Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTM842YW)

• DOT Name: Protachykinin-1 (TAC1)
• Synonyms: PPT
• Gene Name: TAC1
• Related Disease:
  Anxiety disorder
  Narcolepsy
  Narcolepsy type 1
  Advanced cancer
  Alcohol dependence
  Allergy
  Analgesia
  Astrocytoma
  Atopic dermatitis
  Bipolar depression
  Bipolar disorder
  Breast cancer
  Breast carcinoma
  Colorectal carcinoma
  Constipation
  Corneal disease
  Depression
  Fibromyalgia
  High blood pressure
  Huntington disease
  Leukemia
  Major depressive disorder
  Neoplasm
  Osteoarthritis
  Parkinson disease
  Psoriasis
  Pulmonary hypertension
  Respiratory syncytial virus infection
  Rheumatoid arthritis
  Schizophrenia
  Type-1/2 diabetes
  Epilepsy
  Gastroesophageal reflux disease
  Glioma
  Inflammatory bowel disease
  Neuroendocrine neoplasm
  Adult glioblastoma
  Glioblastoma multiforme
  Hypotension
  Anxiety
  Asthma
  Colitis
  Neuroblastoma
  Prostate cancer
  Prostate carcinoma
  Ulcerative colitis
• UniProt ID: TKN1_HUMAN
• PDB ID: 2B19; 2KS9; 2KSA; 2KSB; 4HOM; 7P00; 7P02; 7RMG; 7RMH; 7VDM; 7XWO; 8U26
• Pfam ID: PF02202
• Sequence:
  MKILVALAVFFLVSTQLFAEEIGANDDLNYWSDWYDSDQIKEELPEPFEHLLQRIARRPK
  PQQFFGLMGKRDADSSIEKQVALLKALYGHGQISHKRHKTDSFVGLMGKRALNSVAYERS
  AMQNYERRR
• Function: Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles.
• KEGG Pathway: Neuroactive ligand-receptor interaction (hsa04080)
• Reactome Pathway:
  G alpha (q) signalling events (R-HSA-416476)
  Tachykinin receptors bind tachykinins (R-HSA-380095)

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Anxiety disorder	DISBI2BT	Definitive	Biomarker	[1]
Narcolepsy	DISLCNLI	Definitive	Biomarker	[2]
Narcolepsy type 1	DISH7Y6Q	Definitive	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Alcohol dependence	DIS4ZSCO	Strong	Biomarker	[4]
Allergy	DIS48ZAP	Strong	Biomarker	[5]
Analgesia	DISK3TVI	Strong	Biomarker	[6]
Astrocytoma	DISL3V18	Strong	Biomarker	[7]
Atopic dermatitis	DISTCP41	Strong	Altered Expression	[8]
Bipolar depression	DISA75FU	Strong	Biomarker	[9]
Bipolar disorder	DISAM7J2	Strong	Biomarker	[9]
Breast cancer	DIS7DPX1	Strong	Biomarker	[10]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[10]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[11]
Constipation	DISRQXWI	Strong	Altered Expression	[12]
Corneal disease	DISTUIM1	Strong	Therapeutic	[13]
Depression	DIS3XJ69	Strong	Biomarker	[14]
Fibromyalgia	DISZJDS2	Strong	Biomarker	[15]
High blood pressure	DISY2OHH	Strong	Biomarker	[16]
Huntington disease	DISQPLA4	Strong	Biomarker	[17]
Leukemia	DISNAKFL	Strong	Biomarker	[18]
Major depressive disorder	DIS4CL3X	Strong	Biomarker	[19]
Neoplasm	DISZKGEW	Strong	Altered Expression	[20]
Osteoarthritis	DIS05URM	Strong	Biomarker	[21]
Parkinson disease	DISQVHKL	Strong	Biomarker	[22]
Psoriasis	DIS59VMN	Strong	Biomarker	[23]
Pulmonary hypertension	DIS1RSP5	Strong	Biomarker	[24]
Respiratory syncytial virus infection	DIS7FWHY	Strong	Biomarker	[25]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[26]
Schizophrenia	DISSRV2N	Strong	Biomarker	[9]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[27]
Epilepsy	DISBB28L	moderate	Biomarker	[28]
Gastroesophageal reflux disease	DISQ8G5S	moderate	Altered Expression	[29]
Glioma	DIS5RPEH	moderate	Biomarker	[30]
Inflammatory bowel disease	DISGN23E	moderate	Altered Expression	[31]
Neuroendocrine neoplasm	DISNPLOO	moderate	Altered Expression	[32]
Adult glioblastoma	DISVP4LU	Disputed	Altered Expression	[33]
Glioblastoma multiforme	DISK8246	Disputed	Biomarker	[34]
Hypotension	DISYNSM9	Disputed	Biomarker	[35]
Anxiety	DISIJDBA	Limited	Biomarker	[1]
Asthma	DISW9QNS	Limited	Altered Expression	[36]
Colitis	DISAF7DD	Limited	Biomarker	[37]
Neuroblastoma	DISVZBI4	Limited	Biomarker	[38]
Prostate cancer	DISF190Y	Limited	Altered Expression	[39]
Prostate carcinoma	DISMJPLE	Limited	Altered Expression	[39]
Ulcerative colitis	DIS8K27O	Limited	Biomarker	[40]

This DOT Affected the Regulation of Drug Effects of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Ergotidine	DM78IME	Approved	Protachykinin-1 (TAC1) increases the secretion of Ergotidine.	[59]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Oxaliplatin	DMQNWRD	Approved	Protachykinin-1 (TAC1) increases the Neuropathy peripheral ADR of Oxaliplatin.	[60]

23 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Protachykinin-1 (TAC1).	[41]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Protachykinin-1 (TAC1).	[42]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Protachykinin-1 (TAC1).	[43]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Protachykinin-1 (TAC1).	[44]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Protachykinin-1 (TAC1).	[42]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Protachykinin-1 (TAC1).	[45]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Protachykinin-1 (TAC1).	[46]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Protachykinin-1 (TAC1).	[47]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Protachykinin-1 (TAC1).	[48]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Protachykinin-1 (TAC1).	[46]
Cytarabine	DMZD5QR	Approved	Cytarabine increases the expression of Protachykinin-1 (TAC1).	[49]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Protachykinin-1 (TAC1).	[50]
DTI-015	DMXZRW0	Approved	DTI-015 decreases the expression of Protachykinin-1 (TAC1).	[51]
Capsaicin	DMGMF6V	Approved	Capsaicin decreases the expression of Protachykinin-1 (TAC1).	[52]
Rofecoxib	DM3P5DA	Approved	Rofecoxib increases the expression of Protachykinin-1 (TAC1).	[53]
Ranitidine	DM0GUSX	Approved	Ranitidine increases the expression of Protachykinin-1 (TAC1).	[54]
Nizatidine	DMGFV3Z	Approved	Nizatidine increases the expression of Protachykinin-1 (TAC1).	[54]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Protachykinin-1 (TAC1).	[55]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Protachykinin-1 (TAC1).	[42]
PMID26560530-Compound-25	DMZ43OM	Patented	PMID26560530-Compound-25 increases the expression of Protachykinin-1 (TAC1).	[56]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Protachykinin-1 (TAC1).	[57]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Protachykinin-1 (TAC1).	[46]
Fluphenazine	DMIT8LX	Investigative	Fluphenazine decreases the expression of Protachykinin-1 (TAC1).	[9]

References

• [1] Substance P: A neuropeptide involved in the psychopathology of anxiety disorders.Neuropeptides. 2020 Feb;79:101993. doi: 10.1016/j.npep.2019.101993. Epub 2019 Nov 11.
• [2] Reduced expression of TAC1, PENK and SOCS2 in Hcrtr-2 mutated narcoleptic dog brain.BMC Neurosci. 2007 May 23;8:34. doi: 10.1186/1471-2202-8-34.
• [3] Synthesis of New Proteomimetic Quinazolinone Alkaloids and Evaluation of Their Neuroprotective and Antitumor Effects.Molecules. 2019 Feb 1;24(3):534. doi: 10.3390/molecules24030534.
• [4] Tacr1 gene variation and neurokinin 1 receptor expression is associated with antagonist efficacy in genetically selected alcohol-preferring rats.Biol Psychiatry. 2013 Apr 15;73(8):774-81. doi: 10.1016/j.biopsych.2012.12.027. Epub 2013 Feb 16.
• [5] Chronic tobacco smoke exposure increases airway sensitivity to capsaicin in awake guinea pigs.J Appl Physiol (1985). 2001 Feb;90(2):695-704. doi: 10.1152/jappl.2001.90.2.695.
• [6] Tachykinins modulate nociceptive responsiveness and sensitization: In vivo electrical characterization of primary sensory neurons in tachykinin knockout (Tac1 KO) mice.Mol Pain. 2019 Jan-Dec;15:1744806919845750. doi: 10.1177/1744806919845750.
• [7] Antiinflammatory actions of gabapentin and pregabalin on the substance Pinduced mitogenactivated protein kinase activation in U373 MG human glioblastoma astrocytoma cells.Mol Med Rep. 2017 Nov;16(5):6109-6115. doi: 10.3892/mmr.2017.7368. Epub 2017 Aug 28.
• [8] Skin neurogenic inflammation.Semin Immunopathol. 2018 May;40(3):249-259. doi: 10.1007/s00281-018-0675-z. Epub 2018 Apr 30.
• [9] Down-regulation of amygdala preprotachykinin A mRNA but not 3H-SP receptor binding sites in subjects affected by mood disorders and schizophrenia. Eur J Neurosci. 2005 Mar;21(6):1712-8. doi: 10.1111/j.1460-9568.2005.04002.x.
• [10] MiR-34b/c-5p and the neurokinin-1 receptor regulate breast cancer cell proliferation and apoptosis.Cell Prolif. 2019 Jan;52(1):e12527. doi: 10.1111/cpr.12527. Epub 2018 Oct 17.
• [11] Roles of Methylated DNA Biomarkers in Patients with Colorectal Cancer.Dis Markers. 2019 Mar 3;2019:2673543. doi: 10.1155/2019/2673543. eCollection 2019.
• [12] Protective effect of mulberry (Morus atropurpurea) fruit against diphenoxylate-induced constipation in mice through the modulation of gut microbiota.Food Funct. 2019 Mar 20;10(3):1513-1528. doi: 10.1039/c9fo00132h.
• [13] Restoration of corneal epithelial barrier function and wound healing by substance P and IGF-1 in rats with capsaicin-induced neurotrophic keratopathy.Invest Ophthalmol Vis Sci. 2003 Jul;44(7):2937-40. doi: 10.1167/iovs.02-0868.
• [14] A hypothetical proposal for association between migraine and Meniere's disease.Med Hypotheses. 2020 Jan;134:109430. doi: 10.1016/j.mehy.2019.109430. Epub 2019 Oct 12.
• [15] Involvement of Substance P in the Analgesic Effect of Low-Level Laser Therapy in a Mouse Model of Chronic Widespread Muscle Pain.Pain Med. 2019 Oct 1;20(10):1963-1970. doi: 10.1093/pm/pnz056.
• [16] Neuroimmune crosstalk in the pathophysiology of hypertension.Nat Rev Cardiol. 2019 Aug;16(8):476-490. doi: 10.1038/s41569-019-0178-1.
• [17] Huntington Mice Demonstrate Diminished Pain Response in Inflammatory Pain Model.Anesth Analg. 2018 Feb;126(2):661-669. doi: 10.1213/ANE.0000000000002419.
• [18] Neurokinin-1 receptor is an effective target for treating leukemia by inducing oxidative stress through mitochondrial calcium overload.Proc Natl Acad Sci U S A. 2019 Sep 24;116(39):19635-19645. doi: 10.1073/pnas.1908998116. Epub 2019 Sep 5.
• [19] The association between substance P and white matter integrity in medication-naive patients with major depressive disorder.Sci Rep. 2017 Aug 29;7(1):9707. doi: 10.1038/s41598-017-10100-y.
• [20] miR-206 Promotes Cancer Progression by Targeting Full-Length Neurokinin-1 Receptor in Breast Cancer.Technol Cancer Res Treat. 2019 Jan 1;18:1533033819875168. doi: 10.1177/1533033819875168.
• [21] The dual regulation of substance P-mediated inflammation via human synovial mast cells in rheumatoid arthritis.Allergol Int. 2017 Sep;66S:S9-S20. doi: 10.1016/j.alit.2017.03.002. Epub 2017 Mar 31.
• [22] Respiratory disturbances in a mouse model of Parkinson's disease.Exp Physiol. 2019 May;104(5):729-739. doi: 10.1113/EP087507. Epub 2019 Mar 7.
• [23] Clearance of psoriasis after ischemic stroke.Cutis. 2019 Feb;103(2):74-76.
• [24] Tachykinin dysfunction attenuates monocrotaline-induced pulmonary hypertension.Toxicol Appl Pharmacol. 2003 Mar 15;187(3):178-85. doi: 10.1016/s0041-008x(02)00070-4.
• [25] Neurotrophins and tonsillar hypertrophy in children with obstructive sleep apnea.Pediatr Res. 2007 Oct;62(4):489-94. doi: 10.1203/PDR.0b013e31814257ed.
• [26] Serum substance P: an indicator of disease activity and subclinical inflammation in rheumatoid arthritis.Clin Rheumatol. 2018 Apr;37(4):901-908. doi: 10.1007/s10067-017-3929-6. Epub 2017 Dec 18.
• [27] Association between dipeptidyl peptidase-4 inhibitor and aspiration pneumonia: disproportionality analysis using the spontaneous reporting system in Japan.Eur J Clin Pharmacol. 2020 Feb;76(2):299-304. doi: 10.1007/s00228-019-02794-y. Epub 2019 Dec 10.
• [28] Targeted hippocampal GABA neuron ablation by Stable Substance P-saporin causes hippocampal sclerosis and chronic epilepsy in rats.Epilepsia. 2019 May;60(5):e52-e57. doi: 10.1111/epi.14723. Epub 2019 Apr 8.
• [29] Effect of anti-reflux treatment on gastroesophageal reflux-associated chronic cough: Implications of neurogenic and neutrophilic inflammation.J Asthma. 2020 Nov;57(11):1202-1210. doi: 10.1080/02770903.2019.1641204. Epub 2019 Jul 15.
• [30] Glioma and Neurokinin-1 Receptor Antagonists: A New Therapeutic Approach.Anticancer Agents Med Chem. 2019;19(1):92-100. doi: 10.2174/1871520618666180420165401.
• [31] Electroacupuncture inhibits visceral pain via adenosine receptors in mice with inflammatory bowel disease.Purinergic Signal. 2019 Jun;15(2):193-204. doi: 10.1007/s11302-019-09655-4. Epub 2019 Jun 11.
• [32] Evaluation of a Neurokinin-1 Receptor-Targeted Technetium-99m Conjugate for Neuroendocrine Cancer Imaging.Mol Imaging Biol. 2020 Apr;22(2):377-383. doi: 10.1007/s11307-019-01391-w.
• [33] In vitro evaluation of (225) Ac-DOTA-substance P for targeted alpha therapy of glioblastoma multiforme.Chem Biol Drug Des. 2018 Jul;92(1):1344-1356. doi: 10.1111/cbdd.13199. Epub 2018 Apr 23.
• [34] Prolonged survival in secondary glioblastoma following local injection of targeted alpha therapy with (213)Bi-substance P analogue.Eur J Nucl Med Mol Imaging. 2018 Jul;45(9):1636-1644. doi: 10.1007/s00259-018-4015-2. Epub 2018 Apr 30.
• [35] Warm SPA-induced hyperthermia confers protection to rats against airway inflammation evoked by capsaicin and substance P.Auton Neurosci. 2010 Jun 24;155(1-2):49-58. doi: 10.1016/j.autneu.2010.01.006.
• [36] Eosinophils increase airway sensory nerve density in mice and in human asthma.Sci Transl Med. 2018 Sep 5;10(457):eaar8477. doi: 10.1126/scitranslmed.aar8477.
• [37] Transient receptor potential vanilloid 1 and transient receptor potential ankyrin 1 contribute to the progression of colonic inflammation in dextran sulfate sodium-induced colitis in mice: Links to calcitonin gene-related peptide and substance P.J Pharmacol Sci. 2018 Mar;136(3):121-132. doi: 10.1016/j.jphs.2017.12.012. Epub 2018 Feb 8.
• [38] Pregabalin and gabapentin inhibit substance P-induced NF-kappaB activation in neuroblastoma and glioma cells.J Cell Biochem. 2008 Oct 1;105(2):414-23. doi: 10.1002/jcb.21837.
• [39] Antitumor effects of oncolytic adenovirus armed with PSA-IZ-CD40L fusion gene against prostate cancer.Gene Ther. 2014 Aug;21(8):723-31. doi: 10.1038/gt.2014.46. Epub 2014 May 22.
• [40] Profound loss of neprilysin accompanied by decreased levels of neuropeptides and increased CRP in ulcerative colitis.PLoS One. 2017 Dec 12;12(12):e0189526. doi: 10.1371/journal.pone.0189526. eCollection 2017.
• [41] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [42] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [43] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [44] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [45] Oxidative Stress Alters miRNA and Gene Expression Profiles in Villous First Trimester Trophoblasts. Biomed Res Int. 2015;2015:257090. doi: 10.1155/2015/257090. Epub 2015 Aug 3.
• [46] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [47] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [48] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [49] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [50] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [51] Gene expression profile induced by BCNU in human glioma cell lines with differential MGMT expression. J Neurooncol. 2005 Jul;73(3):189-98.
• [52] Expression of vanilloid receptor subtype 1 in cutaneous sensory nerve fibers, mast cells, and epithelial cells of appendage structures. Exp Dermatol. 2004 Mar;13(3):129-39. doi: 10.1111/j.0906-6705.2004.0178.x.
• [53] Analgesic action of acetaminophen in symptomatic osteoarthritis of the knee. Rheumatology (Oxford). 2006 Jun;45(6):765-70. doi: 10.1093/rheumatology/kei253. Epub 2006 Jan 31.
• [54] Effects of histamine H(2)-receptor antagonists on human plasma levels of calcitonin gene-related peptide, substance P and vasoactive intestinal peptide. J Pharm Pharmacol. 2002 Nov;54(11):1559-63. doi: 10.1211/002235702117.
• [55] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [56] Enhancement of salivary secretion and neuropeptide (substance P, alpha-calcitonin gene-related peptide) levels in saliva by chronic anethole trithione treatment. J Pharm Pharmacol. 2001 Dec;53(12):1697-702. doi: 10.1211/0022357011778098.
• [57] Chemical stresses fail to mimic the unfolded protein response resulting from luminal load with unfolded polypeptides. J Biol Chem. 2018 Apr 13;293(15):5600-5612.
• [58] Down-regulation of amygdala preprotachykinin A mRNA but not 3H-SP receptor binding sites in subjects affected by mood disorders and schizophrenia. Eur J Neurosci. 2005 Mar;21(6):1712-8. doi: 10.1111/j.1460-9568.2005.04002.x.
• [59] Substance P-induced histamine release from human basophils, skin and lung fragments: effect of nedocromil sodium and theophylline. Int Arch Allergy Appl Immunol. 1990;92(4):329-33. doi: 10.1159/000235160.
• [60] Polymorphic markers associated with severe oxaliplatin-induced, chronic peripheral neuropathy in colon cancer patients. Cancer. 2012 Jun 1;118(11):2828-36. doi: 10.1002/cncr.26614. Epub 2011 Oct 21.