Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXJKU4Y)

• DOT Name: Metallothionein-1E (MT1E)
• Synonyms: MT-1E; Metallothionein-IE; MT-IE
• Gene Name: MT1E
• Related Disease:
  Acute myelogenous leukaemia
  Bladder cancer
  Urinary bladder cancer
  Urinary bladder neoplasm
  Acute monocytic leukemia
  Advanced cancer
  Anemia
  Breast cancer
  Breast carcinoma
  Carcinoma of esophagus
  Classic Hodgkin lymphoma
  Clear cell renal carcinoma
  Colonic neoplasm
  Endometrial cancer
  Endometrial carcinoma
  Esophageal cancer
  Glioblastoma multiforme
  Glioma
  Graves disease
  Hepatocellular carcinoma
  Huntington disease
  Laryngeal carcinoma
  Laryngeal squamous cell carcinoma
  Malignant pleural mesothelioma
  Melanoma
  Metastatic malignant neoplasm
  Myelodysplastic syndrome
  Neoplasm of esophagus
  Non-insulin dependent diabetes
  Polyp
  Pulmonary disease
  Systemic lupus erythematosus
  Thrombocytopenia
  Lung cancer
  Lung carcinoma
  Renal cell carcinoma
  Tuberculosis
  Non-small-cell lung cancer
  Breast neoplasm
  Glaucoma/ocular hypertension
  Invasive ductal breast carcinoma
  Lupus nephritis
  Parkinson disease
  Prostate cancer
  Prostate carcinoma
  Stroke
  Thyroid gland papillary carcinoma
  Type-1/2 diabetes
• UniProt ID: MT1E_HUMAN
• Pfam ID: PF00131
• Sequence:
  MDPNCSCATGGSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGASEKCSCC
  A
• Function: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
• KEGG Pathway: Mineral absorption (hsa04978)
• Reactome Pathway: Metallothioneins bind metals (R-HSA-5661231)

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute myelogenous leukaemia	DISCSPTN	Definitive	Biomarker	[1]
Bladder cancer	DISUHNM0	Definitive	Biomarker	[2]
Urinary bladder cancer	DISDV4T7	Definitive	Biomarker	[2]
Urinary bladder neoplasm	DIS7HACE	Definitive	Biomarker	[2]
Acute monocytic leukemia	DIS28NEL	Strong	Genetic Variation	[3]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[4]
Anemia	DISTVL0C	Strong	Biomarker	[5]
Breast cancer	DIS7DPX1	Strong	Biomarker	[6]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[6]
Carcinoma of esophagus	DISS6G4D	Strong	Biomarker	[7]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Genetic Variation	[8]
Clear cell renal carcinoma	DISBXRFJ	Strong	Posttranslational Modification	[9]
Colonic neoplasm	DISSZ04P	Strong	Posttranslational Modification	[10]
Endometrial cancer	DISW0LMR	Strong	Altered Expression	[11]
Endometrial carcinoma	DISXR5CY	Strong	Altered Expression	[11]
Esophageal cancer	DISGB2VN	Strong	Biomarker	[7]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[12]
Glioma	DIS5RPEH	Strong	Biomarker	[13]
Graves disease	DISU4KOQ	Strong	Biomarker	[14]
Hepatocellular carcinoma	DIS0J828	Strong	Genetic Variation	[15]
Huntington disease	DISQPLA4	Strong	Altered Expression	[16]
Laryngeal carcinoma	DISNHCIV	Strong	Biomarker	[17]
Laryngeal squamous cell carcinoma	DIS9UUVF	Strong	Biomarker	[17]
Malignant pleural mesothelioma	DIST2R60	Strong	Biomarker	[18]
Melanoma	DIS1RRCY	Strong	Posttranslational Modification	[19]
Metastatic malignant neoplasm	DIS86UK6	Strong	Posttranslational Modification	[19]
Myelodysplastic syndrome	DISYHNUI	Strong	Biomarker	[1]
Neoplasm of esophagus	DISOLKAQ	Strong	Biomarker	[7]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Altered Expression	[20]
Polyp	DISRSLYF	Strong	Biomarker	[21]
Pulmonary disease	DIS6060I	Strong	Biomarker	[22]
Systemic lupus erythematosus	DISI1SZ7	Strong	Altered Expression	[23]
Thrombocytopenia	DISU61YW	Strong	Biomarker	[24]
Lung cancer	DISCM4YA	moderate	Genetic Variation	[25]
Lung carcinoma	DISTR26C	moderate	Genetic Variation	[25]
Renal cell carcinoma	DISQZ2X8	moderate	Posttranslational Modification	[9]
Tuberculosis	DIS2YIMD	moderate	Biomarker	[26]
Non-small-cell lung cancer	DIS5Y6R9	Disputed	Altered Expression	[27]
Breast neoplasm	DISNGJLM	Limited	Altered Expression	[28]
Glaucoma/ocular hypertension	DISLBXBY	Limited	Genetic Variation	[29]
Invasive ductal breast carcinoma	DIS43J58	Limited	Altered Expression	[30]
Lupus nephritis	DISCVGPZ	Limited	Altered Expression	[23]
Parkinson disease	DISQVHKL	Limited	Biomarker	[31]
Prostate cancer	DISF190Y	Limited	Altered Expression	[32]
Prostate carcinoma	DISMJPLE	Limited	Altered Expression	[32]
Stroke	DISX6UHX	Limited	Biomarker	[33]
Thyroid gland papillary carcinoma	DIS48YMM	Limited	Biomarker	[34]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[35]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Paclitaxel	DMLB81S	Approved	Metallothionein-1E (MT1E) increases the response to substance of Paclitaxel.	[73]
Mitomycin	DMH0ZJE	Approved	Metallothionein-1E (MT1E) affects the response to substance of Mitomycin.	[74]

37 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Metallothionein-1E (MT1E).	[36]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Metallothionein-1E (MT1E).	[37]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Metallothionein-1E (MT1E).	[38]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Metallothionein-1E (MT1E).	[39]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Metallothionein-1E (MT1E).	[40]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Metallothionein-1E (MT1E).	[41]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Metallothionein-1E (MT1E).	[42]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Metallothionein-1E (MT1E).	[43]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Metallothionein-1E (MT1E).	[44]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Metallothionein-1E (MT1E).	[45]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Metallothionein-1E (MT1E).	[46]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Metallothionein-1E (MT1E).	[47]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Metallothionein-1E (MT1E).	[48]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of Metallothionein-1E (MT1E).	[49]
Malathion	DMXZ84M	Approved	Malathion increases the expression of Metallothionein-1E (MT1E).	[50]
Acetic Acid, Glacial	DM4SJ5Y	Approved	Acetic Acid, Glacial increases the expression of Metallothionein-1E (MT1E).	[51]
Motexafin gadolinium	DMEJKRF	Approved	Motexafin gadolinium increases the expression of Metallothionein-1E (MT1E).	[52]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Metallothionein-1E (MT1E).	[53]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Metallothionein-1E (MT1E).	[54]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Metallothionein-1E (MT1E).	[55]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Metallothionein-1E (MT1E).	[56]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Metallothionein-1E (MT1E).	[57]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Metallothionein-1E (MT1E).	[58]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Metallothionein-1E (MT1E).	[59]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Metallothionein-1E (MT1E).	[60]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Metallothionein-1E (MT1E).	[61]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Metallothionein-1E (MT1E).	[62]
chloropicrin	DMSGBQA	Investigative	chloropicrin affects the expression of Metallothionein-1E (MT1E).	[63]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Metallothionein-1E (MT1E).	[64]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Metallothionein-1E (MT1E).	[65]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Metallothionein-1E (MT1E).	[66]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid decreases the expression of Metallothionein-1E (MT1E).	[67]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of Metallothionein-1E (MT1E).	[68]
crotylaldehyde	DMTWRQI	Investigative	crotylaldehyde decreases the expression of Metallothionein-1E (MT1E).	[69]
Lead acetate	DML0GZ2	Investigative	Lead acetate increases the expression of Metallothionein-1E (MT1E).	[70]
Pyrrolidine dithiocarbamate	DM5ZAS6	Investigative	Pyrrolidine dithiocarbamate increases the expression of Metallothionein-1E (MT1E).	[71]
Genistein-7-glucoside	DMMLNTW	Investigative	Genistein-7-glucoside increases the expression of Metallothionein-1E (MT1E).	[72]

References

• [1] Phase Ib Study of Glasdegib, a Hedgehog Pathway Inhibitor, in Combination with Standard Chemotherapy in Patients with AML or High-Risk MDS.Clin Cancer Res. 2018 May 15;24(10):2294-2303. doi: 10.1158/1078-0432.CCR-17-2824. Epub 2018 Feb 20.
• [2] Overlapping gene expression profiles of cell migration and tumor invasion in human bladder cancer identify metallothionein 1E and nicotinamide N-methyltransferase as novel regulators of cell migration.Oncogene. 2008 Nov 6;27(52):6679-89. doi: 10.1038/onc.2008.264. Epub 2008 Aug 25.
• [3] Results of the Phase I Trial of RG7112, a Small-Molecule MDM2 Antagonist in Leukemia.Clin Cancer Res. 2016 Feb 15;22(4):868-76. doi: 10.1158/1078-0432.CCR-15-0481. Epub 2015 Oct 12.
• [4] Dendritic Cell-Based Immunotherapy in Advanced Sarcoma and Neuroblastoma Pediatric Patients: Anti-cancer Treatment Preceding Monocyte Harvest Impairs the Immunostimulatory and Antigen-Presenting Behavior of DCs and Manufacturing Process Outcome.Front Oncol. 2019 Oct 25;9:1034. doi: 10.3389/fonc.2019.01034. eCollection 2019.
• [5] A phase I trial investigating pulsatile erlotinib in combination with gemcitabine and oxaliplatin in advanced biliary tract cancers.Invest New Drugs. 2017 Feb;35(1):95-104. doi: 10.1007/s10637-016-0406-z. Epub 2016 Nov 16.
• [6] A case-control study of Metallothionein-1 expression in breast cancer and breast fibroadenoma.Sci Rep. 2019 May 15;9(1):7407. doi: 10.1038/s41598-019-43565-0.
• [7] Effects of metallothionein-3 and metallothionein-1E gene transfection on proliferation, cell cycle, and apoptosis of esophageal cancer cells.Genet Mol Res. 2013 Oct 17;12(4):4595-603. doi: 10.4238/2013.October.17.2.
• [8] A novel MspI PCR-RFLP in the human cytosine 5-methyltransferase gene: lack of relevance for malignant lymphoproliferative disease and breast cancer.Hum Hered. 1998 Jul-Aug;48(4):226-9. doi: 10.1159/000022805.
• [9] DNA methylation of metallothionein genes is associated with the clinical features of renal cell carcinoma.Oncol Rep. 2019 Jun;41(6):3535-3544. doi: 10.3892/or.2019.7109. Epub 2019 Apr 10.
• [10] Induction of apoptosis by wild-type p53 in a human colon tumor-derived cell line.Proc Natl Acad Sci U S A. 1992 May 15;89(10):4495-9. doi: 10.1073/pnas.89.10.4495.
• [11] Epigenetic alteration of the metallothionein 1E gene in human endometrial carcinomas.Tumour Biol. 2009;30(2):93-9. doi: 10.1159/000218032. Epub 2009 May 6.
• [12] Phase I trial with biomarker studies of vatalanib (PTK787) in patients with newly diagnosed glioblastoma treated with enzyme inducing anti-epileptic drugs and standard radiation and temozolomide.J Neurooncol. 2011 Jun;103(2):325-32. doi: 10.1007/s11060-010-0390-7. Epub 2010 Sep 7.
• [13] The melatonin-MT1 receptor axis modulates tumor growth in PTEN-mutated gliomas.Biochem Biophys Res Commun. 2018 Feb 19;496(4):1322-1330. doi: 10.1016/j.bbrc.2018.02.010.
• [14] Expression of Metallothionein I/II and Ki-67 Antigen in Graves' Disease.Anticancer Res. 2018 Dec;38(12):6847-6853. doi: 10.21873/anticanres.13059.
• [15] Overexpression of CDCA5, KIF4A, TPX2, and FOXM1 Coregulated Cell Cycle and Promoted Hepatocellular Carcinoma Development.J Comput Biol. 2020 Jun;27(6):965-974. doi: 10.1089/cmb.2019.0254. Epub 2019 Oct 9.
• [16] The melatonin MT1 receptor axis modulates mutant Huntingtin-mediated toxicity.J Neurosci. 2011 Oct 12;31(41):14496-507. doi: 10.1523/JNEUROSCI.3059-11.2011.
• [17] Potential biomarkers for head and neck squamous cell carcinoma.Laryngoscope. 2003 Mar;113(3):393-400. doi: 10.1097/00005537-200303000-00001.
• [18] Immunohistochemically detectable metallothionein expression in malignant pleural mesotheliomas is strongly associated with early failure to platin-based chemotherapy.Oncotarget. 2018 Apr 27;9(32):22254-22268. doi: 10.18632/oncotarget.24962. eCollection 2018 Apr 27.
• [19] Metallothionein 1E is methylated in malignant melanoma and increases sensitivity to cisplatin-induced apoptosis.Melanoma Res. 2010 Oct;20(5):392-400.
• [20] Metallothionein 1 negatively regulates glucose-stimulated insulin secretion and is differentially expressed in conditions of beta cell compensation and failure in mice and humans.Diabetologia. 2019 Dec;62(12):2273-2286. doi: 10.1007/s00125-019-05008-3. Epub 2019 Oct 17.
• [21] Iranian Voice Quality of Life Profile (IVQLP): Factor Analysis.J Voice. 2017 Sep;31(5):576-582. doi: 10.1016/j.jvoice.2017.01.001. Epub 2017 Feb 9.
• [22] Evaluation of two commercial amplification assays for detection of Mycobacterium tuberculosis complex in respiratory specimens.Infection. 1995 Jul-Aug;23(4):216-21. doi: 10.1007/BF01781200.
• [23] The renal metallothionein expression profile is altered in human lupus nephritis.Arthritis Res Ther. 2008;10(4):R76. doi: 10.1186/ar2450. Epub 2008 Jul 6.
• [24] Efficacy of the PARP Inhibitor Veliparib with Carboplatin or as a Single Agent in Patients with Germline BRCA1- or BRCA2-Associated Metastatic Breast Cancer: California Cancer Consortium Trial NCT01149083.Clin Cancer Res. 2017 Aug 1;23(15):4066-4076. doi: 10.1158/1078-0432.CCR-16-2714. Epub 2017 Mar 29.
• [25] Impact of metallothionein gene polymorphisms on the risk of lung cancer in a Japanese population.Mol Carcinog. 2015 Jun;54 Suppl 1:E122-8. doi: 10.1002/mc.22198. Epub 2014 Aug 30.
• [26] Impact of nucleic acid amplification test on pulmonary tuberculosis notifications and treatments in Taiwan: a 7-year single-center cohort study.BMC Infect Dis. 2019 Aug 16;19(1):726. doi: 10.1186/s12879-019-4358-8.
• [27] Metallothionein 1F and 2A overexpression predicts poor outcome of non-small cell lung cancer patients.Exp Mol Pathol. 2013 Feb;94(1):301-8. doi: 10.1016/j.yexmp.2012.10.006. Epub 2012 Oct 9.
• [28] Immunohistochemical Expression of Melatonin Receptor MT1 and Glucose Transporter GLUT1 in Human Breast Cancer.Anticancer Agents Med Chem. 2018;18(15):2110-2116. doi: 10.2174/1871520618666181025125532.
• [29] Variations in the myocilin gene in patients with open-angle glaucoma.Arch Ophthalmol. 2002 Sep;120(9):1189-97. doi: 10.1001/archopht.120.9.1189.
• [30] Metallothionein 1E mRNA is highly expressed in oestrogen receptor-negative human invasive ductal breast cancer.Br J Cancer. 2000 Aug;83(3):319-23. doi: 10.1054/bjoc.2000.1276.
• [31] Mitochondrial gene therapy augments mitochondrial physiology in a Parkinson's disease cell model.Hum Gene Ther. 2009 Aug;20(8):897-907. doi: 10.1089/hum.2009.023.
• [32] Melatonin MT1 receptor-induced transcriptional up-regulation of p27(Kip1) in prostate cancer antiproliferation is mediated via inhibition of constitutively active nuclear factor kappa B (NF-B): potential implications on prostate cancer chemoprevention and therapy.J Pineal Res. 2013 Jan;54(1):69-79. doi: 10.1111/j.1600-079X.2012.01026.x. Epub 2012 Aug 1.
• [33] Metallothionein I as a direct link between therapeutic hematopoietic stem/progenitor cells and cerebral protection in stroke.FASEB J. 2018 May;32(5):2381-2394. doi: 10.1096/fj.201700746R. Epub 2017 Dec 21.
• [34] Metallothionein Isoform Expression in Benign and Malignant Thyroid Lesions.Anticancer Res. 2017 Sep;37(9):5179-5185. doi: 10.21873/anticanres.11940.
• [35] Using hESCs to Probe the Interaction of the Diabetes-Associated Genes CDKAL1 and MT1E.Cell Rep. 2017 May 23;19(8):1512-1521. doi: 10.1016/j.celrep.2017.04.070.
• [36] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [37] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [38] Extremely low copper concentrations affect gene expression profiles of human prostate epithelial cell lines. Chem Biol Interact. 2010 Oct 6;188(1):214-9.
• [39] Human drug metabolism genes in parathion-and estrogen-treated breast cells. Int J Mol Med. 2007 Dec;20(6):875-81.
• [40] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [41] Arsenic trioxide (ATO) influences the gene expression of metallothioneins in human glioblastoma cells. Biol Trace Elem Res. 2012 Dec;149(3):331-9.
• [42] Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
• [43] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [44] Dissecting progressive stages of 5-fluorouracil resistance in vitro using RNA expression profiling. Int J Cancer. 2004 Nov 1;112(2):200-12. doi: 10.1002/ijc.20401.
• [45] Glucocorticoids inhibit cell death in ovarian cancer and up-regulate caspase inhibitor cIAP2. Clin Cancer Res. 2005 Sep 1;11(17):6325-32. doi: 10.1158/1078-0432.CCR-05-0182.
• [46] Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
• [47] Inhibiting Heat Shock Proteins Can Potentiate the Cytotoxic Effect of Cannabidiol in Human Glioma Cells. Anticancer Res. 2015 Nov;35(11):5827-37.
• [48] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [49] Characterizing the genetic basis for nicotine induced cancer development: a transcriptome sequencing study. PLoS One. 2013 Jun 18;8(6):e67252.
• [50] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [51] Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
• [52] Motexafin gadolinium disrupts zinc metabolism in human cancer cell lines. Cancer Res. 2005 May 1;65(9):3837-45.
• [53] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [54] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [55] Capturing time-dependent activation of genes and stress-response pathways using transcriptomics in iPSC-derived renal proximal tubule cells. Cell Biol Toxicol. 2023 Aug;39(4):1773-1793. doi: 10.1007/s10565-022-09783-5. Epub 2022 Dec 31.
• [56] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [57] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [58] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [59] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
• [60] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [61] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [62] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [63] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [64] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [65] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [66] The MT1G Gene in LUHMES Neurons Is a Sensitive Biomarker of Neurotoxicity. Neurotox Res. 2020 Dec;38(4):967-978. doi: 10.1007/s12640-020-00272-3. Epub 2020 Sep 1.
• [67] Identification of palmitate-regulated genes in HepG2 cells by applying microarray analysis. Biochim Biophys Acta. 2007 Sep;1770(9):1283-8. doi: 10.1016/j.bbagen.2007.07.001. Epub 2007 Jul 10.
• [68] Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
• [69] Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.
• [70] Analysis of lead toxicity in human cells. BMC Genomics. 2012 Jul 27;13:344.
• [71] Effects of a redox-active agent on lymphocyte activation and early gene expression patterns. Free Radic Biol Med. 2004 Nov 15;37(10):1550-63.
• [72] Water-soluble genistin glycoside isoflavones up-regulate antioxidant metallothionein expression and scavenge free radicals. J Agric Food Chem. 2006 May 31;54(11):3819-26.
• [73] cDNA microarray analysis of isogenic paclitaxel- and doxorubicin-resistant breast tumor cell lines reveals distinct drug-specific genetic signatures of resistance. Breast Cancer Res Treat. 2006 Mar;96(1):17-39. doi: 10.1007/s10549-005-9026-6. Epub 2005 Dec 2.
• [74] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.