Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9BP2S0)

• DOT Name: Alpha-1-antichymotrypsin (SERPINA3)
• Synonyms: ACT; Cell growth-inhibiting gene 24/25 protein; Serpin A3
• Gene Name: SERPINA3
• Related Disease:
  Adult glioblastoma
  Glioma
  Type-1/2 diabetes
  Advanced cancer
  Breast cancer
  Breast carcinoma
  Chronic obstructive pulmonary disease
  Clear cell renal carcinoma
  Coagulation defect
  Colon cancer
  Colon carcinoma
  Diabetic retinopathy
  Epithelial ovarian cancer
  Familial Alzheimer disease
  Hepatocellular carcinoma
  Insomnia
  Intracerebral hemorrhage
  Malaria
  Melanoma
  Multiple sclerosis
  Non-insulin dependent diabetes
  Non-small-cell lung cancer
  Ovarian cancer
  Ovarian neoplasm
  Pancreatic cancer
  Parkinson disease
  Pertussis
  Prion disease
  Prostate carcinoma
  Pulmonary emphysema
  Rheumatoid arthritis
  Schizophrenia
  Stroke
  Cerebrovascular disease
  Retinopathy
  Acute myocardial infarction
  Amyotrophic lateral sclerosis type 1
  Aplasia cutis congenita
  Asthma
  Corpus callosum, agenesis of
  Familial amyotrophic lateral sclerosis
  Glioblastoma multiforme
  Lupus nephritis
  Lysosomal lipid storage disorder
  Mental disorder
  Myocardial infarction
  Prostate cancer
  Prostate neoplasm
  Pulmonary tuberculosis
• UniProt ID: AACT_HUMAN
• PDB ID: 1AS4; 1QMN; 2ACH; 3CAA; 3DLW; 4CAA; 6HGE
• Pfam ID: PF00079
• Sequence:
  MERMLPLLALGLLAAGFCPAVLCHPNSPLDEENLTQENQDRGTHVDLGLASANVDFAFSL
  YKQLVLKAPDKNVIFSPLSISTALAFLSLGAHNTTLTEILKGLKFNLTETSEAEIHQSFQ
  HLLRTLNQSSDELQLSMGNAMFVKEQLSLLDRFTEDAKRLYGSEAFATDFQDSAAAKKLI
  NDYVKNGTRGKITDLIKDLDSQTMMVLVNYIFFKAKWEMPFDPQDTHQSRFYLSKKKWVM
  VPMMSLHHLTIPYFRDEELSCTVVELKYTGNASALFILPDQDKMEEVEAMLLPETLKRWR
  DSLEFREIGELYLPKFSISRDYNLNDILLQLGIEEAFTSKADLSGITGARNLAVSQVVHK
  AVLDVFEEGTEASAATAVKITLLSALVETRTIVRFNRPFLMIIVPTDTQNIFFMSKVTNP
  KQA
• Function: Although its physiological function is unclear, it can inhibit neutrophil cathepsin G and mast cell chymase, both of which can convert angiotensin-1 to the active angiotensin-2.
• Tissue Specificity: Plasma. Synthesized in the liver. Like the related alpha-1-antitrypsin, its concentration increases in the acute phase of inflammation or infection. Found in the amyloid plaques from the hippocampus of Alzheimer disease brains.
• Reactome Pathway:
  Neutrophil degranulation (R-HSA-6798695)
  Platelet degranulation (R-HSA-114608)

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Definitive	Biomarker	[1]
Glioma	DIS5RPEH	Definitive	Altered Expression	[1]
Type-1/2 diabetes	DISIUHAP	Definitive	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Breast cancer	DIS7DPX1	Strong	Genetic Variation	[4]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[4]
Chronic obstructive pulmonary disease	DISQCIRF	Strong	Genetic Variation	[5]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[3]
Coagulation defect	DIS9X3H6	Strong	Biomarker	[6]
Colon cancer	DISVC52G	Strong	Biomarker	[7]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[7]
Diabetic retinopathy	DISHGUJM	Strong	Biomarker	[2]
Epithelial ovarian cancer	DIS56MH2	Strong	Genetic Variation	[8]
Familial Alzheimer disease	DISE75U4	Strong	Genetic Variation	[9]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[10]
Insomnia	DIS0AFR7	Strong	Biomarker	[11]
Intracerebral hemorrhage	DISC81BT	Strong	Genetic Variation	[12]
Malaria	DISQ9Y50	Strong	Biomarker	[13]
Melanoma	DIS1RRCY	Strong	Altered Expression	[14]
Multiple sclerosis	DISB2WZI	Strong	Altered Expression	[15]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[16]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[17]
Ovarian cancer	DISZJHAP	Strong	Genetic Variation	[8]
Ovarian neoplasm	DISEAFTY	Strong	Genetic Variation	[8]
Pancreatic cancer	DISJC981	Strong	Biomarker	[18]
Parkinson disease	DISQVHKL	Strong	Biomarker	[19]
Pertussis	DISQZUE7	Strong	Biomarker	[20]
Prion disease	DISOUMB0	Strong	Biomarker	[21]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[22]
Pulmonary emphysema	DIS5M7HZ	Strong	Biomarker	[23]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[24]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[25]
Stroke	DISX6UHX	Strong	Genetic Variation	[26]
Cerebrovascular disease	DISAB237	moderate	Genetic Variation	[27]
Retinopathy	DISB4B0F	moderate	Therapeutic	[28]
Acute myocardial infarction	DISE3HTG	Limited	Altered Expression	[29]
Amyotrophic lateral sclerosis type 1	DIS5A2M0	Limited	Biomarker	[30]
Aplasia cutis congenita	DISMDAYM	Limited	Biomarker	[31]
Asthma	DISW9QNS	Limited	Biomarker	[32]
Corpus callosum, agenesis of	DISO9P40	Limited	Biomarker	[31]
Familial amyotrophic lateral sclerosis	DISWZ9CJ	Limited	Biomarker	[30]
Glioblastoma multiforme	DISK8246	Limited	Biomarker	[33]
Lupus nephritis	DISCVGPZ	Limited	Biomarker	[34]
Lysosomal lipid storage disorder	DISXQRTX	Limited	Biomarker	[35]
Mental disorder	DIS3J5R8	Limited	Biomarker	[36]
Myocardial infarction	DIS655KI	Limited	Altered Expression	[29]
Prostate cancer	DISF190Y	Limited	Biomarker	[22]
Prostate neoplasm	DISHDKGQ	Limited	Biomarker	[37]
Pulmonary tuberculosis	DIS6FLUM	Limited	Biomarker	[38]

37 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[39]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[40]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[35]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[42]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[43]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[44]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[45]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[46]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[47]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[47]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[48]
Isotretinoin	DM4QTBN	Approved	Isotretinoin increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[40]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[43]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[49]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Alpha-1-antichymotrypsin (SERPINA3).	[50]
Clozapine	DMFC71L	Approved	Clozapine increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[51]
Alitretinoin	DMME8LH	Approved	Alitretinoin increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[40]
Haloperidol	DM96SE0	Approved	Haloperidol increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[35]
Fluoxetine	DM3PD2C	Approved	Fluoxetine increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[51]
Sertraline	DM0FB1J	Approved	Sertraline increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[51]
Rofecoxib	DM3P5DA	Approved	Rofecoxib increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[52]
Tetracycline	DMZA017	Approved	Tetracycline increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[35]
Thioridazine	DM35M8J	Approved	Thioridazine increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[51]
Imipramine	DM2NUH3	Approved	Imipramine increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[51]
Clomipramine	DMINRKW	Approved	Clomipramine increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[51]
Citalopram	DM2G9AE	Approved	Citalopram increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[54]
Loratadine	DMF3AN7	Approved	Loratadine increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[51]
Pentamidine	DMHZJCG	Approved	Pentamidine increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[51]
Flecainide	DMSQDLE	Approved	Flecainide increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[51]
Perhexiline	DMINO7Z	Approved	Perhexiline increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[51]
Doxepin	DMPI98T	Approved	Doxepin increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[54]
Chlorpromazine	DMBGZI3	Phase 3 Trial	Chlorpromazine increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[51]
Chlorcyclizine	DM3L52Q	Phase 1	Chlorcyclizine increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[51]
ZIMELIDINE	DMNI3U2	Withdrawn from market	ZIMELIDINE increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[51]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Alpha-1-antichymotrypsin (SERPINA3).	[56]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[57]
all-trans-4-oxo-retinoic acid	DMM2R1N	Investigative	all-trans-4-oxo-retinoic acid increases the expression of Alpha-1-antichymotrypsin (SERPINA3).	[40]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Olanzapine	DMPFN6Y	Approved	Olanzapine increases the phosphorylation of Alpha-1-antichymotrypsin (SERPINA3).	[53]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Alpha-1-antichymotrypsin (SERPINA3).	[55]

References

• [1] SERPINA3 induced by astroglia/microglia co-culture facilitates glioblastoma stem-like cell invasion.Oncol Lett. 2018 Jan;15(1):285-291. doi: 10.3892/ol.2017.7275. Epub 2017 Oct 26.
• [2] Differential proteome analysis of serum proteins associated with the development of type 2 diabetes mellitus in the KK-A(y) mouse model using the iTRAQ technique.J Proteomics. 2013 Jun 12;84:40-51. doi: 10.1016/j.jprot.2013.03.014. Epub 2013 Mar 29.
• [3] Dual-Tracer PET/CT Differentiates 2 Types of Primary Cancers and Metastases in a Patient With Crossed Fused Renal Ectopia.Clin Nucl Med. 2019 Feb;44(2):157-158. doi: 10.1097/RLU.0000000000002390.
• [4] Association of vitamin D receptor gene polymorphisms with breast cancer risk in an Egyptian population.Tumour Biol. 2017 Oct;39(10):1010428317727738. doi: 10.1177/1010428317727738.
• [5] COPD patients prescribed inhaled corticosteroid in general practice: Based on disease characteristics according to guidelines?.Chron Respir Dis. 2019 Jan-Dec;16:1479973119867949. doi: 10.1177/1479973119867949.
• [6] Coagulopathy as a predictor of mortality after penetrating traumatic brain injury.Am J Emerg Med. 2018 Jan;36(1):38-42. doi: 10.1016/j.ajem.2017.06.057. Epub 2017 Jul 5.
• [7] Heart Failure Stimulates Tumor Growth by Circulating Factors.Circulation. 2018 Aug 14;138(7):678-691. doi: 10.1161/CIRCULATIONAHA.117.030816.
• [8] Breast and ovarian cancer referrals to the ACT Genetic Service: are we meeting guidelines?.Intern Med J. 2017 Mar;47(3):311-317. doi: 10.1111/imj.13357.
• [9] Apolipoprotein E and alpha-1-antichymotrypsin allele polymorphism in sporadic and familial Alzheimer's disease.Neurosci Lett. 1999 Aug 6;270(3):129-32. doi: 10.1016/s0304-3940(99)00468-1.
• [10] SERPINA3 is a key modulator of HNRNP-K transcriptional activity against oxidative stress in HCC.Redox Biol. 2019 Jun;24:101217. doi: 10.1016/j.redox.2019.101217. Epub 2019 May 12.
• [11] Clinical pharmacology of the dual orexin receptor antagonist ACT-541468 in elderly subjects: Exploration of pharmacokinetics, pharmacodynamics and tolerability following single-dose morning and repeated-dose evening administration.J Psychopharmacol. 2020 Mar;34(3):326-335. doi: 10.1177/0269881119882854. Epub 2019 Oct 23.
• [12] Alpha-1 antichymotrypsin gene signal peptide a/t polymorphism and primary intracerebral hemorrhage.Eur Neurol. 2008;59(6):307-14. doi: 10.1159/000121420. Epub 2008 Apr 11.
• [13] Mass drug administration can be a valuable addition to the malaria elimination toolbox.Malar J. 2019 Aug 22;18(1):281. doi: 10.1186/s12936-019-2906-8.
• [14] Knockdown of STAT3 targets a subpopulation of invasive melanoma stem-like cells.Cell Biol Int. 2019 Jun;43(6):613-622. doi: 10.1002/cbin.11134. Epub 2019 Apr 30.
• [15] Cerebrospinal fluid biomarkers link toxic astrogliosis and microglial activation to multiple sclerosis severity.Mult Scler Relat Disord. 2019 Feb;28:34-43. doi: 10.1016/j.msard.2018.11.032. Epub 2018 Dec 5.
• [16] Proteomic analysis of serum biomarkers for prediabetes using the Long-Evans Agouti rat, a spontaneous animal model of type 2 diabetes mellitus.J Diabetes Investig. 2017 Sep;8(5):661-671. doi: 10.1111/jdi.12638. Epub 2017 Mar 27.
• [17] Identification a novel clinical biomarker in early diagnosis of human non-small cell lung cancer.Glycoconj J. 2019 Feb;36(1):57-68. doi: 10.1007/s10719-018-09853-z. Epub 2019 Jan 3.
• [18] Quantitative analysis of single amino acid variant peptides associated with pancreatic cancer in serum by an isobaric labeling quantitative method.J Proteome Res. 2014 Dec 5;13(12):6058-66. doi: 10.1021/pr500934u. Epub 2014 Nov 24.
• [19] The homozygote AA genotype of the alpha1-antichymotrypsin gene may confer protection against early-onset Parkinson's disease in women.Parkinsonism Relat Disord. 2004 Dec;10(8):469-73. doi: 10.1016/j.parkreldis.2004.06.001.
• [20] Membrane Permeabilization by Pore-Forming RTX Toxins: What Kind of Lesions Do These Toxins Form?.Toxins (Basel). 2019 Jun 18;11(6):354. doi: 10.3390/toxins11060354.
• [21] Differential overexpression of SERPINA3 in human prion diseases.Sci Rep. 2017 Nov 15;7(1):15637. doi: 10.1038/s41598-017-15778-8.
• [22] Early Response Monitoring Following Radiation Therapy by Using [(18)F]FDG and [(11)C]Acetate PET in Prostate Cancer Xenograft Model with Metabolomics Corroboration.Molecules. 2017 Nov 10;22(11):1946. doi: 10.3390/molecules22111946.
• [23] Conformational pathology of the serpins: themes, variations, and therapeutic strategies.Annu Rev Biochem. 2009;78:147-76. doi: 10.1146/annurev.biochem.78.082107.133320.
• [24] Efficacy of tocilizumab monotherapy after response to combined tocilizumab and methotrexate in patients with rheumatoid arthritis: the randomised JUST-ACT study.Clin Exp Rheumatol. 2019 May-Jun;37(3):437-444. Epub 2018 Sep 17.
• [25] Association of CCL11 promoter polymorphisms with schizophrenia in a Korean population.Gene. 2018 May 20;656:80-85. doi: 10.1016/j.gene.2018.02.053. Epub 2018 Feb 22.
• [26] Post-stroke dementia is associated with alpha(1)-antichymotrypsin polymorphism.J Neurol Sci. 2005 Jul 15;234(1-2):31-6. doi: 10.1016/j.jns.2005.02.012.
• [27] alpha-1-Antichymotrypsin gene A1252G variant (ACT Isehara-1) is associated with a lacunar type of ischemic cerebrovascular disease.J Hum Genet. 2001;46(1):45-7. doi: 10.1007/s100380170125.
• [28] Anti-inflammatory and antioxidant effects of SERPINA3K in the retina.Invest Ophthalmol Vis Sci. 2009 Aug;50(8):3943-52. doi: 10.1167/iovs.08-2954. Epub 2009 Mar 25.
• [29] Circulating Serpina3 levels predict the major adverse cardiac events in patients with myocardial infarction.Int J Cardiol. 2020 Feb 1;300:34-38. doi: 10.1016/j.ijcard.2019.08.034. Epub 2019 Aug 15.
• [30] Differential expression of inflammation- and apoptosis-related genes in spinal cords of a mutant SOD1 transgenic mouse model of familial amyotrophic lateral sclerosis.J Neurochem. 2002 Jan;80(1):158-67. doi: 10.1046/j.0022-3042.2001.00683.x.
• [31] Adrenocortical carcinoma -- improving patient care by establishing new structures.Exp Clin Endocrinol Diabetes. 2006 Feb;114(2):45-51. doi: 10.1055/s-2006-923808.
• [32] A Pragmatic Trial of Symptom-Based Inhaled Corticosteroid Use in African-American Children with Mild Asthma.J Allergy Clin Immunol Pract. 2020 Jan;8(1):176-185.e2. doi: 10.1016/j.jaip.2019.06.030. Epub 2019 Jul 30.
• [33] Identification of blood biomarkers in glioblastoma by SWATH mass spectrometry and quantitative targeted absolute proteomics.PLoS One. 2018 Mar 7;13(3):e0193799. doi: 10.1371/journal.pone.0193799. eCollection 2018.
• [34] Discovery of SERPINA3 as a candidate urinary biomarker of lupus nephritis activity.Rheumatology (Oxford). 2019 Feb 1;58(2):321-330. doi: 10.1093/rheumatology/key301.
• [35] Determination of phospholipidosis potential based on gene expression analysis in HepG2 cells. Toxicol Sci. 2007 Mar;96(1):101-14.
• [36] Outcomes of clients in need of intensive team care in Flexible Assertive Community Treatment in Sweden.Nord J Psychiatry. 2018 Apr;72(3):226-231. doi: 10.1080/08039488.2018.1430168. Epub 2018 Jan 26.
• [37] Alpha 1 antichymotrypsin genotype is associated with increased risk of prostate carcinoma and PSA levels.Anticancer Res. 2008 Jan-Feb;28(1B):395-9.
• [38] Label-Free Quantitative Proteomics Identifies Novel Plasma Biomarkers for Distinguishing Pulmonary Tuberculosis and Latent Infection.Front Microbiol. 2018 Jun 13;9:1267. doi: 10.3389/fmicb.2018.01267. eCollection 2018.
• [39] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [40] Retinoic acid and its 4-oxo metabolites are functionally active in human skin cells in vitro. J Invest Dermatol. 2005 Jul;125(1):143-53.
• [41] Determination of phospholipidosis potential based on gene expression analysis in HepG2 cells. Toxicol Sci. 2007 Mar;96(1):101-14.
• [42] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [43] Assaying estrogenicity by quantitating the expression levels of endogenous estrogen-regulated genes. Environ Health Perspect. 2000 May;108(5):403-12.
• [44] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [45] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [46] Oxidative Stress Alters miRNA and Gene Expression Profiles in Villous First Trimester Trophoblasts. Biomed Res Int. 2015;2015:257090. doi: 10.1155/2015/257090. Epub 2015 Aug 3.
• [47] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [48] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [49] Effects of aspirin on metastasis-associated gene expression detected by cDNA microarray. Acta Pharmacol Sin. 2004 Oct;25(10):1327-33.
• [50] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [51] A toxicogenomic approach to drug-induced phospholipidosis: analysis of its induction mechanism and establishment of a novel in vitro screening system. Toxicol Sci. 2005 Feb;83(2):282-92.
• [52] Rofecoxib modulates multiple gene expression pathways in a clinical model of acute inflammatory pain. Pain. 2007 Mar;128(1-2):136-47.
• [53] Effects of olanzapine on serum protein phosphorylation patterns in patients with schizophrenia. Proteomics Clin Appl. 2015 Oct;9(9-10):907-16. doi: 10.1002/prca.201400148. Epub 2015 May 15.
• [54] In vitro detection of drug-induced phospholipidosis using gene expression and fluorescent phospholipid based methodologies. Toxicol Sci. 2007 Sep;99(1):162-73.
• [55] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [56] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
• [57] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.