Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEPKLMQ)

DME Name Cytochrome P450 2B6 (CYP2B6)
Synonyms Cytochrome P450 family 2 subfamily B member 6; Cytochrome P450 IIB1; CYP2B6; CYPIIB6
Gene Name CYP2B6
UniProt ID
CP2B6_HUMAN
INTEDE ID
DME0020
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
1555
EC Number EC: 1.14.14.1
Oxidoreductase
Oxygen paired donor oxidoreductase
Flavin/flavoprotein donor oxidoreductase
EC: 1.14.14.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MELSVLLFLALLTGLLLLLVQRHPNTHDRLPPGPRPLPLLGNLLQMDRRGLLKSFLRFRE
KYGDVFTVHLGPRPVVMLCGVEAIREALVDKAEAFSGRGKIAMVDPFFRGYGVIFANGNR
WKVLRRFSVTTMRDFGMGKRSVEERIQEEAQCLIEELRKSKGALMDPTFLFQSITANIIC
SIVFGKRFHYQDQEFLKMLNLFYQTFSLISSVFGQLFELFSGFLKYFPGAHRQVYKNLQE
INAYIGHSVEKHRETLDPSAPKDLIDTYLLHMEKEKSNAHSEFSHQNLNLNTLSLFFAGT
ETTSTTLRYGFLLMLKYPHVAERVYREIEQVIGPHRPPELHDRAKMPYTEAVIYEIQRFS
DLLPMGVPHIVTQHTSFRGYIIPKDTEVFLILSTALHDPHYFEKPDAFNPDHFLDANGAL
KKTEAFIPFSLGKRICLGEGIARAELFLFFTTILQNFSMASPVAPEDIDLTPQECGVGKI
PPTYQIRFLPR
Function
This enzyme is involved in the metabolism of endocannabinoids and steroids. It catalyzes the epoxidation of double bonds of arachidonoylethanolamide (anandamide) to 8,9-, 11,12-, and 14,15- epoxyeicosatrienoic acid ethanolamides (EpETrE-EAs). It hydroxylates steroid hormones, including testosterone at C-16 and estrogens at C-2 and plays a role in the oxidative metabolism of xenobiotics, including plant lipids and drugs.
KEGG Pathway
Arachidonic acid metabolism (hsa00590 )
Drug metabolism - cytochrome P450 (hsa00982 )
Metabolic pathways (hsa01100 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Retinol metabolism (hsa00830 )
Reactome Pathway
Fatty acids (R-HSA-211935 )
Xenobiotics (R-HSA-211981 )
CYP2E1 reactions (R-HSA-211999 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
85 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Amitriptyline DMK7F9S Depression 6A70-6A7Z Approved [1]
Artemether DM48QOT Malaria 1F40-1F45 Approved [2]
Artemisinin DMOY7W3 Malaria 1F40-1F45 Approved [3]
Benzphetamine DMIJATC Obesity 5B81 Approved [4]
Brivaracetam DMSEPK8 Complex partial seizure 8A68.0 Approved [5]
Bupropion DM5PCS7 Smoking dependence 6C4A.2 Approved [6]
Capsaicin DMGMF6V Neuropathic pain 8E43.0 Approved [7]
Carbamazepine DMZOLBI Epilepsy 8A60-8A68 Approved [8]
Cenobamate DM8KLU9 Complex partial seizure 8A68.0 Approved [9]
Cinnarizine DM7U5QJ Vertigo meniere disease AB31.0 Approved [10]
Cisapride DMY7PED Gastroesophageal reflux disease DA22.Z Approved [11]
Clobazam - Lundbeck DMW1OQ0 Anxiety disorder 6B00-6B0Z Approved [12]
Clofibrate DMPC1J7 Dysbetalipoproteinemia 5C80.2 Approved [13]
Clopidogrel DMOL54H Thrombosis DB61-GB90 Approved [14]
Clotiazepam DM59AZT Anxiety disorder 6B00-6B0Z Approved [15]
Cyclophosphamide DM4O2Z7 Solid tumour/cancer 2A00-2F9Z Approved [16]
Desipramine DMT2FDC Attention deficit hyperactivity disorder 6A05.Z Approved [17]
Dextromethorphan DMUDJZM Cough MD12 Approved [18]
Diazepam DM08E9O Epilepsy 8A60-8A68 Approved [19]
Diclofenac DMPIHLS Osteoarthritis FA00-FA05 Approved [20]
Domperidone DMBDPY0 Gastrointestinal disease DE2Z Approved [21]
Efavirenz DMC0GSJ Human immunodeficiency virus infection 1C62 Approved [22]
Enasidenib DM8QXOC Acute myeloid leukaemia 2A60 Approved [23]
Epinastine DMX0K3Q Allergic conjunctivitis 9A60.02 Approved [24]
Estrone DM5T6US Menopausal and postmenopausal disorder GA30 Approved [25]
Flunitrazepam DMGR5Z3 Insomnia 7A00-7A0Z Approved [26]
Fluoxetine DM3PD2C Depression 6A70-6A7Z Approved [27]
Halothane DM80OZ5 Anaesthesia 9A78.6 Approved [28]
Hydrocodone bitartrate DMIAPBE Neuropathic pain 8E43.0 Approved [29]
Ifosfamide DMCT3I8 Solid tumour/cancer 2A00-2F9Z Approved [30]
Imipramine DM2NUH3 Depression 6A70-6A7Z Approved [31]
Irinotecan DMP6SC2 Colorectal cancer 2B91.Z Approved [17]
Isoflurane DMY6T31 Anaesthesia 9A78.6 Approved [32]
Istradefylline DM20VSK Parkinson disease 8A00.0 Approved [33]
Ketamine DMT5HA4 Anaesthesia 9A78.6 Approved [34]
Ketobemidone DMM3L6Z Pain MG30-MG3Z Approved [35]
Lidocaine DML4ZOT Anaesthesia 9A78.6 Approved [2]
Loperamide DMOJZQ9 Diarrhea ME05.1 Approved [36]
Loratadine DMF3AN7 Allergy 4A80-4A85 Approved [37]
Lorcaserin DMG6OYJ Obesity 5B81 Approved [38]
Malathion DMXZ84M Pediculus capitis infestation 1G00.0 Approved [39]
Meperidine DMX4GND Pain MG30-MG3Z Approved [2]
Mephenytoin DM5UGDK Epilepsy 8A60-8A68 Approved [10]
Methadone DMTW6IU Dry cough MD12 Approved [40]
Methoxyflurane DML0RAE Anaesthesia 9A78.6 Approved [41]
Methylphenobarbital DMDSWAG Anxiety disorder 6B00-6B0Z Approved [42]
Methyltestosterone DMWLFGO Solid tumour/cancer 2A00-2F9Z Approved [43]
Mexiletine DMCTE9R Ventricular tachycardia BC71 Approved [44]
Mianserin DMVKA4O Depression 6A70-6A7Z Approved [28]
Midazolam DMXOELT Irritability MB24 Approved [45]
MLN9708 DMCMETN Amyloidosis 5D00 Approved [46]
Nevirapine DM6HX9B Human immunodeficiency virus infection 1C62 Approved [47]
Nicotine DMWX5CO Nicotine dependence 6C4A.2 Approved [48]
Ospemifene DMC4GEI Dyspareunia GA12 Approved [49]
Perhexiline DMINO7Z Angina pectoris BA40 Approved [50]
Permethrin DMZ0Q1G Sarcoptes scabiei infection 1G04 Approved [51]
Phenobarbital DMXZOCG Seizure disorder 8A6Z Approved [8]
Phenytoin DMNOKBV Epilepsy 8A60-8A68 Approved [52]
Prasugrel DM7MT6E Acute coronary syndrome BA41 Approved [53]
Promethazine DM6I5GR Nausea MD90 Approved [28]
Propofol DMB4OLE Anaesthesia 9A78.6 Approved [54]
Rifampicin DM5DSFZ Osteoporosis FB83.0 Approved [55]
Ritonavir DMU764S Human immunodeficiency virus infection 1C62 Approved [22]
Romidepsin DMT5GNL Cutaneous T-cell lymphoma 2B01 Approved [56]
Ropivacaine DMSPJG2 Anaesthesia 9A78.6 Approved [32]
Selegiline hydrochloride DM3VR1L Parkinson disease 8A00.0 Approved [57]
Sertraline DM0FB1J Depression 6A70-6A7Z Approved [58]
Sevoflurane DMC9O43 Anaesthesia 9A78.6 Approved [32]
Tamoxifen DMLB0EZ Breast cancer 2C60-2C65 Approved [59]
Temazepam DM02A65 Insomnia 7A00-7A0Z Approved [60]
Testosterone cypionate DMC1TEV Testosterone deficiency 5A81.1 Approved [2]
Testosterone enanthate DMB6871 Testosterone deficiency 5A81.1 Approved [2]
Testosterone Undecanoate DMZO10Y Hypogonadism 5A61.0 Approved [2]
Thalidomide DM70BU5 Multiple myeloma 2A83 Approved [61]
Tramadol DMRQD04 Pain MG30-MG3Z Approved [62]
Tretinoin DM49DUI Acne vulgaris ED80 Approved [32]
Trifarotene DMOL793 Acne vulgaris ED80 Approved [63]
Trofosfamide DMHB2C3 Non-hodgkin lymphoma 2B33.5 Approved [64]
Valproate DMCFE9I Epilepsy 8A60-8A68 Approved [2]
Velpatasvir DMGF8ZQ Hepatitis virus infection 1E50-1E51 Approved [65]
Verapamil DMA7PEW Hypertension BA00-BA04 Approved [32]
Vortioxetine DM6F1PU Major depressive disorder 6A70.3 Approved [66]
Voxelotor DMCS6M5 Sickle-cell disorder 3A51 Approved [67]
Zotepine DMF3VXA Anxiety disorder 6B00-6B0Z Approved [68]
Vonoprazan DMCOJPS Gastro-oesophageal reflux DA22 Phase 4 [69]
⏷ Show the Full List of 85 Approved Drug(s)
7 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Clomethiazole DMSPN58 Stroke 8B20 Phase 3 [32]
Esketamine DMVU687 Depression 6A70-6A7Z Phase 3 [34]
Fexinidazole DMOYE70 Trypanosomiasis 1D51-1F53 Phase 2/3 [70]
BMS 650032 DMQI43G Hepatitis C virus infection 1E51.1 Phase 2 [71]
Dexloxiglumide DM52HUD Pancreatic malfunction DC30-DC3Z Phase 2 [72]
R-roscovitine DMSH108 Non-small-cell lung cancer 2C25.Y Phase 2 [73]
H3B-6545 DMIFCY2 Breast cancer 2C60-2C65 Phase 1/2 [74]
⏷ Show the Full List of 7 Clinical Trial Drug(s)
3 Discontinued Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Seratrodast DMPNTDL Allergic asthma CA23.0 Discontinued in Phase 3 [10]
FCP-3P1 DMTQLIJ Arteriosclerosis BD40 Discontinued in Phase 2 [75]
Banoxantrone DMK5I07 Acute lymphoblastic leukaemia 2A85 Discontinued in Phase 1 [76]
3 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Ethylmorphine DM0YROF Discovery agent N.A. Investigative [19]
Levoverbenone DMV3P89 Pulmonary tuberculosis 1B10.Z Investigative [77]
Phenazone DMCE985 Discovery agent N.A. Investigative [78]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 7.30E-02 -1.59E-02 -1.23E-01
Alopecia ED70 Skin from scalp 5.59E-02 3.00E-01 3.61E-01
Alzheimer's disease 8A20 Entorhinal cortex 4.88E-01 -1.69E-05 -1.28E-04
Ankylosing spondylitis FA92.0 Pheripheral blood 8.71E-02 -5.85E-02 -7.69E-01
Aortic stenosis BB70 Calcified aortic valve 9.45E-01 -1.69E-02 -2.18E-02
Apnea 7A40 Hyperplastic tonsil 6.10E-01 -5.59E-02 -2.63E-01
Arthropathy FA00-FA5Z Peripheral blood 5.28E-02 9.71E-02 9.67E-01
Asthma CA23 Nasal and bronchial airway 4.74E-01 2.25E-01 1.65E-01
Atopic dermatitis EA80 Skin 3.49E-03 2.21E-02 2.17E-01
Autism 6A02 Whole blood 4.08E-01 -7.97E-02 -4.43E-01
Autoimmune uveitis 9A96 Peripheral monocyte 1.09E-01 -9.75E-02 -4.25E-01
Autosomal dominant monocytopenia 4B04 Whole blood 5.55E-01 3.64E-04 2.57E-03
Bacterial infection of gingival 1C1H Gingival tissue 2.84E-01 2.08E-02 7.58E-02
Batten disease 5C56.1 Whole blood 5.75E-01 -8.69E-02 -8.50E-01
Behcet's disease 4A62 Peripheral blood 4.32E-01 7.38E-02 4.17E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 5.99E-01 1.92E-02 1.35E-01
Bladder cancer 2C94 Bladder tissue 6.20E-05 5.17E-01 3.18E+00
Breast cancer 2C60-2C6Z Breast tissue 5.71E-03 5.36E-02 1.63E-01
Cardioembolic stroke 8B11.20 Whole blood 7.07E-01 -5.57E-02 -1.64E-01
Cervical cancer 2C77 Cervical tissue 2.02E-03 -1.26E-01 -6.18E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 7.58E-01 9.97E-03 6.67E-02
Chronic hepatitis C 1E51.1 Whole blood 8.60E-02 1.65E-01 8.28E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.10E-02 9.95E-02 3.65E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.07E-03 -2.31E-01 -5.10E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 2.73E-03 -6.73E-01 -1.20E+00
Colon cancer 2B90 Colon tissue 7.11E-02 1.77E-01 2.56E-01
Coronary artery disease BA80-BA8Z Peripheral blood 4.85E-01 -1.16E-01 -6.57E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 8.81E-01 -4.25E-02 -1.66E-01
Endometriosis GA10 Endometrium tissue 7.34E-01 -2.23E-02 -9.87E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.93E-01 -2.22E-02 -1.61E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.88E-03 -2.88E-01 -1.41E+00
Gastric cancer 2B72 Gastric tissue 1.70E-02 5.52E-02 5.02E-01
Glioblastopma 2A00.00 Nervous tissue 4.78E-02 4.13E-02 1.93E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 6.41E-01 -4.80E-02 -3.07E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 5.69E-05 -5.35E-01 -2.88E+00
Head and neck cancer 2D42 Head and neck tissue 7.41E-12 -2.61E-01 -3.81E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 3.54E-01 -2.05E-02 -1.25E-01
Huntington's disease 8A01.10 Whole blood 2.40E-01 -8.11E-02 -5.50E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.91E-01 -3.14E-02 -1.42E-01
Immunodeficiency 4A00-4A20 Peripheral blood 5.27E-01 3.96E-02 3.97E-01
Influenza 1E30 Whole blood 2.05E-02 3.08E-01 2.67E+00
Interstitial cystitis GC00.3 Bladder tissue 7.62E-01 5.13E-02 3.48E-01
Intracranial aneurysm 8B01.0 Intracranial artery 3.93E-01 -1.08E-02 -7.09E-02
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.55E-01 7.99E-02 2.21E-01
Ischemic stroke 8B11 Peripheral blood 1.88E-01 3.80E-02 1.69E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.46E-01 -4.36E-02 -1.36E-01
Lateral sclerosis 8B60.4 Skin 8.28E-01 -5.54E-02 -4.08E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 2.35E-02 7.82E-02 4.89E-01
Liver cancer 2C12.0 Liver tissue 2.38E-13 -2.40E+00 -1.69E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.22E-03 -1.69E+00 -3.55E+00
Lung cancer 2C25 Lung tissue 2.81E-03 -9.34E-02 -3.57E-01
Lupus erythematosus 4A40 Whole blood 2.36E-06 6.59E-02 2.11E-01
Major depressive disorder 6A70-6A7Z Hippocampus 5.79E-01 -1.30E-02 -9.78E-02
Major depressive disorder 6A70-6A7Z Whole blood 3.00E-01 1.26E-01 3.74E-01
Melanoma 2C30 Skin 5.29E-04 -5.51E-01 -5.60E-01
Multiple myeloma 2A83.1 Peripheral blood 1.01E-01 5.77E-02 8.39E-01
Multiple myeloma 2A83.1 Bone marrow 2.88E-03 -6.19E-01 -1.74E+00
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 3.97E-02 -1.72E-01 -9.29E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 9.02E-01 1.35E-02 7.95E-02
Myelofibrosis 2A20.2 Whole blood 1.66E-01 -2.64E-02 -2.16E-01
Myocardial infarction BA41-BA50 Peripheral blood 5.14E-01 5.05E-02 6.99E-02
Myopathy 8C70.6 Muscle tissue 7.06E-01 -4.55E-02 -2.54E-01
Neonatal sepsis KA60 Whole blood 8.52E-01 -9.47E-03 -5.16E-02
Neuroectodermal tumour 2A00.11 Brain stem tissue 7.27E-03 -3.02E-01 -1.04E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.98E-01 3.67E-01 5.18E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 3.11E-01 9.55E-02 1.62E+00
Olive pollen allergy CA08.00 Peripheral blood 6.86E-01 1.54E-01 4.86E-01
Oral cancer 2B6E Oral tissue 8.41E-01 -4.49E-02 -1.67E-01
Osteoarthritis FA00-FA0Z Synovial tissue 1.64E-01 1.53E-01 1.14E+00
Osteoporosis FB83.1 Bone marrow 4.17E-01 -2.70E-02 -2.65E-01
Ovarian cancer 2C73 Ovarian tissue 3.79E-01 -3.97E-02 -1.93E-01
Pancreatic cancer 2C10 Pancreas 1.10E-02 1.91E-02 9.50E-02
Parkinson's disease 8A00.0 Substantia nigra tissue 4.32E-01 4.39E-02 4.30E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 4.96E-03 -1.55E-01 -1.47E+00
Pituitary cancer 2D12 Pituitary tissue 7.65E-01 3.20E-02 1.39E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.71E-01 7.12E-03 3.68E-02
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.86E-02 3.52E-02 6.08E-01
Polycythemia vera 2A20.4 Whole blood 5.18E-01 -3.02E-02 -2.12E-01
Pompe disease 5C51.3 Biceps muscle 7.33E-03 -2.03E-01 -8.96E-01
Preterm birth KA21.4Z Myometrium 5.67E-01 -4.10E-02 -5.31E-01
Prostate cancer 2C82 Prostate 1.97E-02 1.25E-01 3.51E-01
Psoriasis EA90 Skin 1.62E-02 1.07E-01 4.44E-01
Rectal cancer 2B92 Rectal colon tissue 2.22E-02 5.21E-01 1.32E+00
Renal cancer 2C90-2C91 Kidney 3.82E-03 -4.83E-01 -1.24E+00
Retinoblastoma 2D02.2 Uvea 2.84E-01 4.60E-02 4.01E-01
Rheumatoid arthritis FA20 Synovial tissue 7.53E-01 1.26E-01 4.92E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 1.43E-01 1.84E-02 5.34E-02
Schizophrenia 6A20 Prefrontal cortex 9.90E-01 3.10E-03 1.75E-02
Schizophrenia 6A20 Superior temporal cortex 5.35E-01 1.10E-02 1.19E-01
Scleroderma 4A42.Z Whole blood 4.10E-07 3.21E-01 3.95E+00
Seizure 8A60-8A6Z Whole blood 7.40E-02 -7.76E-02 -4.64E-01
Sensitive skin EK0Z Skin 5.29E-01 -2.88E-02 -7.39E-02
Sepsis with septic shock 1G41 Whole blood 5.42E-11 1.25E-01 7.17E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 3.47E-02 2.12E-01 7.38E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.52E-05 1.99E-01 3.17E+00
Simpson golabi behmel syndrome LD2C Adipose tissue 3.51E-01 4.13E-02 2.86E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 6.09E-02 -1.44E-01 -1.93E+00
Skin cancer 2C30-2C3Z Skin 8.25E-05 1.47E-01 3.09E-01
Thrombocythemia 3B63 Whole blood 3.39E-01 -1.22E-02 -9.58E-02
Thrombocytopenia 3B64 Whole blood 2.11E-01 -7.34E-02 -3.14E-01
Thyroid cancer 2D10 Thyroid 1.25E-01 -7.02E-02 -2.81E-01
Tibial muscular dystrophy 8C75 Muscle tissue 7.03E-01 3.69E-02 1.86E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 1.94E-01 1.29E-01 7.28E-01
Type 2 diabetes 5A11 Liver tissue 2.05E-01 -1.49E-01 -3.36E-01
Ureter cancer 2C92 Urothelium 7.19E-01 -5.25E-02 -4.77E-01
Uterine cancer 2C78 Endometrium tissue 2.28E-01 2.15E-03 7.85E-03
Vitiligo ED63.0 Skin 7.19E-01 -2.31E-01 -1.10E+00
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Cytochrome P450 2B6 (CYP2B6) DTT Info
DME DTT Type Literature-reported

References

1 Application of the relative activity factor approach in scaling from heterologously expressed cytochromes p450 to human liver microsomes: studies on amitriptyline as a model substrate. J Pharmacol Exp Ther. 2001 Apr;297(1):326-37.
2 Insights into CYP2B6-mediated drug-drug interactions. Acta Pharm Sin B. 2016 Sep;6(5):413-425.
3 Antimalarial artemisinin drugs induce cytochrome P450 and MDR1 expression by activation of xenosensors pregnane X receptor and constitutive androstane receptor. Mol Pharmacol. 2005 Jun;67(6):1954-65.
4 Mechanistic analysis of the inactivation of cytochrome P450 2B6 by phencyclidine: effects on substrate binding, electron transfer, and uncoupling. Drug Metab Dispos. 2009 Apr;37(4):745-52.
5 Pharmacokinetics and metabolism of 14C-brivaracetam, a novel SV2A ligand, in healthy subjects. Drug Metab Dispos. 2008 Jan;36(1):36-45.
6 Laparoscopic Roux-en-Y gastric bypass surgery influenced pharmacokinetics of several drugs given as a cocktail with the highest impact observed for CYP1A2, CYP2C8 and CYP2E1 substrates. Basic Clin Pharmacol Toxicol. 2019 Aug;125(2):123-132.
7 Metabolism of capsaicin by cytochrome P450 produces novel dehydrogenated metabolites and decreases cytotoxicity to lung and liver cells. Chem Res Toxicol. 2003 Mar;16(3):336-49.
8 Regulation of CYP2B6 in primary human hepatocytes by prototypical inducers. Drug Metab Dispos. 2004 Mar;32(3):348-58.
9 FDA label of Cenobamate. The 2020 official website of the U.S. Food and Drug Administration.
10 Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development. Curr Med Chem. 2009;16(27):3480-675.
11 Interaction of cisapride with the human cytochrome P450 system: metabolism and inhibition studies. Drug Metab Dispos. 2000 Jul;28(7):789-800.
12 In vitro characterization of clobazam metabolism by recombinant cytochrome P450 enzymes: importance of CYP2C19. Drug Metab Dispos. 2004 Nov;32(11):1279-86.
13 Oxidative metabolism of flunarizine and cinnarizine by microsomes from B-lymphoblastoid cell lines expressing human cytochrome P450 enzymes. Biol Pharm Bull. 1996 Nov;19(11):1511-4.
14 Clopidogrel pathway. Pharmacogenet Genomics. 2010 Jul;20(7):463-5.
15 Contribution of human hepatic cytochrome p450 isoforms to the metabolism of psychotropic drugs. Biol Pharm Bull. 2005 Sep;28(9):1711-6.
16 The effect of cyclophosphamide with and without dexamethasone on cytochrome P450 3A4 and 2B6 in human hepatocytes. Drug Metab Dispos. 2002 Jul;30(7):814-22.
17 Drugs that may have potential CYP2B6 interactions.
18 Enzymes in addition to CYP3A4 and 3A5 mediate N-demethylation of dextromethorphan in human liver microsomes. Biopharm Drug Dispos. 1999 Oct;20(7):341-6.
19 Inhibitory monoclonal antibody to human cytochrome P450 2B6. Biochem Pharmacol. 1998 May 15;55(10):1633-40.
20 Hepatic metabolism of diclofenac: role of human CYP in the minor oxidative pathways. Biochem Pharmacol. 1999 Sep 1;58(5):787-96.
21 Characterization of human cytochrome P450 enzymes catalyzing domperidone N-dealkylation and hydroxylation in vitro. Br J Clin Pharmacol. 2004 Sep;58(3):277-87.
22 Evaluation of CYP2B6 induction and prediction of clinical drug-drug interactions: considerations from the IQ consortium induction working group-an industry perspective. Drug Metab Dispos. 2016 Oct;44(10):1720-30.
23 FDA Label of Enasidenib. The 2020 official website of the U.S. Food and Drug Administration.
24 Metabolism of epinastine, a histamine H1 receptor antagonist, in human liver microsomes in comparison with that of terfenadine. Res Commun Mol Pathol Pharmacol. 1997 Dec;98(3):273-92.
25 Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms. Endocrinology. 2003 Aug;144(8):3382-98.
26 CYP3A4 is the major CYP isoform mediating the in vitro hydroxylation and demethylation of flunitrazepam. Drug Metab Dispos. 2001 Feb;29(2):133-40.
27 Molecular characterization of CYP2B6 substrates. Curr Drug Metab. 2008 Jun;9(5):363-73.
28 Bupropion and 4-OH-bupropion pharmacokinetics in relation to genetic polymorphisms in CYP2B6. Pharmacogenetics. 2003 Oct;13(10):619-26.
29 FDA label of Hydrocodone bitartrate. The 2020 official website of the U.S. Food and Drug Administration.
30 A novel distal enhancer module regulated by pregnane X receptor/constitutive androstane receptor is essential for the maximal induction of CYP2B6 gene expression. J Biol Chem. 2003 Apr 18;278(16):14146-52.
31 Reappraisal of human CYP isoforms involved in imipramine N-demethylation and 2-hydroxylation: a study using microsomes obtained from putative extensive and poor metabolizers of S-mephenytoin and eleven recombinant human CYPs. J Pharmacol Exp Ther. 1997 Jun;281(3):1199-210.
32 Summary of information on human CYP enzymes: human P450 metabolism data. Drug Metab Rev. 2002 Feb-May;34(1-2):83-448.
33 Effects of rifampin on the pharmacokinetics of a single dose of istradefylline in healthy subjects. J Clin Pharmacol. 2018 Feb;58(2):193-201.
34 Contribution of CYP3A4, CYP2B6, and CYP2C9 isoforms to N-demethylation of ketamine in human liver microsomes. Drug Metab Dispos. 2002 Jul;30(7):853-8.
35 Ketobemidone is a substrate for cytochrome P4502C9 and 3A4, but not for P-glycoprotein. Xenobiotica. 2005 Aug;35(8):785-96.
36 Identification of cytochrome P450 isoforms involved in the metabolism of loperamide in human liver microsomes. Eur J Clin Pharmacol. 2004 Oct;60(8):575-81.
37 Metabolism of loratadine and further characterization of its in vitro metabolites. Drug Metab Lett. 2009 Aug;3(3):162-70.
38 Identification of human cytochrome P450 and flavin-containing monooxygenase enzymes involved in the metabolism of lorcaserin, a novel selective human 5-hydroxytryptamine 2C agonist. Drug Metab Dispos. 2012 Apr;40(4):761-71.
39 Malathion bioactivation in the human liver: the contribution of different cytochrome p450 isoforms. Drug Metab Dispos. 2005 Mar;33(3):295-302.
40 Methadone metabolism and drug-drug interactions: in vitro and in vivo literature review. J Pharm Sci. 2018 Dec;107(12):2983-2991.
41 Human kidney methoxyflurane and sevoflurane metabolism. Intrarenal fluoride production as a possible mechanism of methoxyflurane nephrotoxicity. Anesthesiology. 1995 Mar;82(3):689-99.
42 Pharmacogenetic roles of CYP2C19 and CYP2B6 in the metabolism of R- and S-mephobarbital in humans. Pharmacogenetics. 2004 Aug;14(8):549-56.
43 Metabolism of anabolic steroids by recombinant human cytochrome P450 enzymes. Gas chromatographic-mass spectrometric determination of metabolites. J Chromatogr B Biomed Sci Appl. 1999 Nov 26;735(1):73-83.
44 Role of specific cytochrome P450 enzymes in the N-oxidation of the antiarrhythmic agent mexiletine. Xenobiotica. 2003 Jan;33(1):13-25.
45 Further characterization of the expression in liver and catalytic activity of CYP2B6. J Pharmacol Exp Ther. 1998 Sep;286(3):1253-9.
46 NINLARO- European Medicines Agency - European Union
47 RAT CYP3A and CYP2B1/2 were not associated with nevirapine-induced hepatotoxicity. Methods Find Exp Clin Pharmacol. 2006 Sep;28(7):423-31.
48 Nicotine and 4-(methylnitrosamino)-1-(3-pyridyl)-butanone metabolism by cytochrome P450 2B6. Drug Metab Dispos. 2005 Dec;33(12):1760-4.
49 Ospemifene metabolism in humans in vitro and in vivo: metabolite identification, quantitation, and CYP assignment of major hydroxylations. Drug Metabol Drug Interact. 2013;28(3):153-61.
50 CYP2B6, CYP2D6, and CYP3A4 catalyze the primary oxidative metabolism of perhexiline enantiomers by human liver microsomes. Drug Metab Dispos. 2007 Jan;35(1):128-38.
51 Human metabolic interactions of environmental chemicals. J Biochem Mol Toxicol. 2007;21(4):182-6.
52 PharmGKB summary: phenytoin pathway. Pharmacogenet Genomics. 2012 Jun;22(6):466-70.
53 The evolution of antiplatelet therapy in the treatment of acute coronary syndromes: from aspirin to the present day. Drugs. 2012 Nov 12;72(16):2087-116.
54 Involvement of human cytochrome P450 2B6 in the omega- and 4-hydroxylation of the anesthetic agent propofol. Xenobiotica. 2007 Jul;37(7):717-24.
55 Cytochrome P450 2B6 activity as measured by bupropion hydroxylation: effect of induction by rifampin and ethnicity. Clin Pharmacol Ther. 2006 Jul;80(1):75-84.
56 FDA Label of Romidepsin. The 2020 official website of the U.S. Food and Drug Administration.
57 Evaluation of metabolism dependent inhibition of CYP2B6 mediated bupropion hydroxylation in human liver microsomes by monoamine oxidase inhibitors and prediction of potential as perpetrators of drug interaction. Chem Biol Interact. 2015 Mar 25;230:9-20.
58 Influence of CYP2B6 and CYP2C19 polymorphisms on sertraline metabolism in major depression patients. Int J Clin Pharm. 2016 Apr;38(2):388-94.
59 Effect of tamoxifen on the enzymatic activity of human cytochrome CYP2B6. J Pharmacol Exp Ther. 2002 Jun;301(3):945-52.
60 Human liver microsomal diazepam metabolism using cDNA-expressed cytochrome P450s: role of CYP2B6, 2C19 and the 3A subfamily. Xenobiotica. 1996 Nov;26(11):1155-66.
61 Metabolism of thalidomide in human microsomes, cloned human cytochrome P-450 isozymes, and Hansen's disease patients. J Biochem Mol Toxicol. 2000;14(3):140-7.
62 Clinical pharmacology of tramadol. Clin Pharmacokinet. 2004;43(13):879-923.
63 FDA label of Trifarotene. The 2020 official website of the U.S. Food and Drug Administration.
64 Investigation of the major human hepatic cytochrome P450 involved in 4-hydroxylation and N-dechloroethylation of trofosfamide. Cancer Chemother Pharmacol. 1999;44(4):327-34.
65 Epclusa- European Medicines Agency - European Union
66 Identification of the cytochrome P450 and other enzymes involved in the in vitro oxidative metabolism of a novel antidepressant, Lu AA21004. Drug Metab Dispos. 2012 Jul;40(7):1357-65.
67 FDA label of Fedratinib. The 2020 official website of the U.S. Food and Drug Administration.
68 Identification of cytochrome P450 enzymes involved in the metabolism of zotepine, an antipsychotic drug, in human liver microsomes. Xenobiotica. 1999 Mar;29(3):217-29.
69 In vitro metabolism of TAK-438, vonoprazan fumarate, a novel potassium-competitive acid blocker. Xenobiotica. 2017 Dec;47(12):1027-1034.
70 Fexinidazole--a new oral nitroimidazole drug candidate entering clinical development for the treatment of sleeping sickness. PLoS Negl Trop Dis. 2010 Dec 21;4(12):e923.
71 Australian Public Assessment Report for asunaprevir.
72 Effect of azole antifungals ketoconazole and fluconazole on the pharmacokinetics of dexloxiglumide. Br J Clin Pharmacol. 2005 Nov;60(5):498-507.
73 Metabolism of the trisubstituted purine cyclin-dependent kinase inhibitor seliciclib (R-roscovitine) in vitro and in vivo. Drug Metab Dispos. 2008 Mar;36(3):561-70.
74 Nonclinical pharmacokinetics and in vitro metabolism of H3B-6545, a novel selective ERalpha covalent antagonist (SERCA). Cancer Chemother Pharmacol. 2019 Jan;83(1):151-160.
75 Conformational adaptation of human cytochrome P450 2B6 and rabbit cytochrome P450 2B4 revealed upon binding multiple amlodipine molecules. Biochemistry. 2012 Sep 18;51(37):7225-38.
76 Tumor-selective drug activation: a GDEPT approach utilizing cytochrome P450 1A1 and AQ4N. Cancer Gene Ther. 2006 Jun;13(6):598-605.
77 Roles of human CYP2A6 and 2B6 and rat CYP2C11 and 2B1 in the 10-hydroxylation of (-)-verbenone by liver microsomes. Drug Metab Dispos. 2003 Aug;31(8):1049-53.
78 Orphenadrine and methimazole inhibit multiple cytochrome P450 enzymes in human liver microsomes. Drug Metab Dispos. 1997 Mar;25(3):390-3.