Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKJ6PXW)

DOT Name Cystine/glutamate transporter (SLC7A11)
Synonyms Amino acid transport system xc-; Calcium channel blocker resistance protein CCBR1; Solute carrier family 7 member 11; xCT
Gene Name SLC7A11
UniProt ID
XCT_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
7CCS; 7EPZ; 7P9U; 7P9V
Pfam ID
PF13520
Sequence
MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGA
GIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGP
LPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLN
SMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFY
YGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLS
NAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHV
RKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRP
FKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIM
SEKITRTLQIILEVVPEEDKL
Function
Heterodimer with SLC3A2, that functions as an antiporter by mediating the exchange of extracellular anionic L-cystine and intracellular L-glutamate across the cellular plasma membrane. Provides L-cystine for the maintenance of the redox balance between extracellular L-cystine and L-cysteine and for the maintenance of the intracellular levels of glutathione that is essential for cells protection from oxidative stress. The transport is sodium-independent, electroneutral with a stoichiometry of 1:1, and is drove by the high intracellular concentration of L-glutamate and the intracellular reduction of L-cystine. In addition, mediates the import of L-kynurenine leading to anti-ferroptotic signaling propagation required to maintain L-cystine and glutathione homeostasis. Moreover, mediates N-acetyl-L-cysteine uptake into the placenta leading to subsequently down-regulation of pathways associated with oxidative stress, inflammation and apoptosis. In vitro can also transport L-aspartate. May participate in astrocyte and meningeal cell proliferation during development and can provide neuroprotection by promoting glutathione synthesis and delivery from non-neuronal cells such as astrocytes and meningeal cells to immature neurons. Controls the production of pheomelanin pigment directly.
Tissue Specificity Expressed in term placenta and primary term cytotrophoblast . Expressed mainly in the brain, but also in pancreas .
KEGG Pathway
Ferroptosis (hsa04216 )
Reactome Pathway
Amino acid transport across the plasma membrane (R-HSA-352230 )
NFE2L2 regulating anti-oxidant/detoxification enzymes (R-HSA-9818027 )
Basigin interactions (R-HSA-210991 )
BioCyc Pathway
MetaCyc:ENSG00000151012-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Regulation of Drug Effects of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Selenium DM25CGV Approved Cystine/glutamate transporter (SLC7A11) increases the import of Selenium. [51]
------------------------------------------------------------------------------------
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Etoposide DMNH3PG Approved Cystine/glutamate transporter (SLC7A11) affects the response to substance of Etoposide. [31]
------------------------------------------------------------------------------------
100 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Cystine/glutamate transporter (SLC7A11). [2]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Cystine/glutamate transporter (SLC7A11). [3]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Cystine/glutamate transporter (SLC7A11). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Cystine/glutamate transporter (SLC7A11). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Cystine/glutamate transporter (SLC7A11). [6]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Cystine/glutamate transporter (SLC7A11). [7]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Cystine/glutamate transporter (SLC7A11). [8]
Arsenic DMTL2Y1 Approved Arsenic increases the expression of Cystine/glutamate transporter (SLC7A11). [9]
Quercetin DM3NC4M Approved Quercetin increases the expression of Cystine/glutamate transporter (SLC7A11). [10]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Cystine/glutamate transporter (SLC7A11). [11]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Cystine/glutamate transporter (SLC7A11). [12]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide decreases the expression of Cystine/glutamate transporter (SLC7A11). [13]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Cystine/glutamate transporter (SLC7A11). [14]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Cystine/glutamate transporter (SLC7A11). [15]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Cystine/glutamate transporter (SLC7A11). [16]
Phenobarbital DMXZOCG Approved Phenobarbital increases the expression of Cystine/glutamate transporter (SLC7A11). [17]
Progesterone DMUY35B Approved Progesterone increases the expression of Cystine/glutamate transporter (SLC7A11). [18]
Menadione DMSJDTY Approved Menadione increases the expression of Cystine/glutamate transporter (SLC7A11). [19]
Panobinostat DM58WKG Approved Panobinostat increases the expression of Cystine/glutamate transporter (SLC7A11). [14]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of Cystine/glutamate transporter (SLC7A11). [20]
Cannabidiol DM0659E Approved Cannabidiol increases the expression of Cystine/glutamate transporter (SLC7A11). [21]
Troglitazone DM3VFPD Approved Troglitazone increases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Hydroquinone DM6AVR4 Approved Hydroquinone increases the expression of Cystine/glutamate transporter (SLC7A11). [22]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol decreases the expression of Cystine/glutamate transporter (SLC7A11). [7]
Azathioprine DMMZSXQ Approved Azathioprine decreases the expression of Cystine/glutamate transporter (SLC7A11). [16]
Aspirin DM672AH Approved Aspirin increases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Diclofenac DMPIHLS Approved Diclofenac decreases the expression of Cystine/glutamate transporter (SLC7A11). [16]
Piroxicam DMTK234 Approved Piroxicam decreases the expression of Cystine/glutamate transporter (SLC7A11). [16]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate increases the expression of Cystine/glutamate transporter (SLC7A11). [23]
Indomethacin DMSC4A7 Approved Indomethacin increases the expression of Cystine/glutamate transporter (SLC7A11). [24]
Mitomycin DMH0ZJE Approved Mitomycin decreases the expression of Cystine/glutamate transporter (SLC7A11). [7]
Ethinyl estradiol DMODJ40 Approved Ethinyl estradiol affects the expression of Cystine/glutamate transporter (SLC7A11). [25]
Cyclophosphamide DM4O2Z7 Approved Cyclophosphamide decreases the expression of Cystine/glutamate transporter (SLC7A11). [26]
Ibuprofen DM8VCBE Approved Ibuprofen increases the expression of Cystine/glutamate transporter (SLC7A11). [27]
Pioglitazone DMKJ485 Approved Pioglitazone increases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Acetic Acid, Glacial DM4SJ5Y Approved Acetic Acid, Glacial increases the expression of Cystine/glutamate transporter (SLC7A11). [28]
Motexafin gadolinium DMEJKRF Approved Motexafin gadolinium increases the expression of Cystine/glutamate transporter (SLC7A11). [28]
Liothyronine DM6IR3P Approved Liothyronine increases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Lindane DMB8CNL Approved Lindane increases the expression of Cystine/glutamate transporter (SLC7A11). [26]
Bicalutamide DMZMSPF Approved Bicalutamide increases the expression of Cystine/glutamate transporter (SLC7A11). [29]
Prednisolone DMQ8FR2 Approved Prednisolone decreases the expression of Cystine/glutamate transporter (SLC7A11). [16]
Vitamin C DMXJ7O8 Approved Vitamin C increases the expression of Cystine/glutamate transporter (SLC7A11). [7]
Fluoxetine DM3PD2C Approved Fluoxetine increases the expression of Cystine/glutamate transporter (SLC7A11). [26]
Methylprednisolone DM4BDON Approved Methylprednisolone decreases the expression of Cystine/glutamate transporter (SLC7A11). [16]
Estrone DM5T6US Approved Estrone increases the expression of Cystine/glutamate transporter (SLC7A11). [30]
Dactinomycin DM2YGNW Approved Dactinomycin decreases the expression of Cystine/glutamate transporter (SLC7A11). [31]
Ampicillin DMHWE7P Approved Ampicillin decreases the expression of Cystine/glutamate transporter (SLC7A11). [10]
Isoproterenol DMK7MEY Approved Isoproterenol increases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Mebendazole DMO14SG Approved Mebendazole increases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Estriol DMOEM2I Approved Estriol increases the expression of Cystine/glutamate transporter (SLC7A11). [30]
Nevirapine DM6HX9B Approved Nevirapine increases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Clavulanate DM2FGRT Approved Clavulanate decreases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Sulfasalazine DMICA9H Approved Sulfasalazine decreases the activity of Cystine/glutamate transporter (SLC7A11). [32]
Flutamide DMK0O7U Approved Flutamide increases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Tolcapone DM8MNVO Approved Tolcapone decreases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Zafirlukast DMHNQOG Approved Zafirlukast decreases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Fexofenadine DM17ONX Approved Fexofenadine decreases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Entacapone DMLBVKQ Approved Entacapone decreases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Trazodone DMK1GBJ Approved Trazodone increases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Bromfenac DMKB79O Approved Bromfenac decreases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Ethambutol DMR87LC Approved Ethambutol increases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Fludrocortisone DMUDIR8 Approved Fludrocortisone decreases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Amikacin DM5PDRB Approved Amikacin decreases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Lumiracoxib DM1S4AG Approved Lumiracoxib increases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Trihexyphenidyl DMB19L8 Approved Trihexyphenidyl increases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Procyclidine DMHFJDT Approved Procyclidine increases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Penbutolol DM4ES8F Approved Penbutolol increases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Aciclovir DMYLOVR Approved Aciclovir increases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Racecadotril DMFOTZ7 Approved Racecadotril increases the expression of Cystine/glutamate transporter (SLC7A11). [33]
Levofloxacin DMS60RB Approved Levofloxacin increases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Biperiden DME78OA Approved Biperiden increases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Diphenhydramine DMKQTBA Approved Diphenhydramine decreases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Alpidem DMN7Y9K Approved Alpidem increases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Aminosalicylic acid DMENSL5 Approved Aminosalicylic acid increases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Protriptyline DMNHTZI Approved Protriptyline decreases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Oseltamivir DMGO72P Approved Oseltamivir decreases the expression of Cystine/glutamate transporter (SLC7A11). [1]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Cystine/glutamate transporter (SLC7A11). [34]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Cystine/glutamate transporter (SLC7A11). [14]
Resveratrol DM3RWXL Phase 3 Resveratrol increases the expression of Cystine/glutamate transporter (SLC7A11). [35]
Curcumin DMQPH29 Phase 3 Curcumin increases the expression of Cystine/glutamate transporter (SLC7A11). [36]
Coprexa DMA0WEK Phase 3 Coprexa increases the expression of Cystine/glutamate transporter (SLC7A11). [37]
Genistein DM0JETC Phase 2/3 Genistein decreases the expression of Cystine/glutamate transporter (SLC7A11). [8]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone increases the expression of Cystine/glutamate transporter (SLC7A11). [38]
Phenol DM1QSM3 Phase 2/3 Phenol increases the expression of Cystine/glutamate transporter (SLC7A11). [7]
Belinostat DM6OC53 Phase 2 Belinostat decreases the expression of Cystine/glutamate transporter (SLC7A11). [39]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate increases the expression of Cystine/glutamate transporter (SLC7A11). [40]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Cystine/glutamate transporter (SLC7A11). [26]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Cystine/glutamate transporter (SLC7A11). [41]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Cystine/glutamate transporter (SLC7A11). [42]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Cystine/glutamate transporter (SLC7A11). [43]
Eugenol DM7US1H Patented Eugenol increases the expression of Cystine/glutamate transporter (SLC7A11). [7]
PMID26394986-Compound-22 DM43Z1G Patented PMID26394986-Compound-22 increases the expression of Cystine/glutamate transporter (SLC7A11). [44]
T83193 DMHO29Y Patented T83193 increases the expression of Cystine/glutamate transporter (SLC7A11). [45]
Piperazinyl methyl quinazolinone derivative 2 DM913KS Patented Piperazinyl methyl quinazolinone derivative 2 decreases the expression of Cystine/glutamate transporter (SLC7A11). [46]
Ticrynafen DMLFSTR Withdrawn from market Ticrynafen increases the expression of Cystine/glutamate transporter (SLC7A11). [1]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN increases the expression of Cystine/glutamate transporter (SLC7A11). [47]
Celastrol DMWQIJX Preclinical Celastrol increases the expression of Cystine/glutamate transporter (SLC7A11). [48]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Cystine/glutamate transporter (SLC7A11). [49]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Cystine/glutamate transporter (SLC7A11). [50]
------------------------------------------------------------------------------------
⏷ Show the Full List of 100 Drug(s)

References

1 An in vitro coculture system of human peripheral blood mononuclear cells with hepatocellular carcinoma-derived cells for predicting drug-induced liver injury. Arch Toxicol. 2021 Jan;95(1):149-168. doi: 10.1007/s00204-020-02882-4. Epub 2020 Aug 20.
2 Inter-laboratory comparison of human renal proximal tubule (HK-2) transcriptome alterations due to Cyclosporine A exposure and medium exhaustion. Toxicol In Vitro. 2009 Apr;23(3):486-99.
3 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
4 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Extremely low copper concentrations affect gene expression profiles of human prostate epithelial cell lines. Chem Biol Interact. 2010 Oct 6;188(1):214-9.
7 Oxidative stress mechanisms do not discriminate between genotoxic and nongenotoxic liver carcinogens. Chem Res Toxicol. 2015 Aug 17;28(8):1636-46.
8 Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
9 Arsenic alters transcriptional responses to Pseudomonas aeruginosa infection and decreases antimicrobial defense of human airway epithelial cells. Toxicol Appl Pharmacol. 2017 Sep 15;331:154-163.
10 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
11 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
12 Global effects of inorganic arsenic on gene expression profile in human macrophages. Mol Immunol. 2009 Feb;46(4):649-56.
13 Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
14 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
15 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
16 Antirheumatic drug response signatures in human chondrocytes: potential molecular targets to stimulate cartilage regeneration. Arthritis Res Ther. 2009;11(1):R15.
17 Dose- and time-dependent effects of phenobarbital on gene expression profiling in human hepatoma HepaRG cells. Toxicol Appl Pharmacol. 2009 Feb 1;234(3):345-60.
18 Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
19 Gene expression after treatment with hydrogen peroxide, menadione, or t-butyl hydroperoxide in breast cancer cells. Cancer Res. 2002 Nov 1;62(21):6246-54.
20 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
21 Cannabidiol induces antioxidant pathways in keratinocytes by targeting BACH1. Redox Biol. 2020 Jan;28:101321. doi: 10.1016/j.redox.2019.101321. Epub 2019 Sep 5.
22 Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
23 The THP-1 cell toolbox: a new concept integrating the key events of skin sensitization. Arch Toxicol. 2019 Apr;93(4):941-951.
24 Anti-inflammatory agent indomethacin reduces invasion and alters metabolism in a human breast cancer cell line. Neoplasia. 2007 Mar;9(3):222-35.
25 The genomic response of Ishikawa cells to bisphenol A exposure is dose- and time-dependent. Toxicology. 2010 Apr 11;270(2-3):137-49. doi: 10.1016/j.tox.2010.02.008. Epub 2010 Feb 17.
26 Transcriptome-based functional classifiers for direct immunotoxicity. Arch Toxicol. 2014 Mar;88(3):673-89.
27 Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
28 Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
29 Microarray analysis of bicalutamide action on telomerase activity, p53 pathway and viability of prostate carcinoma cell lines. J Pharm Pharmacol. 2005 Jan;57(1):83-92.
30 Using a customized DNA microarray for expression profiling of the estrogen-responsive genes to evaluate estrogen activity among natural estrogens and industrial chemicals. Environ Health Perspect. 2004 May;112(7):773-81. doi: 10.1289/ehp.6753.
31 Actinomycin D inhibits the expression of the cystine/glutamate transporter xCT via attenuation of CD133 synthesis in CD133(+) HCC. Chem Biol Interact. 2019 Aug 25;309:108713. doi: 10.1016/j.cbi.2019.06.026. Epub 2019 Jun 19.
32 Pharmacogenomic approach reveals a role for the x(c)- cystine/glutamate antiporter in growth and celastrol resistance of glioma cell lines. J Pharmacol Exp Ther. 2010 Mar;332(3):949-58. doi: 10.1124/jpet.109.162248. Epub 2009 Dec 9.
33 Successful validation of genomic biomarkers for human immunotoxicity in Jurkat T cells in vitro. J Appl Toxicol. 2015 Jul;35(7):831-41.
34 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
35 Resveratrol protects against deoxynivalenol-induced ferroptosis in HepG2 cells. Toxicology. 2023 Aug 1;494:153589. doi: 10.1016/j.tox.2023.153589. Epub 2023 Jul 5.
36 Curcumin downregulates the inflammatory cytokines CXCL1 and -2 in breast cancer cells via NFkappaB. Carcinogenesis. 2008 Apr;29(4):779-89.
37 Copper chelator ATN-224 inhibits endothelial function by multiple mechanisms. Microvasc Res. 2009 May;77(3):314-26.
38 Capturing time-dependent activation of genes and stress-response pathways using transcriptomics in iPSC-derived renal proximal tubule cells. Cell Biol Toxicol. 2023 Aug;39(4):1773-1793. doi: 10.1007/s10565-022-09783-5. Epub 2022 Dec 31.
39 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
40 Expression and function of cystine/glutamate transporter in neutrophils. J Leukoc Biol. 2007 Apr;81(4):974-82. doi: 10.1189/jlb.0606385. Epub 2007 Jan 2.
41 BET bromodomain inhibition targets both c-Myc and IL7R in high-risk acute lymphoblastic leukemia. Blood. 2012 Oct 4;120(14):2843-52.
42 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
43 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
44 Anticancer effects of non-steroidal anti-inflammatory drugs against cancer cells and cancer stem cells. Toxicol In Vitro. 2021 Aug;74:105155. doi: 10.1016/j.tiv.2021.105155. Epub 2021 Mar 27.
45 Antimutagenicity of cinnamaldehyde and vanillin in human cells: Global gene expression and possible role of DNA damage and repair. Mutat Res. 2007 Mar 1;616(1-2):60-9. doi: 10.1016/j.mrfmmm.2006.11.022. Epub 2006 Dec 18.
46 Downregulation of Cx43 reduces cisplatin-induced acute renal injury by inhibiting ferroptosis. Food Chem Toxicol. 2021 Dec;158:112672. doi: 10.1016/j.fct.2021.112672. Epub 2021 Nov 13.
47 Chemical stresses fail to mimic the unfolded protein response resulting from luminal load with unfolded polypeptides. J Biol Chem. 2018 Apr 13;293(15):5600-5612.
48 Gene expression signature-based chemical genomic prediction identifies a novel class of HSP90 pathway modulators. Cancer Cell. 2006 Oct;10(4):321-30.
49 Bisphenolic compounds alter gene expression in MCF-7 cells through interaction with estrogen receptor . Toxicol Appl Pharmacol. 2020 Jul 15;399:115030. doi: 10.1016/j.taap.2020.115030. Epub 2020 May 6.
50 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
51 Selenium uptake through cystine transporter mediated by glutathione conjugation. J Toxicol Sci. 2017;42(1):85-91. doi: 10.2131/jts.42.85.