple novel hepatocellular carcinoma signature genes are commonly controlled by the master pluripotency factor OCT4.Cell Oncol (Dordr). 2020 Apr;43(2):279-295. doi: 10.1007/s13402-019-00487-3. Epub 2019 Dec 17.
• [20] Risk HLA-DQA1 and PLA(2)R1 alleles in idiopathic membranous nephropathy.N Engl J Med. 2011 Feb 17;364(7):616-26. doi: 10.1056/NEJMoa1009742.
• [21] Risk alleles for multiple sclerosis identified by a genomewide study.N Engl J Med. 2007 Aug 30;357(9):851-62. doi: 10.1056/NEJMoa073493. Epub 2007 Jul 29.
• [22] Risk for myasthenia gravis maps to a (151) ProAla change in TNIP1 and to human leukocyte antigen-B*08.Ann Neurol. 2012 Dec;72(6):927-35. doi: 10.1002/ana.23691. Epub 2012 Oct 10.
• [23] Downregulation of basic fibroblast growth factor increases cisplatin sensitivity in A549 non-small cell lung cancer cells.J Cancer Res Ther. 2018;14(7):1519-1524. doi: 10.4103/jcrt.JCRT_481_18.
• [24] Disulfiram/copper targets stem cell-like ALDH(+) population of multiple myeloma by inhibition of ALDH1A1 and Hedgehog pathway.J Cell Biochem. 2018 Aug;119(8):6882-6893. doi: 10.1002/jcb.26885. Epub 2018 Apr 17.
• [25] Elimination of SOX2/OCT4-Associated Prostate Cancer Stem Cells Blocks Tumor Development and Enhances Therapeutic Response.Cancers (Basel). 2019 Sep 8;11(9):1331. doi: 10.3390/cancers11091331.
• [26] TRAF1-C5 as a risk locus for rheumatoid arthritis--a genomewide study.N Engl J Med. 2007 Sep 20;357(12):1199-209. doi: 10.1056/NEJMoa073491. Epub 2007 Sep 5.
• [27] Induced Pluripotent-stem-cell Related Genes Contribute to De-differentiation in Oral Squamous Cell Carcinoma.Anticancer Res. 2017 Mar;37(3):1075-1082. doi: 10.21873/anticanres.11419.
• [28] Genome-wide association study of Stevens-Johnson Syndrome and Toxic Epidermal Necrolysis in Europe.Orphanet J Rare Dis. 2011 Jul 29;6:52. doi: 10.1186/1750-1172-6-52.
• [29] Germ cell tumour growth patterns originating from clear cell carcinomas of the ovary and endometrium: a comparative immunohistochemical study favouring their origin from somatic stem cells.Histopathology. 2018 Mar;72(4):634-647. doi: 10.1111/his.13426. Epub 2017 Dec 21.
• [30] A genome-wide association study identifies KIAA0350 as a type 1 diabetes gene.Nature. 2007 Aug 2;448(7153):591-4. doi: 10.1038/nature06010. Epub 2007 Jul 15.
• [31] Genome-wide association study for vitiligo identifies susceptibility loci at 6q27 and the MHC.Nat Genet. 2010 Jul;42(7):614-8. doi: 10.1038/ng.603. Epub 2010 Jun 6.
• [32] Hedgehog pathway inhibition causes primary follicle atresia and decreases female germline stem cell proliferation capacity or stemness.Stem Cell Res Ther. 2019 Jul 5;10(1):198. doi: 10.1186/s13287-019-1299-5.
• [33] siRNA-mediated knockdown of ID1 disrupts Nanog- and Oct-4-mediated cancer stem cell-likeness and resistance to chemotherapy in gastric cancer cells.Oncol Lett. 2017 May;13(5):3014-3024. doi: 10.3892/ol.2017.5828. Epub 2017 Mar 8.
• [34] Expressional changes in stemness markers post electrochemotherapy in pancreatic cancer cells.Bioelectrochemistry. 2018 Aug;122:84-92. doi: 10.1016/j.bioelechem.2018.03.009. Epub 2018 Mar 15.
• [35] Protein Expression of PTTG-1, OCT-4, and KLF-4 in Seminoma: A Pilot Study.Front Endocrinol (Lausanne). 2019 Sep 11;10:619. doi: 10.3389/fendo.2019.00619. eCollection 2019.
• [36] Identification of new susceptibility loci for type 2 diabetes and shared etiological pathways with coronary heart disease.Nat Genet. 2017 Oct;49(10):1450-1457. doi: 10.1038/ng.3943. Epub 2017 Sep 4.
• [37] Genetic variation at the glycosaminoglycan metabolism pathway contributes to the risk of psoriatic arthritis but not psoriasis.Ann Rheum Dis. 2019 Mar;78(3):e214158. doi: 10.1136/annrheumdis-2018-214158. Epub 2018 Dec 14.
• [38] A scale out approach towards neural induction of human induced pluripotent stem cells for neurodevelopmental toxicity studies. Toxicol Lett. 2018 Sep 15;294:51-60. doi: 10.1016/j.toxlet.2018.05.018. Epub 2018 May 21.
• [39] Retinoic acid represses a cassette of candidate pluripotency chromosome 12p genes during induced loss of human embryonal carcinoma tumorigenicity. Biochim Biophys Acta. 2005 Oct 15;1731(1):48-56. doi: 10.1016/j.bbaexp.2005.08.006. Epub 2005 Sep 1.
• [40] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [41] Cisplatin treatment of primary and metastatic epithelial ovarian carcinomas generates residual cells with mesenchymal stem cell-like profile. J Cell Biochem. 2011 Oct;112(10):2850-64. doi: 10.1002/jcb.23199.
• [42] Metformin represses self-renewal of the human breast carcinoma stem cells via inhibition of estrogen receptor-mediated OCT4 expression. PLoS One. 2011;6(11):e28068. doi: 10.1371/journal.pone.0028068. Epub 2011 Nov 23.
• [43] Ivermectin as an inhibitor of cancer stem?like cells. Mol Med Rep. 2018 Feb;17(2):3397-3403. doi: 10.3892/mmr.2017.8231. Epub 2017 Dec 8.
• [44] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [45] Quercetin in elimination of tumor initiating stem-like and mesenchymal transformation property in head and neck cancer. Head Neck. 2013 Mar;35(3):413-9. doi: 10.1002/hed.22982. Epub 2012 Mar 16.
• [46] Arsenic trioxide induces differentiation of cancer stem cells in hepatocellular carcinoma through inhibition of LIF/JAK1/STAT3 and NF-kB signaling pathways synergistically. Clin Transl Med. 2021 Feb;11(2):e335. doi: 10.1002/ctm2.335.
• [47] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [48] Altered expression of genes identified in rats with prostatic chronic inflammation in a prostate spheroid model treated by estradiol/testosterone. J Toxicol Sci. 2021;46(11):515-523. doi: 10.2131/jts.46.515.
• [49] Antiepileptic drugs are endocrine disruptors for the human fetal testis ex vivo. Toxicol Sci. 2023 Sep 28;195(2):169-183. doi: 10.1093/toxsci/kfad076.
• [50] Evaluation of developmental toxicity using undifferentiated human embryonic stem cells. J Appl Toxicol. 2015 Feb;35(2):205-18.
• [51] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [52] Role of the IL-6-JAK1-STAT3-Oct-4 pathway in the conversion of non-stem cancer cells into cancer stem-like cells. Cell Signal. 2013 Apr;25(4):961-9. doi: 10.1016/j.cellsig.2013.01.007. Epub 2013 Jan 16.
• [53] Chronic ethanol exposure increases goosecoid (GSC) expression in human embryonic carcinoma cell differentiation. J Appl Toxicol. 2014 Jan;34(1):66-75.
• [54] Lysosome Fe(2+) release is responsible for etoposide- and cisplatin-induced stemness of small cell lung cancer cells. Environ Toxicol. 2021 Aug;36(8):1654-1663. doi: 10.1002/tox.23161. Epub 2021 May 10.
• [55] Enhancement of cancer stem-like and epithelial-mesenchymal transdifferentiation property in oral epithelial cells with long-term nicotine exposure: reversal by targeting SNAIL. Toxicol Appl Pharmacol. 2013 Feb 1;266(3):459-69.
• [56] Deregulation of the CD44-NANOG-MDR1 associated chemoresistance pathways of breast cancer stem cells potentiates the anti-cancer effect of Kaempferol in synergism with Verapamil. Toxicol Appl Pharmacol. 2022 Feb 15;437:115887. doi: 10.1016/j.taap.2022.115887. Epub 2022 Jan 19.
• [57] Effects of Exposure to Acetaminophen and Ibuprofen on Fetal Germ Cell Development in Both Sexes in Rodent and Human Using Multiple Experimental Systems. Environ Health Perspect. 2018 Apr 16;126(4):047006. doi: 10.1289/EHP2307.
• [58] Ascorbic acid induces in vitro proliferation of human subcutaneous adipose tissue derived mesenchymal stem cells with upregulation of embryonic stem cell pluripotency markers Oct4 and SOX 2. Hum Cell. 2010 Nov;23(4):152-5. doi: 10.1111/j.1749-0774.2010.00095.x.
• [59] Melatonin decreases estrogen receptor binding to estrogen response elements sites on the OCT4 gene in human breast cancer stem cells. Genes Cancer. 2016 May;7(5-6):209-17. doi: 10.18632/genesandcancer.107.
• [60] Ciprofloxacin mediates cancer stem cell phenotypes in lung cancer cells through caveolin-1-dependent mechanism. Chem Biol Interact. 2016 Apr 25;250:1-11.
• [61] YM155 as an inhibitor of cancer stemness simultaneously inhibits autophosphorylation of epidermal growth factor receptor and G9a-mediated stemness in lung cancer cells. PLoS One. 2017 Aug 7;12(8):e0182149. doi: 10.1371/journal.pone.0182149. eCollection 2017.
• [62] Resveratrol inhibits pancreatic cancer stem cell characteristics in human and KrasG12D transgenic mice by inhibiting pluripotency maintaining factors and epithelial-mesenchymal transition. PLoS One. 2011 Jan 31;6(1):e16530. doi: 10.1371/journal.pone.0016530.
• [63] Curcumin suppresses the stemness of non-small cell lung cancer cells via promoting the nuclear-cytoplasm translocation of TAZ. Environ Toxicol. 2021 Jun;36(6):1135-1142. doi: 10.1002/tox.23112. Epub 2021 Feb 4.
• [64] The antipsychotic chlorpromazine suppresses YAP signaling, stemness properties, and drug resistance in breast cancer cells. Chem Biol Interact. 2019 Apr 1;302:28-35. doi: 10.1016/j.cbi.2019.01.033. Epub 2019 Jan 28.
• [65] Suppression of cancer relapse and metastasis by inhibiting cancer stemness. Proc Natl Acad Sci U S A. 2015 Feb 10;112(6):1839-44. doi: 10.1073/pnas.1424171112. Epub 2015 Jan 20.
• [66] Thymoquinone suppresses the proliferation of renal cell carcinoma cells via reactive oxygen species-induced apoptosis and reduces cell stemness. Environ Toxicol. 2019 Nov;34(11):1208-1220. doi: 10.1002/tox.22822. Epub 2019 Jul 12.
• [67] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [68] BET protein inhibitor JQ1 inhibits growth and modulates WNT signaling in mesenchymal stem cells. Stem Cell Res Ther. 2016 Feb 1;7:22. doi: 10.1186/s13287-016-0278-3.
• [69] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [70] Eugenol restricts Cancer Stem Cell population by degradation of -catenin via N-terminal Ser37 phosphorylation-an in vivo and in vitro experimental evaluation. Chem Biol Interact. 2020 Jan 25;316:108938. doi: 10.1016/j.cbi.2020.108938. Epub 2020 Jan 8.
• [71] Exposure-based assessment of chemical teratogenicity using morphogenetic aggregates of human embryonic stem cells. Reprod Toxicol. 2020 Jan;91:74-91. doi: 10.1016/j.reprotox.2019.10.004. Epub 2019 Nov 8.
• [72] Cobalt and nickel stabilize stem cell transcription factor OCT4 through modulating its sumoylation and ubiquitination. PLoS One. 2014 Jan 31;9(1):e86620. doi: 10.1371/journal.pone.0086620. eCollection 2014.
• [73] Epigenetic changes and disturbed neural development in a human embryonic stem cell-based model relating to the fetal valproate syndrome. Hum Mol Genet. 2012 Sep 15;21(18):4104-14. doi: 10.1093/hmg/dds239. Epub 2012 Jun 20.
• [74] Methylparaben stimulates tumor initiating cells in ER+ breast cancer models. J Appl Toxicol. 2017 Apr;37(4):417-425. doi: 10.1002/jat.3374. Epub 2016 Sep 1.
• [75] Paraquat affects the differentiation of neural stem cells and impairs the function of vascular endothelial cells: a study of molecular mechanism. Environ Toxicol. 2019 Apr;34(4):548-555. doi: 10.1002/tox.22723. Epub 2019 Jan 30.
• [76] Cancer stem-like cells accumulated in nickel-induced malignant transformation. Toxicol Sci. 2016 Jun;151(2):376-87.
• [77] Aspartame induces cancer stem cell enrichment through p21, NICD and GLI1 in human PANC-1 pancreas adenocarcinoma cells. Food Chem Toxicol. 2021 Jul;153:112264. doi: 10.1016/j.fct.2021.112264. Epub 2021 May 14.
• [78] Lithium chloride regulates the proliferation of stem-like cells in retinoblastoma cell lines: a potential role for the canonical Wnt signaling pathway. Mol Vis. 2010 Jan 13;16:36-45.
• [79] Cordycepin Enhances SIRT1 Expression and Maintains Stemness of Human Mesenchymal Stem Cells. In Vivo. 2023 Mar-Apr;37(2):596-610. doi: 10.21873/invivo.13118.
• [80] Differential responses to retinoic acid and endocrine disruptor compounds of subpopulations within human embryonic stem cell lines. Differentiation. 2012 Nov;84(4):330-43. doi: 10.1016/j.diff.2012.07.006. Epub 2012 Aug 18.
• [81] Farnesoid X receptor and liver X receptors regulate Oct3/4 expression by multiple feedback regulating system in normal renal-derived cells and renal adenocarcinoma cells. J Toxicol Sci. 2020;45(1):25-35. doi: 10.2131/jts.45.25.
• [82] Ginsenoside Rg3 attenuates the osimertinib resistance by reducing the stemness of non-small cell lung cancer cells. Environ Toxicol. 2020 Jun;35(6):643-651. doi: 10.1002/tox.22899. Epub 2020 Jan 9.
• [83] A small molecule inhibitor of SRC family kinases promotes simple epithelial differentiation of human pluripotent stem cells. PLoS One. 2013;8(3):e60016. doi: 10.1371/journal.pone.0060016. Epub 2013 Mar 20.
• [84] Activation of D2 Dopamine Receptors in CD133+ve Cancer Stem Cells in Non-small Cell Lung Carcinoma Inhibits Proliferation, Clonogenic Ability, and Invasiveness of These Cells. J Biol Chem. 2017 Jan 13;292(2):435-445. doi: 10.1074/jbc.M116.748970. Epub 2016 Dec 5.
• [85] Amniogenesis in Human Amniotic Sac Embryoids after Exposures to Organophosphate Flame Retardants. Environ Health Perspect. 2023 Apr;131(4):47007. doi: 10.1289/EHP11958. Epub 2023 Apr 7.
• [86] Hypoxia influences stem cell-like properties in multidrug resistant K562 leukemic cells. Blood Cells Mol Dis. 2013 Oct;51(3):177-84. doi: 10.1016/j.bcmd.2013.05.003. Epub 2013 May 29.
• [87] Genome-wide association for methamphetamine dependence: convergent results from 2 samples. Arch Gen Psychiatry. 2008 Mar;65(3):345-55. doi: 10.1001/archpsyc.65.3.345.