Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGLBN29)

• DOT Name: Cytochrome P450 2C9 (CYP2C9)
• Synonyms: EC 1.14.14.1; (R)-limonene 6-monooxygenase; EC 1.14.14.53; (S)-limonene 6-monooxygenase; EC 1.14.14.51; (S)-limonene 7-monooxygenase; EC 1.14.14.52; CYPIIC9; Cholesterol 25-hydroxylase; Cytochrome P-450MP; Cytochrome P450 MP-4; Cytochrome P450 MP-8; Cytochrome P450 PB-1; S-mephenytoin 4-hydroxylase
• Gene Name: CYP2C9
• UniProt ID: CP2C9_HUMAN
• PDB ID: 1OG2; 1OG5; 1R9O; 4NZ2; 5A5I; 5A5J; 5K7K; 5W0C; 5X23; 5X24; 5XXI; 6VLT; 7RL2
• EC Number: 1.14.14.1; 1.14.14.51; 1.14.14.52; 1.14.14.53
• Pfam ID: PF00067
• Sequence:
  MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKV
  YGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKW
  KEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICS
  IIFHKRFDYKDQQFLNLMEKLNENIKILSSPWIQICNNFSPIIDYFPGTHNKLLKNVAFM
  KSYILEKVKEHQESMDMNNPQDFIDCFLMKMEKEKHNQPSEFTIESLENTAVDLFGAGTE
  TTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSPCMQDRSHMPYTDAVVHEVQRYID
  LLPTSLPHAVTCDIKFRNYLIPKGTTILISLTSVLHDNKEFPNPEMFDPHHFLDEGGNFK
  KSKYFMPFSAGKRICVGEALAGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVP
  PFYQLCFIPV
• Function: A cytochrome P450 monooxygenase involved in the metabolism of various endogenous substrates, including fatty acids and steroids. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase). Catalyzes the epoxidation of double bonds of polyunsaturated fatty acids (PUFA). Catalyzes the hydroxylation of carbon-hydrogen bonds. Metabolizes cholesterol toward 25-hydroxycholesterol, a physiological regulator of cellular cholesterol homeostasis. Exhibits low catalytic activity for the formation of catechol estrogens from 17beta-estradiol (E2) and estrone (E1), namely 2-hydroxy E1 and E2. Catalyzes bisallylic hydroxylation and hydroxylation with double-bond migration of polyunsaturated fatty acids (PUFA). Also metabolizes plant monoterpenes such as limonene. Oxygenates (R)- and (S)-limonene to produce carveol and perillyl alcohol. Contributes to the wide pharmacokinetics variability of the metabolism of drugs such as S-warfarin, diclofenac, phenytoin, tolbutamide and losartan.
• KEGG Pathway:
  Arachidonic acid metabolism (hsa00590)
  Linoleic acid metabolism (hsa00591)
  Retinol metabolism (hsa00830)
  Metabolism of xenobiotics by cytochrome P450 (hsa00980)
  Drug metabolism - cytochrome P450 (hsa00982)
  Metabolic pathways (hsa01100)
  Serotonergic sy.pse (hsa04726)
  Chemical carcinogenesis - D. adducts (hsa05204)
  Lipid and atherosclerosis (hsa05417)
• Reactome Pathway:
  CYP2E1 reactions (R-HSA-211999)
  Synthesis of epoxy (EET) and dihydroxyeicosatrienoic acids (DHET) (R-HSA-2142670)
  Synthesis of (16-20)-hydroxyeicosatetraenoic acids (HETE) (R-HSA-2142816)
  Biosynthesis of maresin-like SPMs (R-HSA-9027307)
  Aspirin ADME (R-HSA-9749641)
  Xenobiotics (R-HSA-211981)
• BioCyc Pathway: MetaCyc:HS06458-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 8 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cytochrome P450 2C9 (CYP2C9) affects the response to substance of Cisplatin.	[65]
Marinol	DM70IK5	Approved	Cytochrome P450 2C9 (CYP2C9) affects the response to substance of Marinol.	[67]
Aspirin	DM672AH	Approved	Cytochrome P450 2C9 (CYP2C9) affects the response to substance of Aspirin.	[68]
Ifosfamide	DMCT3I8	Approved	Cytochrome P450 2C9 (CYP2C9) increases the response to substance of Ifosfamide.	[71]
Warfarin	DMJYCVW	Approved	Cytochrome P450 2C9 (CYP2C9) increases the response to substance of Warfarin.	[72]
Losartan	DM72JXH	Approved	Cytochrome P450 2C9 (CYP2C9) increases the Metabolic disorder ADR of Losartan.	[81]
Tetramethylbutylphenol	DMW9CH2	Investigative	Cytochrome P450 2C9 (CYP2C9) increases the response to substance of Tetramethylbutylphenol.	[94]
Irbesartan	DMTP1DC	Investigative	Cytochrome P450 2C9 (CYP2C9) decreases the response to substance of Irbesartan.	[98]

This DOT Affected the Regulation of Drug Effects of 13 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Hydrogen peroxide	DM1NG5W	Approved	Cytochrome P450 2C9 (CYP2C9) increases the abundance of Hydrogen peroxide.	[66]
Felbamate	DM1V5ZS	Approved	Cytochrome P450 2C9 (CYP2C9) increases the metabolism of Felbamate.	[79]
LAROPIPRANT	DM5FABJ	Phase 4	Cytochrome P450 2C9 (CYP2C9) increases the metabolism of LAROPIPRANT.	[83]
Afimoxifene	DMFORDT	Phase 2	Cytochrome P450 2C9 (CYP2C9) increases the metabolism of Afimoxifene.	[49]
Carfentanil	DM7ADGX	Phase 2	Cytochrome P450 2C9 (CYP2C9) increases the metabolism of Carfentanil.	[85]
Clopidogrel	DMOL54H	Phase 2 Trial	Cytochrome P450 2C9 (CYP2C9) decreases the metabolism of Clopidogrel.	[86]
HPPH	DM25PQB	Phase 2	Cytochrome P450 2C9 (CYP2C9) increases the abundance of HPPH.	[87]
PMID26394986-Compound-22	DM43Z1G	Patented	Cytochrome P450 2C9 (CYP2C9) increases the metabolism of PMID26394986-Compound-22.	[88]
Phencyclidine	DMQBEYX	Investigative	Cytochrome P450 2C9 (CYP2C9) affects the metabolism of Phencyclidine.	[91]
Chlorpyrifos	DMKPUI6	Investigative	Cytochrome P450 2C9 (CYP2C9) affects the metabolism of Chlorpyrifos.	[92]
1,4-Naphthoquinone	DMTCMH7	Investigative	Cytochrome P450 2C9 (CYP2C9) increases the abundance of 1,4-Naphthoquinone.	[95]
Ellipticine	DMHPYSM	Investigative	Cytochrome P450 2C9 (CYP2C9) increases the metabolism of Ellipticine.	[96]
aconitine	DMFOZ60	Investigative	Cytochrome P450 2C9 (CYP2C9) increases the metabolism of aconitine.	[97]

This DOT Affected the Biotransformations of 19 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Diclofenac	DMPIHLS	Approved	Cytochrome P450 2C9 (CYP2C9) decreases the hydroxylation of Diclofenac.	[69]
Ethinyl estradiol	DMODJ40	Approved	Cytochrome P450 2C9 (CYP2C9) increases the hydroxylation of Ethinyl estradiol.	[70]
Propranolol	DM79NTF	Approved	Cytochrome P450 2C9 (CYP2C9) increases the oxidation of Propranolol.	[73]
Mefenamic acid	DMK7HFI	Approved	Cytochrome P450 2C9 (CYP2C9) increases the glutathionylation of Mefenamic acid.	[74]
Flurbiprofen	DMGN4BY	Approved	Cytochrome P450 2C9 (CYP2C9) increases the hydroxylation of Flurbiprofen.	[75]
Naproxen	DMZ5RGV	Approved	Cytochrome P450 2C9 (CYP2C9) decreases the methylation of Naproxen.	[75]
Lansoprazole	DMXYLQ3	Approved	Cytochrome P450 2C9 (CYP2C9) increases the hydroxylation of Lansoprazole.	[76]
Bromfenac	DMKB79O	Approved	Cytochrome P450 2C9 (CYP2C9) increases the hydroxylation of Bromfenac.	[77]
Sulfadiazine	DMTW3R8	Approved	Cytochrome P450 2C9 (CYP2C9) increases the hydroxylation of Sulfadiazine.	[78]
Perazine	DM2AOTZ	Approved	Cytochrome P450 2C9 (CYP2C9) decreases the methylation of Perazine.	[80]
Torasemide	DMXKJ6C	Approved	Cytochrome P450 2C9 (CYP2C9) increases the hydroxylation of Torasemide.	[82]
N-DESMETHYLCLOZAPINE	DMVIRN3	Phase 2	Cytochrome P450 2C9 (CYP2C9) increases the chemical synthesis of N-DESMETHYLCLOZAPINE.	[84]
SCH-C	DM8J9SF	Discontinued in Phase 1	Cytochrome P450 2C9 (CYP2C9) decreases the ethylation of SCH-C.	[89]
Nimesulide	DMR1NMD	Terminated	Cytochrome P450 2C9 (CYP2C9) increases the glutathionylation of Nimesulide.	[90]
all-trans-4-oxo-retinoic acid	DMM2R1N	Investigative	Cytochrome P450 2C9 (CYP2C9) increases the chemical synthesis of all-trans-4-oxo-retinoic acid.	[93]
Erythropoietin	DM3R8YL	Investigative	Cytochrome P450 2C9 (CYP2C9) increases the hydroxylation of Erythropoietin.	[72]
Lauric Acid	DM9C8KQ	Investigative	Cytochrome P450 2C9 (CYP2C9) decreases the hydroxylation of Lauric Acid.	[69]
Dimemorfan	DM2Q3CL	Investigative	Cytochrome P450 2C9 (CYP2C9) increases the oxidation of Dimemorfan.	[99]
Bufuralol	DMJSC07	Investigative	Cytochrome P450 2C9 (CYP2C9) increases the hydroxylation of Bufuralol.	[100]

98 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Cytochrome P450 2C9 (CYP2C9).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Cytochrome P450 2C9 (CYP2C9).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Cytochrome P450 2C9 (CYP2C9).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Cytochrome P450 2C9 (CYP2C9).	[4]
Estradiol	DMUNTE3	Approved	Estradiol increases the activity of Cytochrome P450 2C9 (CYP2C9).	[5]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[6]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Cytochrome P450 2C9 (CYP2C9).	[7]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Cytochrome P450 2C9 (CYP2C9).	[8]
Carbamazepine	DMZOLBI	Approved	Carbamazepine increases the expression of Cytochrome P450 2C9 (CYP2C9).	[9]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Cytochrome P450 2C9 (CYP2C9).	[10]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Cytochrome P450 2C9 (CYP2C9).	[11]
Phenobarbital	DMXZOCG	Approved	Phenobarbital increases the activity of Cytochrome P450 2C9 (CYP2C9).	[12]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Cytochrome P450 2C9 (CYP2C9).	[13]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the activity of Cytochrome P450 2C9 (CYP2C9).	[14]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[15]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[16]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Cytochrome P450 2C9 (CYP2C9).	[17]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Cytochrome P450 2C9 (CYP2C9).	[18]
Irinotecan	DMP6SC2	Approved	Irinotecan decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[19]
Paclitaxel	DMLB81S	Approved	Paclitaxel decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[20]
Malathion	DMXZ84M	Approved	Malathion decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[21]
Menthol	DMG2KW7	Approved	Menthol increases the expression of Cytochrome P450 2C9 (CYP2C9).	[22]
Cocaine	DMSOX7I	Approved	Cocaine decreases the expression of Cytochrome P450 2C9 (CYP2C9).	[23]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid decreases the expression of Cytochrome P450 2C9 (CYP2C9).	[24]
Rifampicin	DM5DSFZ	Approved	Rifampicin increases the expression of Cytochrome P450 2C9 (CYP2C9).	[25]
Capsaicin	DMGMF6V	Approved	Capsaicin decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[26]
Sorafenib	DMS8IFC	Approved	Sorafenib decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[27]
Beta-carotene	DM0RXBT	Approved	Beta-carotene increases the expression of Cytochrome P450 2C9 (CYP2C9).	[28]
Adefovir dipivoxil	DMMAWY1	Approved	Adefovir dipivoxil decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[29]
Ritonavir	DMU764S	Approved	Ritonavir increases the expression of Cytochrome P450 2C9 (CYP2C9).	[30]
Cholecalciferol	DMGU74E	Approved	Cholecalciferol decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[6]
Eicosapentaenoic acid/docosa-hexaenoic acid	DMMUCG4	Approved	Eicosapentaenoic acid/docosa-hexaenoic acid decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[31]
Cimetidine	DMH61ZB	Approved	Cimetidine decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[20]
Hesperetin	DMKER83	Approved	Hesperetin decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[32]
Thioridazine	DM35M8J	Approved	Thioridazine decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[34]
Amodiaquine	DME4RA8	Approved	Amodiaquine decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[14]
Teriflunomide	DMQ2FKJ	Approved	Teriflunomide increases the expression of Cytochrome P450 2C9 (CYP2C9).	[35]
Efavirenz	DMC0GSJ	Approved	Efavirenz decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[36]
Methoxsalen	DME8FZ9	Approved	Methoxsalen decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[6]
Pentamidine	DMHZJCG	Approved	Pentamidine decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[14]
Zafirlukast	DMHNQOG	Approved	Zafirlukast decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[38]
Felodipine	DMOSW35	Approved	Felodipine decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[39]
Miconazole	DMPMYE8	Approved	Miconazole decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[40]
Pyrimethamine	DM5X7VY	Approved	Pyrimethamine decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[14]
Quinine	DMSWYF5	Approved	Quinine decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[14]
Desipramine	DMT2FDC	Approved	Desipramine decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[34]
Dabrafenib	DMX6OE3	Approved	Dabrafenib decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[41]
Isradipine	DMA5XGH	Approved	Isradipine decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[39]
Dapsone	DM4LT8A	Approved	Dapsone decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[14]
Fluconazole	DMOWZ6B	Approved	Fluconazole decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[40]
Thiabendazole	DM7YCK3	Approved	Thiabendazole decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[14]
Voriconazole	DMAOL2S	Approved	Voriconazole decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[40]
Cisapride	DMY7PED	Approved	Cisapride decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[42]
MELARSOPROL	DMGUZ0W	Approved	MELARSOPROL decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[14]
Yn-968D1	DMMP3Y2	Approved	Yn-968D1 decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[43]
Pranlukast	DMYHDCA	Approved	Pranlukast decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[38]
Delavirdine	DM3NF5G	Approved	Delavirdine decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[36]
Sulfaphenazole	DMFNAEM	Approved	Sulfaphenazole decreases the expression of Cytochrome P450 2C9 (CYP2C9).	[44]
Benidipine	DMWNP6B	Phase 4	Benidipine decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[45]
Barnidipine	DMJSDBE	Phase 4	Barnidipine decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[45]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[6]
Chlorpromazine	DMBGZI3	Phase 3 Trial	Chlorpromazine decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[34]
HMPL-004	DM29XGY	Phase 3	HMPL-004 decreases the expression of Cytochrome P450 2C9 (CYP2C9).	[46]
Manidipine	DMJPGUA	Phase 3	Manidipine decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[45]
MLN8237	DMO8PT9	Phase 3	MLN8237 affects the activity of Cytochrome P450 2C9 (CYP2C9).	[47]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[32]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Cytochrome P450 2C9 (CYP2C9).	[48]
BAICALEIN	DM4C7E6	Phase 2	BAICALEIN decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[32]
(Z)-endoxifen	DMGDOS2	Phase 2	(Z)-endoxifen decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[49]
Icaritin	DMGHQ37	Phase 2	Icaritin decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[32]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Cytochrome P450 2C9 (CYP2C9).	[50]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Cytochrome P450 2C9 (CYP2C9).	[35]
Flavonoid derivative 1	DMCQP0B	Patented	Flavonoid derivative 1 decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[32]
PMID27841045-Compound-156	DML4AVX	Patented	PMID27841045-Compound-156 decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[32]
Avasimibe	DMFG4OM	Discontinued in Phase 3	Avasimibe decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[51]
Dioscin	DM5H2W9	Preclinical	Dioscin increases the expression of Cytochrome P450 2C9 (CYP2C9).	[52]
EMODIN	DMAEDQG	Terminated	EMODIN decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[53]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Cytochrome P450 2C9 (CYP2C9).	[54]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of Cytochrome P450 2C9 (CYP2C9).	[55]
Glyphosate	DM0AFY7	Investigative	Glyphosate decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[21]
Rapamycin Immunosuppressant Drug	DM678IB	Investigative	Rapamycin Immunosuppressant Drug increases the expression of Cytochrome P450 2C9 (CYP2C9).	[56]
Bilirubin	DMI0V4O	Investigative	Bilirubin increases the expression of Cytochrome P450 2C9 (CYP2C9).	[57]
Arachidonic acid	DMUOQZD	Investigative	Arachidonic acid decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[31]
Kaempferol	DMHEMUB	Investigative	Kaempferol decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[32]
Daidzein	DMRFTJX	Investigative	Daidzein decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[6]
Apigenin	DMI3491	Investigative	Apigenin decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[32]
2-tert-butylbenzene-1,4-diol	DMNXI1E	Investigative	2-tert-butylbenzene-1,4-diol increases the expression of Cytochrome P450 2C9 (CYP2C9).	[58]
biochanin A	DM0HPWY	Investigative	biochanin A decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[59]
Myricetin	DMTV4L0	Investigative	Myricetin decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[32]
Linoleic acid	DMDGPY9	Investigative	Linoleic acid decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[31]
LICOAGROCHACONE A	DMWY0TN	Investigative	LICOAGROCHACONE A decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[60]
MANGIFERIN	DMWAF5Z	Investigative	MANGIFERIN decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[61]
Isoarnebin 4	DM0B7NO	Investigative	Isoarnebin 4 decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[62]
Aloe-emodin	DMPTY8S	Investigative	Aloe-emodin decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[63]
Icosapentum	DMF1CM7	Investigative	Icosapentum decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[31]
Hyperforin	DM2L3PE	Investigative	Hyperforin increases the expression of Cytochrome P450 2C9 (CYP2C9).	[25]
CITCO	DM0N634	Investigative	CITCO increases the expression of Cytochrome P450 2C9 (CYP2C9).	[64]
RHEIN	DMS6IJ0	Investigative	RHEIN decreases the activity of Cytochrome P450 2C9 (CYP2C9).	[53]

2 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Clotrimazole	DMMFCIH	Approved	Clotrimazole affects the binding of Cytochrome P450 2C9 (CYP2C9).	[33]
Benzbromarone	DMC3YUA	Approved	Benzbromarone affects the binding of Cytochrome P450 2C9 (CYP2C9).	[37]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Differentiation-specific factors modulate epidermal CYP1-4 gene expression in human skin in response to retinoic acid and classic aryl hydrocarbon receptor ligands. J Pharmacol Exp Ther. 2006 Dec;319(3):1162-71.
• [4] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [5] Isoform-specific regulation of cytochromes P450 expression by estradiol and progesterone. Drug Metab Dispos. 2013 Feb;41(2):263-9.
• [6] Functional expression and comparative characterization of nine murine cytochromes P450 by fluorescent inhibition screening. Drug Metab Dispos. 2008 Jul;36(7):1322-31.
• [7] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [8] Triclosan treatment decreased the antitumor effect of sorafenib on hepatocellular carcinoma cells. Onco Targets Ther. 2018 May 18;11:2945-2954.
• [9] Transcriptional profiling of genes induced in the livers of patients treated with carbamazepine. Clin Pharmacol Ther. 2006 Nov;80(5):440-456.
• [10] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [11] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [12] Regulation of cytochrome P450 2C9 expression in primary cultures of human hepatocytes. J Biochem Mol Toxicol. 2009 Jan-Feb;23(1):43-58.
• [13] Expression and induction potential of cytochromes P450 in human cryopreserved hepatocytes. Drug Metab Dispos. 2005 Jul;33(7):1004-16.
• [14] Application of higher throughput screening (HTS) inhibition assays to evaluate the interaction of antiparasitic drugs with cytochrome P450s. Drug Metab Dispos. 2001 Jan;29(1):30-5.
• [15] Characterization of the structural determinants required for potent mechanism-based inhibition of human cytochrome P450 1A1 by cannabidiol. Chem Biol Interact. 2014 May 25;215:62-8.
• [16] Comparative effects of thiazolidinediones on in vitro P450 enzyme induction and inhibition. Drug Metab Dispos. 2003 Apr;31(4):439-46.
• [17] A comprehensive evaluation of anti-diabetic drugs on nuclear receptor PXR platform. Toxicol In Vitro. 2019 Oct;60:347-358.
• [18] Cardiac toxicity from ethanol exposure in human-induced pluripotent stem cell-derived cardiomyocytes. Toxicol Sci. 2019 May 1;169(1):280-292.
• [19] Interaction of irinotecan (CPT-11) and its active metabolite 7-ethyl-10-hydroxycamptothecin (SN-38) with human cytochrome P450 enzymes. Drug Metab Dispos. 2002 Apr;30(4):391-6.
• [20] Size-dependent effects of nanoparticles on the activity of cytochrome P450 isoenzymes. Toxicol Appl Pharmacol. 2010 Feb 1;242(3):326-32.
• [21] An evaluation of the cytochrome P450 inhibition potential of selected pesticides in human hepatic microsomes. J Environ Sci Health B. 2009 Aug;44(6):553-63.
• [22] Menthol reduces the anticoagulant effect of warfarin by inducing cytochrome P450 2C expression. Eur J Pharm Sci. 2014 Jun 2;56:92-101. doi: 10.1016/j.ejps.2014.02.011. Epub 2014 Mar 1.
• [23] Down-regulation of astroglial CYP2C, glucocorticoid receptor and constitutive androstane receptor genes in response to cocaine in human U373 MG astrocytoma cells. Toxicol Lett. 2005 Dec 15;159(3):203-11.
• [24] Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
• [25] Induction of human CYP2C9 by rifampicin, hyperforin, and phenobarbital is mediated by the pregnane X receptor. J Pharmacol Exp Ther. 2004 Feb;308(2):495-501.
• [26] Effects of capsaicin and dihydrocapsaicin on human and rat liver microsomal CYP450 enzyme activities in vitro and in vivo. J Asian Nat Prod Res. 2012;14(4):382-95.
• [27] Differential inhibition of human CYP2C8 and molecular docking interactions elicited by sorafenib and its major N-oxide metabolite. Chem Biol Interact. 2021 Apr 1;338:109401. doi: 10.1016/j.cbi.2021.109401. Epub 2021 Feb 5.
• [28] Beta-carotene and apocarotenals promote retinoid signaling in BEAS-2B human bronchioepithelial cells. Arch Biochem Biophys. 2006 Nov 1;455(1):48-60.
• [29] Inhibition of human liver microsomal cytochrome P450 activities by adefovir and tenofovir. Xenobiotica. 2006 Dec;36(12):1165-77.
• [30] Severe interaction between ritonavir and acenocoumarol. Ann Pharmacother. 2002 Apr;36(4):621-3.
• [31] The inhibitory effect of polyunsaturated fatty acids on human CYP enzymes. Life Sci. 2006 Nov 25;79(26):2432-40.
• [32] Drug interaction study of flavonoids toward CYP3A4 and their quantitative structure activity relationship (QSAR) analysis for predicting potential effects. Toxicol Lett. 2018 Sep 15;294:27-36.
• [33] Different inhibitory effects of azole-containing drugs and pesticides on CYP2C9 polymorphic forms: an in vitro study. Toxicol In Vitro. 2018 Aug;50:249-256.
• [34] Inhibition of cytochrome P450 enzymes participating in p-nitrophenol hydroxylation by drugs known as CYP2E1 inhibitors. Chem Biol Interact. 2004 Apr 15;147(3):331-40.
• [35] Teriflunomide is an indirect human constitutive androstane receptor (CAR) activator interacting with epidermal growth factor (EGF) signaling. Front Pharmacol. 2018 Oct 11;9:993.
• [36] Inhibition of human cytochrome P450 isoforms by nonnucleoside reverse transcriptase inhibitors. J Clin Pharmacol. 2001 Jan;41(1):85-91.
• [37] A new class of CYP2C9 inhibitors: probing 2C9 specificity with high-affinity benzbromarone derivatives. Drug Metab Dispos. 2003 Jul;31(7):967-71.
• [38] Potential of pranlukast and zafirlukast in the inhibition of human liver cytochrome P450 enzymes. Xenobiotica. 2004 May;34(5):429-38.
• [39] Optical isomers of dihydropyridine calcium channel blockers display enantiospecific effects on the expression and enzyme activities of human xenobiotics-metabolizing cytochromes P450. Toxicol Lett. 2016 Nov 16;262:173-186.
• [40] The novel azole R126638 is a selective inhibitor of ergosterol synthesis in Candida albicans, Trichophyton spp., and Microsporum canis. Antimicrob Agents Chemother. 2004 Sep;48(9):3272-8.
• [41] Dabrafenib inhibits ABCG2 and cytochrome P450 isoenzymes; potential implications for combination anticancer therapy. Toxicol Appl Pharmacol. 2022 Jan 1;434:115797. doi: 10.1016/j.taap.2021.115797. Epub 2021 Nov 13.
• [42] Drug-drug interactions of Z-338, a novel gastroprokinetic agent, with terfenadine, comparison with cisapride, and involvement of UGT1A9 and 1A8 in the human metabolism of Z-338. Eur J Pharmacol. 2004 Aug 23;497(2):223-31.
• [43] Evaluation of the inhibition effects of apatinib on human and rat cytochrome P450. Toxicol Lett. 2018 Nov;297:1-7.
• [44] Cytochrome P450 2C epoxygenases mediate photochemical stress-induced death of photoreceptors. J Biol Chem. 2014 Mar 21;289(12):8337-52. doi: 10.1074/jbc.M113.507152. Epub 2014 Feb 11.
• [45] Inhibition of human cytochrome P450 enzymes by 1,4-dihydropyridine calcium antagonists: prediction of in vivo drug-drug interactions. Eur J Clin Pharmacol. 2000 Feb-Mar;55(11-12):843-52.
• [46] Effects of Andrographis paniculata extract and Andrographolide on hepatic cytochrome P450 mRNA expression and monooxygenase activities after in vivo administration to rats and in vitro in rat and human hepatocyte cultures. Chem Biol Interact. 2009 May 15;179(2-3):247-55.
• [47] Alisertib shows negligible potential for perpetrating pharmacokinetic drug-drug interactions on ABCB1, ABCG2 and cytochromes P450, but acts as dual-activity resistance modulator through the inhibition of ABCC1 transporter. Toxicol Appl Pharmacol. 2022 Jan 1;434:115823. doi: 10.1016/j.taap.2021.115823. Epub 2021 Dec 9.
• [48] Capturing time-dependent activation of genes and stress-response pathways using transcriptomics in iPSC-derived renal proximal tubule cells. Cell Biol Toxicol. 2023 Aug;39(4):1773-1793. doi: 10.1007/s10565-022-09783-5. Epub 2022 Dec 31.
• [49] The formation of estrogen-like tamoxifen metabolites and their influence on enzyme activity and gene expression of ADME genes. Arch Toxicol. 2018 Mar;92(3):1099-1112.
• [50] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [51] Effects of avasimibe on cytochrome P450 2C9 expression in vitro and in vivo. Drug Metab Dispos. 2004 Dec;32(12):1370-6.
• [52] Molecular mechanism and inhibitory targets of dioscin in HepG2 cells. Food Chem Toxicol. 2018 Oct;120:143-154.
• [53] The natural anthraquinones from Rheum palmatum induced the metabolic disorder of melatonin by inhibiting human CYP and SULT enzymes. Toxicol Lett. 2016 Nov 16;262:27-38.
• [54] Environmental pollutants parathion, paraquat and bisphenol A show distinct effects towards nuclear receptors-mediated induction of xenobiotics-metabolizing cytochromes P450 in human hepatocytes. Toxicol Lett. 2015 Oct 1;238(1):43-53.
• [55] Ochratoxin A induces CYP3A4, 2B6, 3A5, 2C9, 1A1, and CYP1A2 gene expression in primary cultured human hepatocytes: a possible activation of nuclear receptors. Drug Chem Toxicol. 2012 Jan;35(1):71-80.
• [56] The effects of drugs with immunosuppressive or immunomodulatory activities on xenobiotics-metabolizing enzymes expression in primary human hepatocytes. Toxicol In Vitro. 2015 Aug;29(5):1088-99.
• [57] Interleukin 1beta inhibits CAR-induced expression of hepatic genes involved in drug and bilirubin clearance. Hepatology. 2004 Oct;40(4):951-60.
• [58] Regulation of human CYP2C9 expression by electrophilic stress involves activator protein 1 activation and DNA looping. Mol Pharmacol. 2014 Aug;86(2):125-37.
• [59] In vivo prediction of CYP-mediated metabolic interaction potential of formononetin and biochanin A using in vitro human and rat CYP450 inhibition data. Toxicol Lett. 2015 Nov 19;239(1):1-8.
• [60] Inhibition of human cytochrome P450 enzymes by licochalcone A, a naturally occurring constituent of licorice. Toxicol In Vitro. 2015 Oct;29(7):1569-76.
• [61] Mangifera indica Lextract and mangiferin modulate cytochrome P450 and UDP-glucuronosyltransferase enzymes in primary cultures of human hepatocytes. Phytother Res. 2013 May;27(5):745-52.
• [62] Assessment of the inhibition risk of shikonin on cytochrome P450 via cocktail inhibition assay. Toxicol Lett. 2017 Nov 5;281:74-83.
• [63] Anthraquinones inhibit cytochromes P450 enzyme activity in silico and in vitro. J Appl Toxicol. 2021 Sep;41(9):1438-1445. doi: 10.1002/jat.4134. Epub 2021 Jan 12.
• [64] Potential role of estradiol and progesterone in insulin resistance through constitutive androstane receptor. J Mol Endocrinol. 2011 Sep 7;47(2):229-39.
• [65] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
• [66] Human recombinant cytochrome P450 enzymes display distinct hydrogen peroxide generating activities during substrate independent NADPH oxidase reactions. Toxicol Sci. 2014 Oct;141(2):344-52. doi: 10.1093/toxsci/kfu133. Epub 2014 Jul 24.
• [67] Interindividual variation in the pharmacokinetics of Delta9-tetrahydrocannabinol as related to genetic polymorphisms in CYP2C9. Clin Pharmacol Ther. 2009 Mar;85(3):273-6. doi: 10.1038/clpt.2008.213. Epub 2008 Nov 12.
• [68] Polymorphisms of Aspirin-Metabolizing Enzymes CYP2C9, NAT2 and UGT1A6 in Aspirin-Intolerant Urticaria. Allergy Asthma Immunol Res. 2011 Oct;3(4):273-6.
• [69] Identification and functional characterization of a new CYP2C9 variant (CYP2C9*5) expressed among African Americans. Mol Pharmacol. 2001 Aug;60(2):382-7. doi: 10.1124/mol.60.2.382.
• [70] The involvement of CYP3A4 and CYP2C9 in the metabolism of 17 alpha-ethinylestradiol. Drug Metab Dispos. 2004 Nov;32(11):1209-12.
• [71] Advantages of human hepatocyte-derived transformants expressing a series of human cytochrome p450 isoforms for genotoxicity examination. Toxicol Sci. 2010 Aug;116(2):488-97. doi: 10.1093/toxsci/kfq154. Epub 2010 May 27.
• [72] Identification and Functional Assessment of a New CYP2C9 Allelic Variant CYP2C9*59. Drug Metab Dispos. 2015 Aug;43(8):1246-9. doi: 10.1124/dmd.115.063412. Epub 2015 May 20.
• [73] Comparative study of the oxidation of propranolol enantiomers in hepatic and small intestinal microsomes from cynomolgus and marmoset monkeys. Chem Biol Interact. 2010 Jan 5;183(1):67-78. doi: 10.1016/j.cbi.2009.10.007.
• [74] Cytochrome P450-mediated bioactivation of mefenamic acid to quinoneimine intermediates and inactivation by human glutathione S-transferases. Chem Res Toxicol. 2014 Dec 15;27(12):2071-81.
• [75] Differential activation of CYP2C9 variants by dapsone. Biochem Pharmacol. 2004 May 15;67(10):1831-41.
• [76] Stereoselective metabolism of lansoprazole by human liver cytochrome P450 enzymes. Drug Metab Dispos. 2003 Oct;31(10):1227-34.
• [77] Metabolite profiling and reaction phenotyping for the in vitro assessment of the bioactivation of bromfenac. Chem Res Toxicol. 2020 Jan 21;33(1):249-257.
• [78] Identification of cytochrome P450 and arylamine N-acetyltransferase isoforms involved in sulfadiazine metabolism. Drug Metab Dispos. 2005 Jul;33(7):969-76.
• [79] Assessment of metabolic activation of felbamate in chimeric mice with humanized liver in combination with in vitro metabolic assays. J Toxicol Sci. 2022;47(7):277-288. doi: 10.2131/jts.47.277.
• [80] Cytochrome P-450 enzymes and FMO3 contribute to the disposition of the antipsychotic drug perazine in vitro. Psychopharmacology (Berl). 2000 Sep;151(4):312-20.
• [81] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
• [82] Allelic and functional variability of cytochrome P4502C9. Pharmacogenetics. 1997 Feb;7(1):51-8. doi: 10.1097/00008571-199702000-00007.
• [83] Metabolism of MK-0524, a prostaglandin D2 receptor 1 antagonist, in microsomes and hepatocytes from preclinical species and humans. Drug Metab Dispos. 2007 Feb;35(2):283-92. doi: 10.1124/dmd.106.011551. Epub 2006 Nov 28.
• [84] Interindividual variation in relative CYP1A2/3A4 phenotype influences susceptibility of clozapine oxidation to cytochrome P450-specific inhibition in human hepatic microsomes. Drug Metab Dispos. 2008 Dec;36(12):2547-55. doi: 10.1124/dmd.108.023671. Epub 2008 Sep 22.
• [85] Identification of human cytochrome P450 isozymes involved in the oxidative metabolism of carfentanil. Toxicol Lett. 2021 Jun 1;343:28-33. doi: 10.1016/j.toxlet.2021.02.017. Epub 2021 Feb 27.
• [86] Common polymorphisms of CYP2C19 and CYP2C9 affect the pharmacokinetic and pharmacodynamic response to clopidogrel but not prasugrel. J Thromb Haemost. 2007 Dec;5(12):2429-36. doi: 10.1111/j.1538-7836.2007.02775.x. Epub 2007 Sep 26.
• [87] Phenytoin metabolic ratio: a putative marker of CYP2C9 activity in vivo. Pharmacogenetics. 2001 Oct;11(7):587-96. doi: 10.1097/00008571-200110000-00005.
• [88] Genetic susceptibility to nonsteroidal anti-inflammatory drug-related gastroduodenal bleeding: role of cytochrome P450 2C9 polymorphisms. Gastroenterology. 2007 Aug;133(2):465-71. doi: 10.1053/j.gastro.2007.05.025. Epub 2007 May 21.
• [89] Identification of human liver cytochrome P450 enzymes involved in the metabolism of SCH 351125, a CCR5 antagonist. Xenobiotica. 2005 May;35(5):405-17. doi: 10.1080/00498250500136569.
• [90] Chemical and Enzymatic Transformations of Nimesulide to GSH Conjugates through Reductive and Oxidative Mechanisms. Chem Res Toxicol. 2015 Dec 21;28(12):2267-77. doi: 10.1021/acs.chemrestox.5b00290. Epub 2015 Nov 12.
• [91] Mechanism of inactivation of human cytochrome P450 2B6 by phencyclidine. Drug Metab Dispos. 2006 Sep;34(9):1523-9. doi: 10.1124/dmd.106.010579. Epub 2006 Jun 16.
• [92] Pesticide metabolism in humans, including polymorphisms. Scand J Work Environ Health. 2005;31 Suppl 1:156-63; discussion 119-22.
• [93] Identification of human cytochrome P450 isoforms that contribute to all-trans-retinoic acid 4-hydroxylation. Biochem Pharmacol. 2000 Aug 15;60(4):517-26. doi: 10.1016/s0006-2952(00)00356-7.
• [94] Interactions between urinary 4-tert-octylphenol levels and metabolism enzyme gene variants on idiopathic male infertility. PLoS One. 2013;8(3):e59398. doi: 10.1371/journal.pone.0059398. Epub 2013 Mar 15.
• [95] In vitro metabolism of naphthalene by human liver microsomal cytochrome P450 enzymes. Drug Metab Dispos. 2006 Jan;34(1):176-83. doi: 10.1124/dmd.105.005785. Epub 2005 Oct 21.
• [96] Ellipticine oxidation and DNA adduct formation in human hepatocytes is catalyzed by human cytochromes P450 and enhanced by cytochrome b5. Toxicology. 2012 Dec 16;302(2-3):233-41. doi: 10.1016/j.tox.2012.08.004. Epub 2012 Aug 16.
• [97] Involvement of CYP3A4/5 and CYP2D6 in the metabolism of aconitine using human liver microsomes and recombinant CYP450 enzymes. Toxicol Lett. 2011 Apr 10;202(1):47-54. doi: 10.1016/j.toxlet.2011.01.019. Epub 2011 Jan 28.
• [98] The CYP2C9 genotype predicts the blood pressure response to irbesartan: results from the Swedish Irbesartan Left Ventricular Hypertrophy Investigation vs Atenolol (SILVHIA) trial. J Hypertens. 2002 Oct;20(10):2089-93.
• [99] The oxidative metabolism of dimemorfan by human cytochrome P450 enzymes. J Pharm Sci. 2010 Feb;99(2):1063-77.
• [100] A monoclonal antibody inhibitory to human P450 2D6: a paradigm for use in combinatorial determination of individual P450 role in specific drug tissue metabolism. Pharmacogenetics. 1997 Dec;7(6):469-77. doi: 10.1097/00008571-199712000-00005.