Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTG2JXV5)

• DOT Name: Transcription factor JunB (JUNB)
• Synonyms: Transcription factor AP-1 subunit JunB
• Gene Name: JUNB
• Related Disease:
  Adult glioblastoma
  Advanced cancer
  Asthma
  Atopic dermatitis
  Autoimmune disease
  B-cell neoplasm
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Carcinoma
  Carcinoma of liver and intrahepatic biliary tract
  Cervical cancer
  Cervical carcinoma
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Endometrial carcinoma
  Liver cancer
  Lung neoplasm
  Lymphoma
  Myocardial ischemia
  Neoplasm
  Osteoarthritis
  Osteosarcoma
  Pneumonia
  Pneumonitis
  Primary cutaneous T-cell lymphoma
  Prostate cancer
  Prostate carcinoma
  Psoriasis
  Renal carcinoma
  Rheumatoid arthritis
  Status epilepticus seizure
  Systemic lupus erythematosus
  Anaplastic large cell lymphoma
  Glioblastoma multiforme
  Head-neck squamous cell carcinoma
  Lung carcinoma
  Pediatric lymphoma
  Lung adenocarcinoma
  Lung cancer
  Plasma cell myeloma
  Breast neoplasm
  Hepatitis C virus infection
  Melanoma
  Neuroblastoma
  Pancreatic cancer
• UniProt ID: JUNB_HUMAN
• Pfam ID: PF00170 ; PF03957
• Sequence:
  MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGP
  EGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGG
  AGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPP
  VYTNLSSYSPASASSGGAGAAVGTGSSYPTTTISYLPHAPPFAGGHPAQLGLGRGASTFK
  EEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKV
  KTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF
• Function: Transcription factor involved in regulating gene activity following the primary growth factor response. Binds to the DNA sequence 5'-TGA[GC]TCA-3'. Heterodimerizes with proteins of the FOS family to form an AP-1 transcription complex, thereby enhancing its DNA binding activity to an AP-1 consensus sequence and its transcriptional activity.
• KEGG Pathway:
  Osteoclast differentiation (hsa04380)
  TNF sig.ling pathway (hsa04668)
  Growth hormone synthesis, secretion and action (hsa04935)
• Reactome Pathway:
  Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807)
  NGF-stimulated transcription (R-HSA-9031628)
  Nuclear events stimulated by ALK signaling in cancer (R-HSA-9725371)
  SMAD2/SMAD3 (R-HSA-2173796)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[1]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[2]
Asthma	DISW9QNS	Strong	Biomarker	[3]
Atopic dermatitis	DISTCP41	Strong	Altered Expression	[4]
Autoimmune disease	DISORMTM	Strong	Biomarker	[5]
B-cell neoplasm	DISVY326	Strong	Altered Expression	[6]
Bone osteosarcoma	DIST1004	Strong	Altered Expression	[7]
Breast cancer	DIS7DPX1	Strong	Biomarker	[8]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[8]
Carcinoma	DISH9F1N	Strong	Biomarker	[9]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Strong	Altered Expression	[10]
Cervical cancer	DISFSHPF	Strong	Biomarker	[11]
Cervical carcinoma	DIST4S00	Strong	Altered Expression	[11]
Colon cancer	DISVC52G	Strong	Altered Expression	[12]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[12]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[13]
Endometrial carcinoma	DISXR5CY	Strong	Altered Expression	[9]
Liver cancer	DISDE4BI	Strong	Altered Expression	[10]
Lung neoplasm	DISVARNB	Strong	Biomarker	[14]
Lymphoma	DISN6V4S	Strong	Altered Expression	[15]
Myocardial ischemia	DISFTVXF	Strong	Biomarker	[16]
Neoplasm	DISZKGEW	Strong	Altered Expression	[17]
Osteoarthritis	DIS05URM	Strong	Altered Expression	[18]
Osteosarcoma	DISLQ7E2	Strong	Altered Expression	[7]
Pneumonia	DIS8EF3M	Strong	Biomarker	[19]
Pneumonitis	DIS88E0K	Strong	Biomarker	[19]
Primary cutaneous T-cell lymphoma	DIS35WVW	Strong	Altered Expression	[20]
Prostate cancer	DISF190Y	Strong	Altered Expression	[21]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[21]
Psoriasis	DIS59VMN	Strong	Altered Expression	[9]
Renal carcinoma	DISER9XT	Strong	Biomarker	[22]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[23]
Status epilepticus seizure	DISY3BIC	Strong	Biomarker	[24]
Systemic lupus erythematosus	DISI1SZ7	Strong	Altered Expression	[25]
Anaplastic large cell lymphoma	DISP4D1R	moderate	Altered Expression	[15]
Glioblastoma multiforme	DISK8246	moderate	Altered Expression	[26]
Head-neck squamous cell carcinoma	DISF7P24	moderate	Genetic Variation	[27]
Lung carcinoma	DISTR26C	moderate	Biomarker	[28]
Pediatric lymphoma	DIS51BK2	moderate	Biomarker	[29]
Lung adenocarcinoma	DISD51WR	Disputed	Biomarker	[30]
Lung cancer	DISCM4YA	Disputed	Biomarker	[14]
Plasma cell myeloma	DIS0DFZ0	Disputed	Biomarker	[31]
Breast neoplasm	DISNGJLM	Limited	Biomarker	[32]
Hepatitis C virus infection	DISQ0M8R	Limited	Altered Expression	[33]
Melanoma	DIS1RRCY	Limited	Altered Expression	[34]
Neuroblastoma	DISVZBI4	Limited	Biomarker	[35]
Pancreatic cancer	DISJC981	Limited	Biomarker	[36]

49 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Transcription factor JunB (JUNB).	[37]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Transcription factor JunB (JUNB).	[38]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Transcription factor JunB (JUNB).	[39]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Transcription factor JunB (JUNB).	[40]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Transcription factor JunB (JUNB).	[41]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Transcription factor JunB (JUNB).	[42]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Transcription factor JunB (JUNB).	[43]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Transcription factor JunB (JUNB).	[44]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Transcription factor JunB (JUNB).	[45]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Transcription factor JunB (JUNB).	[46]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Transcription factor JunB (JUNB).	[47]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Transcription factor JunB (JUNB).	[48]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Transcription factor JunB (JUNB).	[49]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Transcription factor JunB (JUNB).	[50]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Transcription factor JunB (JUNB).	[51]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Transcription factor JunB (JUNB).	[52]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Transcription factor JunB (JUNB).	[53]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the expression of Transcription factor JunB (JUNB).	[54]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of Transcription factor JunB (JUNB).	[55]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of Transcription factor JunB (JUNB).	[56]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Transcription factor JunB (JUNB).	[57]
Indomethacin	DMSC4A7	Approved	Indomethacin increases the expression of Transcription factor JunB (JUNB).	[58]
Menthol	DMG2KW7	Approved	Menthol decreases the expression of Transcription factor JunB (JUNB).	[59]
Cocaine	DMSOX7I	Approved	Cocaine affects the expression of Transcription factor JunB (JUNB).	[60]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid decreases the expression of Transcription factor JunB (JUNB).	[61]
Nilotinib	DM7HXWT	Approved	Nilotinib increases the expression of Transcription factor JunB (JUNB).	[62]
Gamolenic acid	DMQN30Z	Approved	Gamolenic acid decreases the expression of Transcription factor JunB (JUNB).	[63]
Amphetamine	DMSZQAK	Approved	Amphetamine decreases the expression of Transcription factor JunB (JUNB).	[60]
Mechlorethamine	DM0CVXA	Approved	Mechlorethamine increases the expression of Transcription factor JunB (JUNB).	[64]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Transcription factor JunB (JUNB).	[65]
Isoflavone	DM7U58J	Phase 4	Isoflavone affects the expression of Transcription factor JunB (JUNB).	[66]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Transcription factor JunB (JUNB).	[68]
PEITC	DMOMN31	Phase 2	PEITC increases the expression of Transcription factor JunB (JUNB).	[69]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Transcription factor JunB (JUNB).	[46]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Transcription factor JunB (JUNB).	[70]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Transcription factor JunB (JUNB).	[71]
Flavonoid derivative 1	DMCQP0B	Patented	Flavonoid derivative 1 decreases the activity of Transcription factor JunB (JUNB).	[74]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of Transcription factor JunB (JUNB).	[75]
T-5224	DMD3CUJ	Discontinued in Phase 2	T-5224 decreases the expression of Transcription factor JunB (JUNB).	[55]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Transcription factor JunB (JUNB).	[76]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Transcription factor JunB (JUNB).	[51]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Transcription factor JunB (JUNB).	[77]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Transcription factor JunB (JUNB).	[78]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Transcription factor JunB (JUNB).	[79]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of Transcription factor JunB (JUNB).	[80]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Transcription factor JunB (JUNB).	[81]
geraniol	DMS3CBD	Investigative	geraniol increases the expression of Transcription factor JunB (JUNB).	[82]
Silmitasertib	DMQIBZD	Investigative	Silmitasertib increases the expression of Transcription factor JunB (JUNB).	[83]
NEUROTENSIN	DM27WCE	Investigative	NEUROTENSIN increases the activity of Transcription factor JunB (JUNB).	[84]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Curcumin	DMQPH29	Phase 3	Curcumin increases the ubiquitination of Transcription factor JunB (JUNB).	[67]
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of Transcription factor JunB (JUNB).	[72]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Transcription factor JunB (JUNB).	[73]

References

• [1] Epidermal growth factor receptor and PTEN modulate tissue factor expression in glioblastoma through JunD/activator protein-1 transcriptional activity.Cancer Res. 2009 Mar 15;69(6):2540-9. doi: 10.1158/0008-5472.CAN-08-1547. Epub 2009 Mar 10.
• [2] Interplay of transcription factors STAT3, STAT1 and AP-1 mediates activity of the matrix metallo-proteinase-1 promoter in colorectal carcinoma cells.Neoplasma. 2019 May 23;66(3):357-366. doi: 10.4149/neo_2018_180731N560. Epub 2018 Dec 12.
• [3] Differential estrogen-receptor activation regulates extracellular matrix deposition in human airway smooth muscle remodeling via NF-B pathway.FASEB J. 2019 Dec;33(12):13935-13950. doi: 10.1096/fj.201901340R. Epub 2019 Oct 22.
• [4] The potential role of impaired Notch signalling in atopic dermatitis.Acta Derm Venereol. 2015 Jan;95(1):5-11. doi: 10.2340/00015555-1898.
• [5] JunB promotes Th17 cell identity and restrains alternative CD4(+) T-cell programs during inflammation.Nat Commun. 2017 Aug 21;8(1):301. doi: 10.1038/s41467-017-00380-3.
• [6] The elevated activation of NFB and AP-1 is correlated with differential regulation of Bcl-2 and associated with oral squamous cell carcinoma progression and resistance.Clin Oral Investig. 2017 Dec;21(9):2721-2731. doi: 10.1007/s00784-017-2074-6. Epub 2017 Feb 23.
• [7] Role of Activator Protein-1 Complex on the Phenotype of Human Osteosarcomas Generated from Mesenchymal Stem Cells.Stem Cells. 2018 Oct;36(10):1487-1500. doi: 10.1002/stem.2869. Epub 2018 Aug 11.
• [8] JUNB governs a feed-forward network of TGF signaling that aggravates breast cancer invasion.Nucleic Acids Res. 2018 Feb 16;46(3):1180-1195. doi: 10.1093/nar/gkx1190.
• [9] AP-1 Expression and its Clinical Relevance in Immune Disorders and Cancer.Am J Med Sci. 2017 May;353(5):474-483. doi: 10.1016/j.amjms.2017.01.019. Epub 2017 Feb 1.
• [10] Expression of junB is markedly stimulated by glycyrrhizin in a human hepatoma cell line.Oncol Rep. 2011 Mar;25(3):609-17. doi: 10.3892/or.2011.1137. Epub 2011 Jan 10.
• [11] Anticancer activity of Phyllanthus emblica Linn. (Indian gooseberry): inhibition of transcription factor AP-1 and HPV gene expression in cervical cancer cells.Nutr Cancer. 2013;65 Suppl 1:88-97. doi: 10.1080/01635581.2013.785008.
• [12] Silibinin inhibits the invasion of IL-6-stimulated colon cancer cells via selective JNK/AP-1/MMP-2 modulation in vitro.J Agric Food Chem. 2012 Dec 26;60(51):12451-7. doi: 10.1021/jf300964f. Epub 2012 Dec 13.
• [13] CRMP5-associated GTPase (CRAG) Is a Candidate Driver Gene for Colorectal Cancer Carcinogenesis.Anticancer Res. 2019 Jan;39(1):99-106. doi: 10.21873/anticanres.13084.
• [14] Bronchial airway gene expression signatures in mouse lung squamous cell carcinoma and their modulation by cancer chemopreventive agents.Oncotarget. 2017 Mar 21;8(12):18885-18900. doi: 10.18632/oncotarget.13806.
• [15] The Role of Activator Protein-1 (AP-1) Family Members in CD30-Positive Lymphomas.Cancers (Basel). 2018 Mar 28;10(4):93. doi: 10.3390/cancers10040093.
• [16] Cardioplegia prevents ischemia-induced transcriptional alterations of cytoprotective genes in rat hearts: a DNA microarray study.J Thorac Cardiovasc Surg. 2005 Oct;130(4):1151. doi: 10.1016/j.jtcvs.2005.06.027.
• [17] Expression of activator protein-1 in papillary thyroid carcinoma and its clinical significance.World J Surg Oncol. 2019 Jan 31;17(1):25. doi: 10.1186/s12957-019-1568-x.
• [18] Regulation of type II collagen, matrix metalloproteinase-13 and cell proliferation by interleukin-1 is mediated by curcumin via inhibition of NF-B signaling in rat chondrocytes.Mol Med Rep. 2017 Aug;16(2):1837-1845. doi: 10.3892/mmr.2017.6771. Epub 2017 Jun 14.
• [19] Ambroxol alleviates ventilator-induced lung injury by inhibiting c-Jun expression.Eur Rev Med Pharmacol Sci. 2019 Jun;23(11):5004-5011. doi: 10.26355/eurrev_201906_18092.
• [20] A genomic and expression study of AP-1 in primary cutaneous T-cell lymphoma: evidence for dysregulated expression of JUNB and JUND in MF and SS.J Cutan Pathol. 2008 Oct;35(10):899-910. doi: 10.1111/j.1600-0560.2007.00924.x. Epub 2008 Jun 28.
• [21] Suppressor of activator protein-1 regulated by interferon expression in prostate cancer tissues and cells.Life Sci. 2019 Sep 1;232:116626. doi: 10.1016/j.lfs.2019.116626. Epub 2019 Jul 2.
• [22] Overexpression of members of the AP-1 transcriptional factor family from an early stage of renal carcinogenesis and inhibition of cell growth by AP-1 gene antisense oligonucleotides in the Tsc2 gene mutant (Eker) rat model.Biochem Biophys Res Commun. 1997 Dec 8;241(1):24-30. doi: 10.1006/bbrc.1997.7731.
• [23] DDR2-CYR61-MMP1 Signaling Pathway Promotes Bone Erosion in Rheumatoid Arthritis Through Regulating Migration and Invasion of Fibroblast-Like Synoviocytes.J Bone Miner Res. 2017 Feb;32(2):407-418. doi: 10.1002/jbmr.2993. Epub 2016 Nov 3.
• [24] Distinctive rat brain immediate early gene responses to seizures induced by lithium plus pilocarpine.Brain Res Mol Brain Res. 1994 Aug;25(1-2):80-9. doi: 10.1016/0169-328x(94)90281-x.
• [25] A novel intronic cAMP response element modulator (CREM) promoter is regulated by activator protein-1 (AP-1) and accounts for altered activation-induced CREM expression in T cells from patients with systemic lupus erythematosus.J Biol Chem. 2011 Sep 16;286(37):32366-72. doi: 10.1074/jbc.M111.245811. Epub 2011 Jul 13.
• [26] Epidermal growth factor receptor-mediated regulation of urokinase plasminogen activator expression and glioblastoma invasion via C-SRC/MAPK/AP-1 signaling pathways.J Neuropathol Exp Neurol. 2010 Jun;69(6):582-92. doi: 10.1097/NEN.0b013e3181e008fe.
• [27] Association between a functional polymorphism (-1195T>C) in the IGFBP5 promoter and head and neck cancer risk.Head Neck. 2011 May;33(5):650-60. doi: 10.1002/hed.21514. Epub 2010 Oct 14.
• [28] Interleukin-7 up-regulates cyclin D1 via activator protein-1 to promote proliferation of cell in lung cancer.Cancer Immunol Immunother. 2012 Jan;61(1):79-88. doi: 10.1007/s00262-011-1078-3. Epub 2011 Aug 17.
• [29] PDGFR blockade is a rational and effective therapy for NPM-ALK-driven lymphomas.Nat Med. 2012 Nov;18(11):1699-704. doi: 10.1038/nm.2966. Epub 2012 Oct 14.
• [30] Screening for transcription factors and their regulatory small molecules involved in regulating the functions of CL1-5 cancer cells under the effects of macrophage-conditioned medium.Oncol Rep. 2014 Mar;31(3):1323-33. doi: 10.3892/or.2013.2937. Epub 2013 Dec 20.
• [31] Formononetin Regulates Multiple Oncogenic Signaling Cascades and Enhances Sensitivity to Bortezomib in a Multiple Myeloma Mouse Model.Biomolecules. 2019 Jul 7;9(7):262. doi: 10.3390/biom9070262.
• [32] Progesterone receptor assembly of a transcriptional complex along with activator protein 1, signal transducer and activator of transcription 3 and ErbB-2 governs breast cancer growth and predicts response to endocrine therapy.Breast Cancer Res. 2013 Dec 17;15(6):R118. doi: 10.1186/bcr3587.
• [33] Hepatitis C virus core protein potentiates proangiogenic activity of hepatocellular carcinoma cells.Oncotarget. 2017 Sep 30;8(49):86681-86692. doi: 10.18632/oncotarget.21407. eCollection 2017 Oct 17.
• [34] Apoptosis protease activator protein-1 expression is dispensable for response of human melanoma cells to distinct proapoptotic agents.Cancer Res. 2004 Oct 15;64(20):7386-94. doi: 10.1158/0008-5472.CAN-04-1640.
• [35] Downregulation of Type 3 Deiodinase in the Hypothalamus During Inflammation.Thyroid. 2019 Sep;29(9):1336-1343. doi: 10.1089/thy.2019.0201. Epub 2019 Aug 15.
• [36] The effect of JDP2 and ATF2 on the epithelial-mesenchymal transition of human pancreatic cancer cell lines.Pathol Oncol Res. 2012 Jul;18(3):571-7. doi: 10.1007/s12253-011-9476-6. Epub 2011 Nov 23.
• [37] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [38] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [39] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [40] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [41] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [42] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [43] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [44] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [45] Activation of inflammation/NF-kappaB signaling in infants born to arsenic-exposed mothers. PLoS Genet. 2007 Nov;3(11):e207.
• [46] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [47] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [48] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [49] DNA microarray analysis of vitamin D-induced gene expression in a human colon carcinoma cell line. Physiol Genomics. 2004 Apr 13;17(2):122-9. doi: 10.1152/physiolgenomics.00002.2003.
• [50] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [51] Angiostatic activity of DNA methyltransferase inhibitors. Mol Cancer Ther. 2006 Feb;5(2):467-75. doi: 10.1158/1535-7163.MCT-05-0417.
• [52] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [53] Transcriptional profiling of MCF7 breast cancer cells in response to 5-Fluorouracil: relationship with cell cycle changes and apoptosis, and identification of novel targets of p53. Int J Cancer. 2006 Sep 1;119(5):1164-75.
• [54] Arsenite and cadmium promote the development of mammary tumors. Carcinogenesis. 2020 Jul 14;41(7):1005-1014. doi: 10.1093/carcin/bgz176.
• [55] The selective activator protein-1 inhibitor T-5224 regulates the IRF4/MYC axis and exerts cooperative antimyeloma activity with bortezomib. Chem Biol Interact. 2023 Oct 1;384:110687. doi: 10.1016/j.cbi.2023.110687. Epub 2023 Aug 31.
• [56] Nicotine and 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone induce cyclooxygenase-2 activity in human gastric cancer cells: involvement of nicotinic acetylcholine receptor (nAChR) and beta-adrenergic receptor signaling pathways. Toxicol Appl Pharmacol. 2008 Dec 1;233(2):254-61.
• [57] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [58] Mechanisms of indomethacin-induced alterations in the choline phospholipid metabolism of breast cancer cells. Neoplasia. 2006 Sep;8(9):758-71.
• [59] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [60] Effect of acute and chronic psychostimulant drugs on redox status, AP-1 activation and pro-enkephalin mRNA in the human astrocyte-like U373 MG cells. Neuropharmacology. 2005 Apr;48(5):673-84. doi: 10.1016/j.neuropharm.2004.12.010.
• [61] Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
• [62] Endoplasmic reticulum stress-mediated apoptosis in imatinib-resistant leukemic K562-r cells triggered by AMN107 combined with arsenic trioxide. Exp Biol Med (Maywood). 2013 Aug 1;238(8):932-42. doi: 10.1177/1535370213492689. Epub 2013 Jul 24.
• [63] A retinoid X receptor (RXR)-selective retinoid reveals that RXR-alpha is potentially a therapeutic target in breast cancer cell lines, and that it potentiates antiproliferative and apoptotic responses to peroxisome proliferator-activated receptor ligands. Breast Cancer Res. 2004;6(5):R546-55. doi: 10.1186/bcr913. Epub 2004 Jul 23.
• [64] Nitrogen mustard prevents transport of Fra-1 into the nucleus to promote c-Fos- and FosB-dependent IL-8 induction in injured mouse epidermis. Toxicol Lett. 2020 Feb 1;319:256-263. doi: 10.1016/j.toxlet.2019.10.006. Epub 2019 Oct 19.
• [65] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [66] Soy isoflavones alter expression of genes associated with cancer progression, including interleukin-8, in androgen-independent PC-3 human prostate cancer cells. J Nutr. 2006 Jan;136(1):75-82.
• [67] Curcumin suppresses AP1 transcription factor-dependent differentiation and activates apoptosis in human epidermal keratinocytes. J Biol Chem. 2007 Mar 2;282(9):6707-15. doi: 10.1074/jbc.M606003200. Epub 2006 Dec 5.
• [68] Expression of endogenous retroviruses reflects increased usage of atypical enhancers in T cells. EMBO J. 2019 Jun 17;38(12):e101107. doi: 10.15252/embj.2018101107. Epub 2019 May 8.
• [69] Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
• [70] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [71] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [72] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [73] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [74] Luteolin, a flavonoid, inhibits AP-1 activation by basophils. Biochem Biophys Res Commun. 2006 Feb 3;340(1):1-7. doi: 10.1016/j.bbrc.2005.11.157. Epub 2005 Dec 6.
• [75] Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
• [76] Bisphenol-A and estradiol exert novel gene regulation in human MCF-7 derived breast cancer cells. Mol Cell Endocrinol. 2004 Jun 30;221(1-2):47-55. doi: 10.1016/j.mce.2004.04.010.
• [77] Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.
• [78] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [79] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [80] In vitro gene expression data supporting a DNA non-reactive genotoxic mechanism for ochratoxin A. Toxicol Appl Pharmacol. 2007 Apr 15;220(2):216-24.
• [81] The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
• [82] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
• [83] MEK inhibitor PD-0325901 overcomes resistance to CK2 inhibitor CX-4945 and exhibits anti-tumor activity in head and neck cancer. Int J Biol Sci. 2015 Feb 23;11(4):411-22. doi: 10.7150/ijbs.10745. eCollection 2015.
• [84] Curcumin inhibits neurotensin-mediated interleukin-8 production and migration of HCT116 human colon cancer cells. Clin Cancer Res. 2006 Sep 15;12(18):5346-55. doi: 10.1158/1078-0432.CCR-06-0968.