Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNBIPMY)

• DOT Name: CCAAT/enhancer-binding protein delta (CEBPD)
• Synonyms: C/EBP delta; Nuclear factor NF-IL6-beta; NF-IL6-beta
• Gene Name: CEBPD
• Related Disease:
  Glioblastoma multiforme
  Prostate cancer
  Prostate carcinoma
  Retinoblastoma
  Acute myelogenous leukaemia
  Acute myocardial infarction
  Advanced cancer
  Alzheimer disease
  Behcet disease
  Bladder transitional cell carcinoma
  Breast cancer
  Breast carcinoma
  Cardiovascular disease
  Cervical cancer
  Cervical carcinoma
  Colitis
  Colorectal carcinoma
  Epithelial ovarian cancer
  Glioma
  Metastatic malignant neoplasm
  Myocardial infarction
  Myocardial ischemia
  Neuroblastoma
  Obesity
  Osteoarthritis
  Prostate neoplasm
  Psoriasis
  Rheumatoid arthritis
  Skin neoplasm
  Squamous cell carcinoma
  Transitional cell carcinoma
  Urothelial carcinoma
  Adult glioblastoma
  Carcinoma
  Nasopharyngeal carcinoma
  Stroke
  Amyotrophic lateral sclerosis
  Bacterial infection
  Breast neoplasm
  Carcinoma of liver and intrahepatic biliary tract
  Glaucoma/ocular hypertension
  Hepatocellular carcinoma
  Liver cancer
  Myotonic dystrophy
  Nervous system disease
  Venous thromboembolism
• UniProt ID: CEBPD_HUMAN
• Pfam ID: PF07716
• Sequence:
  MSAALFSLDGPARGAPWPAEPAPFYEPGRAGKPGRGAEPGALGEPGAAAPAMYDDESAID
  FSAYIDSMAAVPTLELCHDELFADLFNSNHKAGGAGPLELLPGGPARPLGPGPAAPRLLK
  REPDWGDGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREK
  SAGKRGPDRGSPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQL
  TRDLAGLRQFFKQLPSPPFLPAAGTADCR
• Function: Transcription activator that recognizes two different DNA motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers. Important transcription factor regulating the expression of genes involved in immune and inflammatory responses. Transcriptional activator that enhances IL6 transcription alone and as heterodimer with CEBPB.
• Reactome Pathway:
  Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807)
  HCMV Late Events (R-HSA-9610379)
  Transcriptional regulation of white adipocyte differentiation (R-HSA-381340)

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Glioblastoma multiforme	DISK8246	Definitive	Biomarker	[1]
Prostate cancer	DISF190Y	Definitive	Altered Expression	[2]
Prostate carcinoma	DISMJPLE	Definitive	Altered Expression	[2]
Retinoblastoma	DISVPNPB	Definitive	Altered Expression	[3]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[4]
Acute myocardial infarction	DISE3HTG	Strong	Biomarker	[5]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[6]
Alzheimer disease	DISF8S70	Strong	Altered Expression	[7]
Behcet disease	DISSYMBS	Strong	Altered Expression	[8]
Bladder transitional cell carcinoma	DISNL46A	Strong	Altered Expression	[9]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[10]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[10]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[11]
Cervical cancer	DISFSHPF	Strong	Altered Expression	[3]
Cervical carcinoma	DIST4S00	Strong	Altered Expression	[3]
Colitis	DISAF7DD	Strong	Altered Expression	[12]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[13]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[14]
Glioma	DIS5RPEH	Strong	Altered Expression	[15]
Metastatic malignant neoplasm	DIS86UK6	Strong	Altered Expression	[10]
Myocardial infarction	DIS655KI	Strong	Altered Expression	[5]
Myocardial ischemia	DISFTVXF	Strong	Biomarker	[16]
Neuroblastoma	DISVZBI4	Strong	Altered Expression	[17]
Obesity	DIS47Y1K	Strong	Altered Expression	[18]
Osteoarthritis	DIS05URM	Strong	Biomarker	[19]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[20]
Psoriasis	DIS59VMN	Strong	Biomarker	[21]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[22]
Skin neoplasm	DIS16DDV	Strong	Altered Expression	[23]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[24]
Transitional cell carcinoma	DISWVVDR	Strong	Biomarker	[25]
Urothelial carcinoma	DISRTNTN	Strong	Biomarker	[25]
Adult glioblastoma	DISVP4LU	moderate	Biomarker	[1]
Carcinoma	DISH9F1N	moderate	Biomarker	[26]
Nasopharyngeal carcinoma	DISAOTQ0	moderate	Biomarker	[27]
Stroke	DISX6UHX	moderate	Genetic Variation	[28]
Amyotrophic lateral sclerosis	DISF7HVM	Limited	Biomarker	[29]
Bacterial infection	DIS5QJ9S	Limited	Biomarker	[30]
Breast neoplasm	DISNGJLM	Limited	Altered Expression	[31]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Limited	Biomarker	[32]
Glaucoma/ocular hypertension	DISLBXBY	Limited	Biomarker	[33]
Hepatocellular carcinoma	DIS0J828	Limited	Altered Expression	[34]
Liver cancer	DISDE4BI	Limited	Biomarker	[32]
Myotonic dystrophy	DISNBEMX	Limited	Altered Expression	[35]
Nervous system disease	DISJ7GGT	Limited	Biomarker	[36]
Venous thromboembolism	DISUR7CR	Limited	Genetic Variation	[37]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of CCAAT/enhancer-binding protein delta (CEBPD).	[38]
Decitabine	DMQL8XJ	Approved	Decitabine affects the methylation of CCAAT/enhancer-binding protein delta (CEBPD).	[4]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of CCAAT/enhancer-binding protein delta (CEBPD).	[56]
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of CCAAT/enhancer-binding protein delta (CEBPD).	[69]

41 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[39]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[40]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[41]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[42]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[43]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[44]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[45]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[46]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[47]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[48]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[49]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[50]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[49]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[51]
Marinol	DM70IK5	Approved	Marinol increases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[53]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[54]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[55]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[50]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[57]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[58]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol affects the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[59]
Sorafenib	DMS8IFC	Approved	Sorafenib increases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[60]
Vitamin B3	DMQVRZH	Approved	Vitamin B3 increases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[61]
Pomalidomide	DMTGBAX	Approved	Pomalidomide increases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[62]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[63]
Isoflavone	DM7U58J	Phase 4	Isoflavone decreases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[64]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[65]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene increases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[66]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[44]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene increases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[67]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[68]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[44]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[70]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[71]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[72]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[73]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate decreases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[74]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[75]
KOJIC ACID	DMP84CS	Investigative	KOJIC ACID increases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[76]
Lithium chloride	DMHYLQ2	Investigative	Lithium chloride increases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[77]
Manganese	DMKT129	Investigative	Manganese increases the expression of CCAAT/enhancer-binding protein delta (CEBPD).	[78]

References

• [1] The C/EBP protein is stabilized by estrogen receptor activity, inhibits SNAI2 expression and associates with good prognosis in breast cancer.Oncogene. 2016 Dec 1;35(48):6166-6176. doi: 10.1038/onc.2016.156. Epub 2016 May 16.
• [2] The combination of the prodrugs perforin-CEBPD and perforin-granzyme B efficiently enhances the activation of caspase signaling and kills prostate cancer.Cell Death Dis. 2014 May 8;5(5):e1220. doi: 10.1038/cddis.2014.106.
• [3] CEBPD reverses RB/E2F1-mediated gene repression and participates in HMDB-induced apoptosis of cancer cells.Clin Cancer Res. 2010 Dec 1;16(23):5770-80. doi: 10.1158/1078-0432.CCR-10-1025. Epub 2010 Oct 22.
• [4] The C/EBPdelta tumor suppressor is silenced by hypermethylation in acute myeloid leukemia. Blood. 2007 May 1;109(9):3895-905. doi: 10.1182/blood-2006-08-040147. Epub 2007 Jan 18.
• [5] Reconstitution of HuR-Inhibited CUGBP1 Expression Protects Cardiomyocytes from Acute Myocardial Infarction-Induced Injury.Antioxid Redox Signal. 2017 Nov 10;27(14):1013-1026. doi: 10.1089/ars.2016.6880. Epub 2017 Mar 28.
• [6] C/EBP-Slug-Lox1 axis promotes metastasis of lung adenocarcinoma via oxLDL uptake.Oncogene. 2020 Jan;39(4):833-848. doi: 10.1038/s41388-019-1015-z. Epub 2019 Sep 27.
• [7] Astrocytic CCAAT/Enhancer-binding protein delta contributes to reactive oxygen species formation in neuroinflammation.Redox Biol. 2018 Jun;16:104-112. doi: 10.1016/j.redox.2018.02.011. Epub 2018 Feb 16.
• [8] Transcription Factors Regulating Inflammatory Cytokine Production Are Differentially Expressed in Peripheral Blood Mononuclear Cells of Behet Disease Depending on Disease Activity.Ann Dermatol. 2017 Apr;29(2):173-179. doi: 10.5021/ad.2017.29.2.173. Epub 2017 Mar 24.
• [9] Inhibition of the EGFR/STAT3/CEBPD Axis Reverses Cisplatin Cross-resistance with Paclitaxel in the Urothelial Carcinoma of the Urinary Bladder.Clin Cancer Res. 2017 Jan 15;23(2):503-513. doi: 10.1158/1078-0432.CCR-15-1169. Epub 2016 Jul 19.
• [10] C/EBP links IL-6 and HIF-1 signaling to promote breast cancer stem cell-associated phenotypes.Oncogene. 2019 May;38(20):3765-3780. doi: 10.1038/s41388-018-0516-5. Epub 2018 Sep 27.
• [11] CCAAT/enhancer-binding protein delta promotes intracellular lipid accumulation in M1 macrophages of vascular lesions.Cardiovasc Res. 2017 Sep 1;113(11):1376-1388. doi: 10.1093/cvr/cvx134.
• [12] Loss of C/EBP enhances apoptosis of intestinal epithelial cells and exacerbates experimental colitis in mice.Genes Cells. 2019 Sep;24(9):619-626. doi: 10.1111/gtc.12711. Epub 2019 Jul 15.
• [13] Instability at the FRA8I common fragile site disrupts the genomic integrity of the KIAA0146, CEBPD and PRKDC genes in colorectal cancer.Cancer Lett. 2013 Aug 9;336(1):85-95. doi: 10.1016/j.canlet.2013.04.007. Epub 2013 Apr 16.
• [14] Mining Featured Biomarkers Linked with Epithelial Ovarian CancerBased on Bioinformatics.Diagnostics (Basel). 2019 Apr 9;9(2):39. doi: 10.3390/diagnostics9020039.
• [15] CCAAT/enhancer-binding protein delta regulates the stemness of glioma stem-like cells through activating PDGFA expression upon inflammatory stimulation.J Neuroinflammation. 2019 Jul 12;16(1):146. doi: 10.1186/s12974-019-1535-z.
• [16] Cardioplegia prevents ischemia-induced transcriptional alterations of cytoprotective genes in rat hearts: a DNA microarray study.J Thorac Cardiovasc Surg. 2005 Oct;130(4):1151. doi: 10.1016/j.jtcvs.2005.06.027.
• [17] CCAAT/enhancer binding protein is a transcriptional repressor of -synuclein.Cell Death Differ. 2020 Feb;27(2):509-524. doi: 10.1038/s41418-019-0368-8. Epub 2019 Jun 17.
• [18] Artemisinic acid is a regulator of adipocyte differentiation and C/EBP expression.J Cell Biochem. 2012 Jul;113(7):2488-99. doi: 10.1002/jcb.24124.
• [19] Obtain osteoarthritis related molecular signature genes through regulation network.Mol Med Rep. 2012 Jan;5(1):177-83. doi: 10.3892/mmr.2011.595. Epub 2011 Sep 22.
• [20] C/EBPdelta is a downstream mediator of IL-6 induced growth inhibition of prostate cancer cells.Prostate. 2005 May 1;63(2):143-54. doi: 10.1002/pros.20159.
• [21] Shikonin induces apoptosis and suppresses growth in keratinocytes via CEBP- upregulation.Int Immunopharmacol. 2019 Jul;72:511-521. doi: 10.1016/j.intimp.2019.04.047. Epub 2019 May 7.
• [22] Identifying Clinical Factors Associated With Low Disease Activity and Remission of Rheumatoid Arthritis During Pregnancy.Arthritis Care Res (Hoboken). 2017 Sep;69(9):1297-1303. doi: 10.1002/acr.23143. Epub 2017 Aug 13.
• [23] C/EBP gene targets in human keratinocytes.PLoS One. 2010 Nov 2;5(11):e13789. doi: 10.1371/journal.pone.0013789.
• [24] C/EBP transcription factors in human squamous cell carcinoma: selective changes in expression of isoforms correlate with the neoplastic state.PLoS One. 2014 Nov 17;9(11):e112073. doi: 10.1371/journal.pone.0112073. eCollection 2014.
• [25] MiR-193b Mediates CEBPD-Induced Cisplatin Sensitization Through Targeting ETS1 and Cyclin D1 in Human Urothelial Carcinoma Cells.J Cell Biochem. 2017 Jun;118(6):1563-1573. doi: 10.1002/jcb.25818. Epub 2016 Dec 20.
• [26] CCAAT/enhancer binding protein delta (C/EBP) demonstrates a dichotomous role in tumour initiation and promotion of epithelial carcinoma.EBioMedicine. 2019 Jun;44:261-274. doi: 10.1016/j.ebiom.2019.05.002. Epub 2019 May 9.
• [27] CCAAT/enhancer binding protein in macrophages contributes to immunosuppression and inhibits phagocytosis in nasopharyngeal carcinoma.Sci Signal. 2013 Jul 16;6(284):ra59. doi: 10.1126/scisignal.2003648.
• [28] Genetic polymorphisms and the risk of stroke after cardiac surgery.Stroke. 2005 Sep;36(9):1854-8. doi: 10.1161/01.STR.0000177482.23478.dc. Epub 2005 Jul 28.
• [29] A data-driven approach links microglia to pathology and prognosis in amyotrophic lateral sclerosis.Acta Neuropathol Commun. 2017 Mar 16;5(1):23. doi: 10.1186/s40478-017-0424-x.
• [30] CCAAT/enhancer-binding protein facilitates bacterial dissemination during pneumococcal pneumonia in a platelet-activating factor receptor-dependent manner.Proc Natl Acad Sci U S A. 2012 Jun 5;109(23):9113-8. doi: 10.1073/pnas.1202641109. Epub 2012 May 21.
• [31] Promoter methylation reduces C/EBPdelta (CEBPD) gene expression in the SUM-52PE human breast cancer cell line and in primary breast tumors.Breast Cancer Res Treat. 2006 Jan;95(2):161-70. doi: 10.1007/s10549-005-9061-3. Epub 2005 Dec 2.
• [32] HMDB and 5-AzadC Combination Reverses Tumor Suppressor CCAAT/Enhancer-Binding Protein Delta to Strengthen the Death of Liver Cancer Cells.Mol Cancer Ther. 2015 Nov;14(11):2623-33. doi: 10.1158/1535-7163.MCT-15-0025. Epub 2015 Sep 10.
• [33] Bioinformatics analysis to identify the differentially expressed genes of glaucoma.Mol Med Rep. 2015 Oct;12(4):4829-36. doi: 10.3892/mmr.2015.4030. Epub 2015 Jul 2.
• [34] Action and clinical significance of CCAAT/enhancer-binding protein delta in hepatocellular carcinoma.Carcinogenesis. 2019 Mar 12;40(1):155-163. doi: 10.1093/carcin/bgy130.
• [35] Conserved functions of RNA-binding proteins in muscle.Int J Biochem Cell Biol. 2019 May;110:29-49. doi: 10.1016/j.biocel.2019.02.008. Epub 2019 Feb 25.
• [36] The role of CELF proteins in neurological disorders.RNA Biol. 2010 Jul-Aug;7(4):474-9. doi: 10.4161/rna.7.4.12345. Epub 2010 Jul 1.
• [37] C-reactive protein 3' UTR +1444C>T polymorphism in patients with spontaneous venous thromboembolism.Atherosclerosis. 2006 Oct;188(2):406-11. doi: 10.1016/j.atherosclerosis.2005.11.006. Epub 2005 Dec 13.
• [38] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [39] Cyclosporine A--induced oxidative stress in human renal mesangial cells: a role for ERK 1/2 MAPK signaling. Toxicol Sci. 2012 Mar;126(1):101-13.
• [40] Systems analysis of transcriptome and proteome in retinoic acid/arsenic trioxide-induced cell differentiation/apoptosis of promyelocytic leukemia. Proc Natl Acad Sci U S A. 2005 May 24;102(21):7653-8.
• [41] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [42] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [43] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [44] Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
• [45] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [46] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [47] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [48] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [49] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [50] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [51] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [52] The C/EBPdelta tumor suppressor is silenced by hypermethylation in acute myeloid leukemia. Blood. 2007 May 1;109(9):3895-905. doi: 10.1182/blood-2006-08-040147. Epub 2007 Jan 18.
• [53] Single-cell Transcriptome Mapping Identifies Common and Cell-type Specific Genes Affected by Acute Delta9-tetrahydrocannabinol in Humans. Sci Rep. 2020 Feb 26;10(1):3450. doi: 10.1038/s41598-020-59827-1.
• [54] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [55] Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
• [56] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [57] Gene expression profiling in Ishikawa cells: a fingerprint for estrogen active compounds. Toxicol Appl Pharmacol. 2009 Apr 1;236(1):85-96.
• [58] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [59] The genomic response of Ishikawa cells to bisphenol A exposure is dose- and time-dependent. Toxicology. 2010 Apr 11;270(2-3):137-49. doi: 10.1016/j.tox.2010.02.008. Epub 2010 Feb 17.
• [60] Growth arrest DNA damage-inducible gene 45 gamma expression as a prognostic and predictive biomarker in hepatocellular carcinoma. Oncotarget. 2015 Sep 29;6(29):27953-65. doi: 10.18632/oncotarget.4446.
• [61] Effects of extended-release niacin on lipid profile and adipocyte biology in patients with impaired glucose tolerance. Atherosclerosis. 2009 Jul;205(1):207-13. doi: 10.1016/j.atherosclerosis.2008.11.026. Epub 2008 Dec 3.
• [62] Immunomodulatory derivative of thalidomide (IMiD CC-4047) induces a shift in lineage commitment by suppressing erythropoiesis and promoting myelopoiesis. Blood. 2005 May 15;105(10):3833-40. doi: 10.1182/blood-2004-03-0828. Epub 2004 Aug 3.
• [63] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [64] Soy isoflavones exert differential effects on androgen responsive genes in LNCaP human prostate cancer cells. J Nutr. 2007 Apr;137(4):964-72.
• [65] Effects of resveratrol on gene expression in renal cell carcinoma. Cancer Biol Ther. 2004 Sep;3(9):882-8. doi: 10.4161/cbt.3.9.1056. Epub 2004 Sep 21.
• [66] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [67] Estrogenic GPR30 signalling induces proliferation and migration of breast cancer cells through CTGF. EMBO J. 2009 Mar 4;28(5):523-32.
• [68] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
• [69] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [70] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [71] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [72] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [73] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [74] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [75] The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
• [76] Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.
• [77] Effects of lithium and valproic acid on gene expression and phenotypic markers in an NT2 neurosphere model of neural development. PLoS One. 2013;8(3):e58822.
• [78] Gene expression profiling of human primary astrocytes exposed to manganese chloride indicates selective effects on several functions of the cells. Neurotoxicology. 2007 May;28(3):478-89.