Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBFEJRQ)

• DOT Name: Krueppel-like factor 9 (KLF9)
• Synonyms: Basic transcription element-binding protein 1; BTE-binding protein 1; GC-box-binding protein 1; Transcription factor BTEB1
• Gene Name: KLF9
• Related Disease:
  Parkinson disease
  Adenoma
  Adult glioblastoma
  Colorectal carcinoma
  Colorectal neoplasm
  Endometriosis
  Endometrium adenocarcinoma
  Epithelial ovarian cancer
  Esophageal squamous cell carcinoma
  Gastric cancer
  Glioma
  Hepatocellular carcinoma
  Hyperglycemia
  Liver cirrhosis
  Medullary thyroid gland carcinoma
  Melanoma
  Mental disorder
  Metastatic malignant neoplasm
  Myocardial infarction
  Ovarian cancer
  Ovarian neoplasm
  Pancreatic ductal carcinoma
  Precancerous condition
  Prostate cancer
  Prostate carcinoma
  Pulmonary emphysema
  Pulmonary fibrosis
  Stomach cancer
  Type-1/2 diabetes
  Acute myelogenous leukaemia
  Bladder cancer
  Glioblastoma multiforme
  Lung cancer
  Lung carcinoma
  Pancreatic cancer
  Plasma cell myeloma
  Urinary bladder cancer
  Urinary bladder neoplasm
  Bone osteosarcoma
  Neuroblastoma
  Osteosarcoma
  Advanced cancer
  Brain neoplasm
  Endometrial cancer
  Endometrial carcinoma
  Matthew-Wood syndrome
  Neoplasm
• UniProt ID: KLF9_HUMAN
• Pfam ID: PF00096
• Sequence:
  MSAAAYMDFVAAQCLVSISNRAAVPEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTL
  VTIAKSLLDLNKYRPIQTPSVCSDSLESPDEDMGSDSDVTTESGSSPSHSPEERQDPGSA
  PSPLSLLHPGVAAKGKHASEKRHKCPYSGCGKVYGKSSHLKAHYRVHTGERPFPCTWPDC
  LKKFSRSDELTRHYRTHTGEKQFRCPLCEKRFMRSDHLTKHARRHTEFHPSMIKRSKKAL
  ANAL
• Function: Transcription factor that binds to GC box promoter elements. Selectively activates mRNA synthesis from genes containing tandem repeats of GC boxes but represses genes with a single GC box. Acts as an epidermal circadian transcription factor regulating keratinocyte proliferation.
• Tissue Specificity: Epidermis (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Parkinson disease	DISQVHKL	Definitive	Biomarker	[1]
Adenoma	DIS78ZEV	Strong	Biomarker	[2]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[3]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[4]
Colorectal neoplasm	DISR1UCN	Strong	Biomarker	[5]
Endometriosis	DISX1AG8	Strong	Biomarker	[6]
Endometrium adenocarcinoma	DISY6744	Strong	Biomarker	[7]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[8]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[9]
Gastric cancer	DISXGOUK	Strong	Biomarker	[10]
Glioma	DIS5RPEH	Strong	Biomarker	[11]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[12]
Hyperglycemia	DIS0BZB5	Strong	Biomarker	[13]
Liver cirrhosis	DIS4G1GX	Strong	Altered Expression	[14]
Medullary thyroid gland carcinoma	DISHBL3K	Strong	Biomarker	[15]
Melanoma	DIS1RRCY	Strong	Biomarker	[16]
Mental disorder	DIS3J5R8	Strong	Genetic Variation	[17]
Metastatic malignant neoplasm	DIS86UK6	Strong	Altered Expression	[16]
Myocardial infarction	DIS655KI	Strong	Biomarker	[18]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[8]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[8]
Pancreatic ductal carcinoma	DIS26F9Q	Strong	Biomarker	[19]
Precancerous condition	DISV06FL	Strong	Altered Expression	[16]
Prostate cancer	DISF190Y	Strong	Biomarker	[20]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[20]
Pulmonary emphysema	DIS5M7HZ	Strong	Altered Expression	[14]
Pulmonary fibrosis	DISQKVLA	Strong	Altered Expression	[21]
Stomach cancer	DISKIJSX	Strong	Biomarker	[10]
Type-1/2 diabetes	DISIUHAP	Strong	Altered Expression	[22]
Acute myelogenous leukaemia	DISCSPTN	moderate	Genetic Variation	[23]
Bladder cancer	DISUHNM0	moderate	Altered Expression	[24]
Glioblastoma multiforme	DISK8246	moderate	Biomarker	[3]
Lung cancer	DISCM4YA	moderate	Biomarker	[25]
Lung carcinoma	DISTR26C	moderate	Biomarker	[25]
Pancreatic cancer	DISJC981	moderate	Altered Expression	[26]
Plasma cell myeloma	DIS0DFZ0	moderate	Genetic Variation	[27]
Urinary bladder cancer	DISDV4T7	moderate	Altered Expression	[24]
Urinary bladder neoplasm	DIS7HACE	moderate	Altered Expression	[24]
Bone osteosarcoma	DIST1004	Disputed	Biomarker	[28]
Neuroblastoma	DISVZBI4	Disputed	Altered Expression	[29]
Osteosarcoma	DISLQ7E2	Disputed	Biomarker	[28]
Advanced cancer	DISAT1Z9	Limited	Altered Expression	[30]
Brain neoplasm	DISY3EKS	Limited	Altered Expression	[3]
Endometrial cancer	DISW0LMR	Limited	Biomarker	[31]
Endometrial carcinoma	DISXR5CY	Limited	Altered Expression	[31]
Matthew-Wood syndrome	DISA7HR7	Limited	Altered Expression	[19]
Neoplasm	DISZKGEW	Limited	Biomarker	[29]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Krueppel-like factor 9 (KLF9).	[32]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Krueppel-like factor 9 (KLF9).	[57]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Krueppel-like factor 9 (KLF9).	[58]

33 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Krueppel-like factor 9 (KLF9).	[33]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Krueppel-like factor 9 (KLF9).	[34]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Krueppel-like factor 9 (KLF9).	[35]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Krueppel-like factor 9 (KLF9).	[36]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Krueppel-like factor 9 (KLF9).	[37]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Krueppel-like factor 9 (KLF9).	[38]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Krueppel-like factor 9 (KLF9).	[39]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Krueppel-like factor 9 (KLF9).	[40]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Krueppel-like factor 9 (KLF9).	[41]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Krueppel-like factor 9 (KLF9).	[42]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Krueppel-like factor 9 (KLF9).	[43]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Krueppel-like factor 9 (KLF9).	[44]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Krueppel-like factor 9 (KLF9).	[38]
Marinol	DM70IK5	Approved	Marinol increases the expression of Krueppel-like factor 9 (KLF9).	[45]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Krueppel-like factor 9 (KLF9).	[46]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Krueppel-like factor 9 (KLF9).	[47]
Irinotecan	DMP6SC2	Approved	Irinotecan increases the expression of Krueppel-like factor 9 (KLF9).	[48]
Amphotericin B	DMTAJQE	Approved	Amphotericin B decreases the expression of Krueppel-like factor 9 (KLF9).	[49]
Liothyronine	DM6IR3P	Approved	Liothyronine decreases the expression of Krueppel-like factor 9 (KLF9).	[39]
Bexarotene	DMOBIKY	Approved	Bexarotene increases the expression of Krueppel-like factor 9 (KLF9).	[50]
Methimazole	DM25FL8	Approved	Methimazole increases the expression of Krueppel-like factor 9 (KLF9).	[39]
Propylthiouracil	DM6D7N8	Approved	Propylthiouracil increases the expression of Krueppel-like factor 9 (KLF9).	[39]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Krueppel-like factor 9 (KLF9).	[51]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Krueppel-like factor 9 (KLF9).	[52]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene decreases the expression of Krueppel-like factor 9 (KLF9).	[34]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol increases the expression of Krueppel-like factor 9 (KLF9).	[53]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Krueppel-like factor 9 (KLF9).	[46]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Krueppel-like factor 9 (KLF9).	[54]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Krueppel-like factor 9 (KLF9).	[55]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Krueppel-like factor 9 (KLF9).	[56]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Krueppel-like factor 9 (KLF9).	[59]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Krueppel-like factor 9 (KLF9).	[60]
Manganese	DMKT129	Investigative	Manganese decreases the expression of Krueppel-like factor 9 (KLF9).	[61]

References

• [1] Angiotensin II induces oxidative stress and upregulates neuroprotective signaling from the NRF2 and KLF9 pathway in dopaminergic cells.Free Radic Biol Med. 2018 Dec;129:394-406. doi: 10.1016/j.freeradbiomed.2018.10.409. Epub 2018 Oct 11.
• [2] Krppel-like factor 9 (KLF9) prevents colorectal cancer through inhibition of interferon-related signaling.Carcinogenesis. 2015 Sep;36(9):946-55. doi: 10.1093/carcin/bgv104. Epub 2015 Jul 25.
• [3] Krppel-like factor 9 and histone deacetylase inhibitors synergistically induce cell death in glioblastoma stem-like cells.BMC Cancer. 2018 Oct 22;18(1):1025. doi: 10.1186/s12885-018-4874-8.
• [4] Prognosis Prediction of Colorectal Cancer Using Gene Expression Profiles.Front Oncol. 2019 Apr 9;9:252. doi: 10.3389/fonc.2019.00252. eCollection 2019.
• [5] Transcription factor KLF9 suppresses the growth of hepatocellular carcinoma cells in vivo and positively regulates p53 expression.Cancer Lett. 2014 Dec 1;355(1):25-33. doi: 10.1016/j.canlet.2014.09.022. Epub 2014 Sep 19.
• [6] MicroRNA-142-3p suppresses endometriosis by regulating KLF9-mediated autophagy in vitro and in vivo.RNA Biol. 2019 Dec;16(12):1733-1748. doi: 10.1080/15476286.2019.1657352. Epub 2019 Aug 25.
• [7] Kruppel-like factor 9 is a negative regulator of ligand-dependent estrogen receptor alpha signaling in Ishikawa endometrial adenocarcinoma cells.Mol Endocrinol. 2007 Dec;21(12):2988-3001. doi: 10.1210/me.2007-0242. Epub 2007 Aug 23.
• [8] Lentivirus-mediated knockdown of Krppel-like factor 9 inhibits the growth of ovarian cancer.Arch Gynecol Obstet. 2015 Feb;291(2):377-82. doi: 10.1007/s00404-014-3405-3. Epub 2014 Sep 13.
• [9] Krppel-like factor 9 was down-regulated in esophageal squamous cell carcinoma and negatively regulated beta-catenin/TCF signaling.Mol Carcinog. 2016 Mar;55(3):280-91. doi: 10.1002/mc.22277. Epub 2015 Jan 16.
• [10] KLF9 suppresses gastric cancer cell invasion and metastasis through transcriptional inhibition of MMP28.FASEB J. 2019 Jul;33(7):7915-7928. doi: 10.1096/fj.201802531R. Epub 2019 Mar 26.
• [11] MicroRNA?40 promotes cell proliferation and invasion of glioma by directly targeting Kruppellike factor9.Mol Med Rep. 2019 Jan;19(1):734-742. doi: 10.3892/mmr.2018.9630. Epub 2018 Nov 7.
• [12] Krppel-like factors in hepatocellular carcinoma.Tumour Biol. 2015 Feb;36(2):533-41. doi: 10.1007/s13277-015-3127-6. Epub 2015 Feb 6.
• [13] Dexamethasone-induced Krppel-like factor 9 expression promotes hepatic gluconeogenesis and hyperglycemia.J Clin Invest. 2019 Apr 29;129(6):2266-2278. doi: 10.1172/JCI66062. eCollection 2019 Apr 29.
• [14] Krppel-like zinc finger proteins in end-stage COPD lungs with and without severe alpha1-antitrypsin deficiency.Orphanet J Rare Dis. 2012 May 23;7:29. doi: 10.1186/1750-1172-7-29.
• [15] Combinations of Tyrosine Kinase Inhibitor and ERAD Inhibitor Promote Oxidative Stress-Induced Apoptosis through ATF4 and KLF9 in Medullary Thyroid Cancer.Mol Cancer Res. 2019 Mar;17(3):751-760. doi: 10.1158/1541-7786.MCR-18-0354. Epub 2018 Dec 14.
• [16] KLF9-dependent ROS regulate melanoma progression in stage-specific manner.Oncogene. 2019 May;38(19):3585-3597. doi: 10.1038/s41388-019-0689-6. Epub 2019 Jan 21.
• [17] Association of body mass index-related single nucleotide polymorphisms with psychiatric disease and memory performance in a Japanese population.Acta Neuropsychiatr. 2017 Oct;29(5):299-308. doi: 10.1017/neu.2016.66. Epub 2016 Dec 7.
• [18] KLF9 aggravates ischemic injury in cardiomyocytes through augmenting oxidative stress.Life Sci. 2019 Sep 15;233:116641. doi: 10.1016/j.lfs.2019.116641. Epub 2019 Jul 8.
• [19] Krppel-like factor 9 suppressed tumorigenicity of the pancreatic ductal adenocarcinoma by negatively regulating frizzled-5.Biochem Biophys Res Commun. 2018 May 23;499(4):815-821. doi: 10.1016/j.bbrc.2018.03.229. Epub 2018 Apr 4.
• [20] MiR-141-3p promotes prostate cancer cell proliferation through inhibiting kruppel-like factor-9 expression.Biochem Biophys Res Commun. 2017 Jan 22;482(4):1381-1386. doi: 10.1016/j.bbrc.2016.12.045. Epub 2016 Dec 9.
• [21] Nrf2 amplifies oxidative stress via induction of Klf9.Mol Cell. 2014 Mar 20;53(6):916-928. doi: 10.1016/j.molcel.2014.01.033. Epub 2014 Mar 6.
• [22] Taking KLF9 to "Cort" for crimes against metabolism.J Clin Invest. 2019 Apr 29;129(6):2178-2180. doi: 10.1172/JCI128481. eCollection 2019 Apr 29.
• [23] Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
• [24] CircPTPRA acts as a tumor suppressor in bladder cancer by sponging miR-636 and upregulating KLF9.Aging (Albany NY). 2019 Dec 10;11(23):11314-11328. doi: 10.18632/aging.102530. Epub 2019 Dec 10.
• [25] MicroRNA-570 promotes lung carcinoma proliferation through targeting tumor suppressor KLF9.Int J Clin Exp Pathol. 2015 Mar 1;8(3):2829-34. eCollection 2015.
• [26] Expression of KLF9 in pancreatic cancer and its effects on the invasion, migration, apoptosis, cell cycle distribution, and proliferation of pancreatic cancer cell lines.Oncol Rep. 2018 Dec;40(6):3852-3860. doi: 10.3892/or.2018.6760. Epub 2018 Oct 2.
• [27] Regions of homozygosity as risk factors for multiple myeloma.Ann Hum Genet. 2019 Jul;83(4):231-238. doi: 10.1111/ahg.12304. Epub 2019 Feb 15.
• [28] MiR-378 promotes the cell proliferation of osteosarcoma through down-regulating the expression of Kruppel-like factor 9.Biochem Cell Biol. 2018 Oct;96(5):515-521. doi: 10.1139/bcb-2017-0186. Epub 2018 Feb 28.
• [29] Krppel-like factor 9 promotes neuroblastoma differentiation via targeting the sonic hedgehog signaling pathway.Pediatr Blood Cancer. 2020 Mar;67(3):e28108. doi: 10.1002/pbc.28108. Epub 2019 Nov 29.
• [30] THBS4 predicts poor outcomes and promotes proliferation and metastasis in gastric cancer.J Physiol Biochem. 2019 Feb;75(1):117-123. doi: 10.1007/s13105-019-00665-9. Epub 2019 Feb 12.
• [31] Krppel-like factor 9 loss-of-expression in human endometrial carcinoma links altered expression of growth-regulatory genes with aberrant proliferative response to estrogen.Biol Reprod. 2011 Aug;85(2):378-85. doi: 10.1095/biolreprod.110.090654. Epub 2011 May 4.
• [32] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [33] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [34] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [35] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [36] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [37] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [38] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [39] Monitoring of deiodinase deficiency based on transcriptomic responses in SH-SY5Y cells. Arch Toxicol. 2013 Jun;87(6):1103-13. doi: 10.1007/s00204-013-1018-4. Epub 2013 Feb 10.
• [40] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [41] Global effects of inorganic arsenic on gene expression profile in human macrophages. Mol Immunol. 2009 Feb;46(4):649-56.
• [42] Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
• [43] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [44] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [45] Delta9-tetrahydrocannabinol inhibits cytotrophoblast cell proliferation and modulates gene transcription. Mol Hum Reprod. 2006 May;12(5):321-33. doi: 10.1093/molehr/gal036. Epub 2006 Apr 5.
• [46] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [47] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [48] In vitro and in vivo irinotecan-induced changes in expression profiles of cell cycle and apoptosis-associated genes in acute myeloid leukemia cells. Mol Cancer Ther. 2005 Jun;4(6):885-900.
• [49] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [50] Pituitary specific retinoid-X receptor ligand interactions with thyroid hormone receptor signaling revealed by high throughput reporter and endogenous gene responses. Toxicol In Vitro. 2015 Oct;29(7):1609-18. doi: 10.1016/j.tiv.2015.06.018. Epub 2015 Jun 19.
• [51] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [52] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [53] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [54] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [55] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [56] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [57] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [58] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [59] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [60] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [61] Gene expression profiling of human primary astrocytes exposed to manganese chloride indicates selective effects on several functions of the cells. Neurotoxicology. 2007 May;28(3):478-89.