Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTV9L89D)

• DOT Name: Tumor necrosis factor ligand superfamily member 9 (TNFSF9)
• Synonyms: 4-1BB ligand; 4-1BBL
• Gene Name: TNFSF9
• Related Disease:
  Cervical cancer
  Cervical carcinoma
  Acute myelogenous leukaemia
  Advanced cancer
  Arteriosclerosis
  Atherosclerosis
  Autoimmune disease
  B-cell neoplasm
  Chronic kidney disease
  Colon cancer
  Colon carcinoma
  Colorectal neoplasm
  Hepatitis B virus infection
  Hepatocellular carcinoma
  HIV infectious disease
  Lung cancer
  Lung carcinoma
  Lymphoma
  Neoplasm
  Non-small-cell lung cancer
  Obesity
  Plasma cell myeloma
  Prostate cancer
  Prostate carcinoma
  Systemic lupus erythematosus
  Breast cancer
  Breast carcinoma
  Influenza
  Neuroblastoma
  Small lymphocytic lymphoma
  Adenocarcinoma
  leukaemia
  Leukemia
  Multiple sclerosis
  Bone osteosarcoma
  Colorectal carcinoma
  Contact dermatitis
  Crohn disease
  Epithelial ovarian cancer
  Gastric cancer
  Gastric neoplasm
  Hereditary diffuse gastric adenocarcinoma
  Melanoma
  Metastatic malignant neoplasm
  Nasopharyngeal carcinoma
  Osteosarcoma
  Ovarian cancer
  Rheumatoid arthritis
  Squamous cell carcinoma
• UniProt ID: TNFL9_HUMAN
• PDB ID: 2X29; 6A3V; 6BWV; 6CPR; 6CU0; 6D3N; 6FIB; 6MGE; 6MGP
• Pfam ID: PF00229
• Sequence:
  MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARA
  SPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSL
  TGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALA
  LTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRV
  TPEIPAGLPSPRSE
• Function: Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages.
• Tissue Specificity: Expressed in brain, placenta, lung, skeletal muscle and kidney.
• KEGG Pathway: Cytokine-cytokine receptor interaction (hsa04060)
• Reactome Pathway: TNFs bind their physiological receptors (R-HSA-5669034)

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Cervical cancer	DISFSHPF	Definitive	Biomarker	[1]
Cervical carcinoma	DIST4S00	Definitive	Biomarker	[1]
Acute myelogenous leukaemia	DISCSPTN	Strong	Altered Expression	[2]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[3]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[4]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[4]
Autoimmune disease	DISORMTM	Strong	Biomarker	[5]
B-cell neoplasm	DISVY326	Strong	Altered Expression	[6]
Chronic kidney disease	DISW82R7	Strong	Altered Expression	[7]
Colon cancer	DISVC52G	Strong	Biomarker	[8]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[8]
Colorectal neoplasm	DISR1UCN	Strong	Biomarker	[9]
Hepatitis B virus infection	DISLQ2XY	Strong	Altered Expression	[10]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[11]
HIV infectious disease	DISO97HC	Strong	Altered Expression	[12]
Lung cancer	DISCM4YA	Strong	Altered Expression	[13]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[13]
Lymphoma	DISN6V4S	Strong	Genetic Variation	[14]
Neoplasm	DISZKGEW	Strong	Biomarker	[11]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[15]
Obesity	DIS47Y1K	Strong	Biomarker	[16]
Plasma cell myeloma	DIS0DFZ0	Strong	Altered Expression	[17]
Prostate cancer	DISF190Y	Strong	Altered Expression	[18]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[18]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[19]
Breast cancer	DIS7DPX1	moderate	Biomarker	[20]
Breast carcinoma	DIS2UE88	moderate	Biomarker	[20]
Influenza	DIS3PNU3	moderate	Biomarker	[21]
Neuroblastoma	DISVZBI4	moderate	Altered Expression	[22]
Small lymphocytic lymphoma	DIS30POX	moderate	Biomarker	[23]
Adenocarcinoma	DIS3IHTY	Disputed	Altered Expression	[24]
leukaemia	DISS7D1V	Disputed	Altered Expression	[24]
Leukemia	DISNAKFL	Disputed	Altered Expression	[24]
Multiple sclerosis	DISB2WZI	Disputed	Altered Expression	[25]
Bone osteosarcoma	DIST1004	Limited	Altered Expression	[26]
Colorectal carcinoma	DIS5PYL0	Limited	Altered Expression	[27]
Contact dermatitis	DISQ3AU0	Limited	Biomarker	[28]
Crohn disease	DIS2C5Q8	Limited	Biomarker	[29]
Epithelial ovarian cancer	DIS56MH2	Limited	Biomarker	[30]
Gastric cancer	DISXGOUK	Limited	Biomarker	[31]
Gastric neoplasm	DISOKN4Y	Limited	Biomarker	[31]
Hereditary diffuse gastric adenocarcinoma	DISUIBYS	Limited	Biomarker	[31]
Melanoma	DIS1RRCY	Limited	Altered Expression	[32]
Metastatic malignant neoplasm	DIS86UK6	Limited	Biomarker	[33]
Nasopharyngeal carcinoma	DISAOTQ0	Limited	Biomarker	[34]
Osteosarcoma	DISLQ7E2	Limited	Altered Expression	[26]
Ovarian cancer	DISZJHAP	Limited	Biomarker	[30]
Rheumatoid arthritis	DISTSB4J	Limited	Altered Expression	[35]
Squamous cell carcinoma	DISQVIFL	Limited	Altered Expression	[24]

36 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[36]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[37]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[38]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[39]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[40]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[41]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[42]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[43]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[44]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[45]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[46]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[31]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[48]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[49]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[50]
Etoposide	DMNH3PG	Approved	Etoposide increases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[51]
Menthol	DMG2KW7	Approved	Menthol increases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[52]
Cidofovir	DMA13GD	Approved	Cidofovir increases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[49]
Cyclophosphamide	DM4O2Z7	Approved	Cyclophosphamide increases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[53]
Ifosfamide	DMCT3I8	Approved	Ifosfamide increases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[49]
Daunorubicin	DMQUSBT	Approved	Daunorubicin increases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[51]
Colchicine	DM2POTE	Approved	Colchicine decreases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[41]
Adefovir dipivoxil	DMMAWY1	Approved	Adefovir dipivoxil increases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[49]
Dactinomycin	DM2YGNW	Approved	Dactinomycin increases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[53]
Adenine	DMZLHKJ	Approved	Adenine decreases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[41]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[54]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[45]
Camptothecin	DM6CHNJ	Phase 3	Camptothecin increases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[51]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[55]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[56]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[57]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[58]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[45]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[59]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[60]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Tumor necrosis factor ligand superfamily member 9 (TNFSF9).	[61]

References

• [1] Costimulation as a platform for the development of vaccines: a peptide-based vaccine containing a novel form of 4-1BB ligand eradicates established tumors.Cancer Res. 2009 May 15;69(10):4319-26. doi: 10.1158/0008-5472.CAN-08-3141. Epub 2009 May 12.
• [2] Expression of 4-1BB and its ligand on blasts correlates with prognosis of patients with AML.J Investig Med. 2016 Dec;64(8):1252-1260. doi: 10.1136/jim-2016-000081. Epub 2016 Jul 7.
• [3] A Novel Form of 4-1BBL Prevents Cancer Development via Nonspecific Activation of CD4(+) T and Natural Killer Cells.Cancer Res. 2019 Feb 15;79(4):783-794. doi: 10.1158/0008-5472.CAN-18-2401.
• [4] Increased Peripheral CD137 Expression in a Mouse Model of Permanent Focal Cerebral Ischemia.Cell Mol Neurobiol. 2019 Apr;39(3):451-460. doi: 10.1007/s10571-019-00661-z. Epub 2019 Feb 18.
• [5] Deletion of CD137 Ligand Exacerbates Renal and Cutaneous but Alleviates Cerebral Manifestations in Lupus.Front Immunol. 2019 Jun 26;10:1411. doi: 10.3389/fimmu.2019.01411. eCollection 2019.
• [6] Efficient inhibition of human B-cell lymphoma in SCID mice by synergistic antitumor effect of human 4-1BB ligand/anti-CD20 fusion proteins and anti-CD3/anti-CD20 diabodies.J Immunother. 2010 Jun;33(5):500-9. doi: 10.1097/CJI.0b013e3181d75c20.
• [7] Tumor necrosis factor superfamily ligand mRNA expression profiles differ between humans and mice during homeostasis and between various murine kidney injuries.J Biomed Sci. 2017 Sep 19;24(1):77. doi: 10.1186/s12929-017-0383-3.
• [8] The study on specific umbilical blood Dc vaccine for Beige nude mice loaded human colorectal carcinoma to induce anti-tumor immunity.Eur Rev Med Pharmacol Sci. 2017 May;21(10):2364-2371.
• [9] T cell immunity induced by a bivalent Salmonella-based CEACAM6 and 4-1BBL vaccines in a rat colorectal cancer model.Oncol Lett. 2017 May;13(5):3753-3759. doi: 10.3892/ol.2017.5938. Epub 2017 Mar 28.
• [10] HBcAg-induced upregulated 4-1BB ligand on B cells contributes to B-cell hyperactivation during chronic hepatitis B infection.J Med Virol. 2019 May;91(5):781-790. doi: 10.1002/jmv.25377. Epub 2019 Jan 2.
• [11] Recombinant Adenovirus Expressing a Soluble Fusion Protein PD-1/CD137L Subverts the Suppression of CD8(+) T Cells in HCC.Mol Ther. 2019 Nov 6;27(11):1906-1918. doi: 10.1016/j.ymthe.2019.07.019. Epub 2019 Aug 5.
• [12] Enhancement of HIV-specific CD8 T cell responses by dual costimulation with CD80 and CD137L.J Immunol. 2005 Nov 15;175(10):6378-89. doi: 10.4049/jimmunol.175.10.6378.
• [13] CD137 ligand feedback upregulates PD-L1 expression on lung cancer via T cell production of IFN-.Thorac Cancer. 2019 Dec;10(12):2225-2235. doi: 10.1111/1759-7714.13207. Epub 2019 Oct 17.
• [14] Recurrent deletions of the TNFSF7 and TNFSF9 genes in 19p13.3 in diffuse large B-cell and Burkitt lymphomas.Int J Cancer. 2012 Sep 1;131(5):E830-5. doi: 10.1002/ijc.27416. Epub 2012 Jan 31.
• [15] CD137 ligand-mediated reverse signaling inhibits proliferation and induces apoptosis in non-small cell lung cancer.Med Oncol. 2015 Mar;32(3):44. doi: 10.1007/s12032-015-0499-9. Epub 2015 Jan 29.
• [16] The involvement of 4-1BB/4-1BBL signaling in glial cell-mediated hypothalamic inflammation in obesity.FEBS Open Bio. 2018 Apr 19;8(5):843-853. doi: 10.1002/2211-5463.12426. eCollection 2018 May.
• [17] B7-1 and 4-1BB ligand expression on a myeloma cell line makes it possible to expand autologous tumor-specific cytotoxic T cells in vitro.Exp Hematol. 2007 Mar;35(3):443-53. doi: 10.1016/j.exphem.2006.11.002.
• [18] 4-1BBL has a Possible Role in Mediating Castration-Resistant Conversion of Prostate Cancer via Up-Regulation of Androgen Receptor.J Cancer. 2019 Jun 2;10(11):2464-2471. doi: 10.7150/jca.29648. eCollection 2019.
• [19] The Progress of Investigating the CD137-CD137L Axis as a Potential Target for Systemic Lupus Erythematosus.Cells. 2019 Sep 6;8(9):1044. doi: 10.3390/cells8091044.
• [20] Tumor suppressive effects of WEE1 gene silencing could not enhance immunopotentiation effects of CD80 and 4-1BBL co-stimulation in human T cells.J Cancer Res Ther. 2015 Oct-Dec;11(4):708-16. doi: 10.4103/0973-1482.147746.
• [21] Intrinsic 4-1BB signals are indispensable for the establishment of an influenza-specific tissue-resident memory CD8 T-cell population in the lung.Mucosal Immunol. 2017 Sep;10(5):1294-1309. doi: 10.1038/mi.2016.124. Epub 2017 Jan 4.
• [22] Induction of a VLA-2 (CD49b)-expressing effector T cell population by a cell-based neuroblastoma vaccine expressing CD137L.J Immunol. 2008 Oct 1;181(7):4621-31. doi: 10.4049/jimmunol.181.7.4621.
• [23] 4-1BB ligand modulates direct and Rituximab-induced NK-cell reactivity in chronic lymphocytic leukemia.Eur J Immunol. 2012 Mar;42(3):737-48. doi: 10.1002/eji.201141920. Epub 2011 Dec 20.
• [24] Analysis of CD137 and CD137L expression in human primary tumor tissues.Croat Med J. 2008 Apr;49(2):192-200. doi: 10.3325/cmj.2008.2.192.
• [25] Increased soluble 4-1BB ligand (4-1BBL) levels in peripheral blood of patients with multiple sclerosis.Scand J Immunol. 2006 Oct;64(4):412-9. doi: 10.1111/j.1365-3083.2006.01796.x.
• [26] Identification of a p53 target, CD137L, that mediates growth suppression and immune response of osteosarcoma cells.Sci Rep. 2017 Sep 6;7(1):10739. doi: 10.1038/s41598-017-11208-x.
• [27] Autoinducer-2 of gut microbiota, a potential novel marker for human colorectal cancer, is associated with the activation of TNFSF9 signaling in macrophages.Oncoimmunology. 2019 Jun 10;8(10):e1626192. doi: 10.1080/2162402X.2019.1626192. eCollection 2019.
• [28] Genes specifically modulated in sensitized skins allow the detection of sensitizers in a reconstructed human skin modelDevelopment of the SENS-IS assay. Toxicol In Vitro. 2015 Jun;29(4):787-802.
• [29] Functional expression of 4-1BB (CD137) in the inflammatory tissue in Crohn's disease.Clin Immunol. 2004 Sep;112(3):239-46. doi: 10.1016/j.clim.2004.04.009.
• [30] Long-term proliferation of functional human NK cells, with conversion of CD56(dim) NK cells to a CD56 (bright) phenotype, induced by carcinoma cells co-expressing 4-1BBL and IL-12.Cancer Immunol Immunother. 2012 May;61(5):615-28. doi: 10.1007/s00262-011-1122-3. Epub 2011 Oct 22.
• [31] Chemical genomic screening for methylation-silenced genes in gastric cancer cell lines using 5-aza-2'-deoxycytidine treatment and oligonucleotide microarray. Cancer Sci. 2006 Jan;97(1):64-71.
• [32] Design and Production of Newcastle Disease Virus for Intratumoral Immunomodulation.Methods Mol Biol. 2020;2058:133-154. doi: 10.1007/978-1-4939-9794-7_9.
• [33] Expression of Tumor-mediated CD137 ligand in human colon cancer indicates dual signaling effects.Oncoimmunology. 2019 Sep 6;8(12):e1651622. doi: 10.1080/2162402X.2019.1651622. eCollection 2019.
• [34] CD137L-DCs, Potent Immune-Stimulators-History, Characteristics, and Perspectives.Front Immunol. 2019 Oct 2;10:2216. doi: 10.3389/fimmu.2019.02216. eCollection 2019.
• [35] Serum concentrations of soluble 4-1BB and 4-1BB ligand correlated with the disease severity in rheumatoid arthritis.Exp Mol Med. 2004 Feb 29;36(1):13-22. doi: 10.1038/emm.2004.2.
• [36] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [37] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [38] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [39] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [40] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [41] Utilization of CDKN1A/p21 gene for class discrimination of DNA damage-induced clastogenicity. Toxicology. 2014 Jan 6;315:8-16. doi: 10.1016/j.tox.2013.10.009. Epub 2013 Nov 6.
• [42] Pattern of expression of apoptosis and inflammatory genes in humans exposed to arsenic and/or fluoride. Sci Total Environ. 2010 Jan 15;408(4):760-7. doi: 10.1016/j.scitotenv.2009.11.016. Epub 2009 Dec 4.
• [43] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [44] Arsenic trioxide induces different gene expression profiles of genes related to growth and apoptosis in glioma cells dependent on the p53 status. Mol Biol Rep. 2008 Sep;35(3):421-9.
• [45] Anti-leukemia activity of MS-275 histone deacetylase inhibitor implicates 4-1BBL/4-1BB immunomodulatory functions. PLoS One. 2009 Sep 17;4(9):e7085. doi: 10.1371/journal.pone.0007085.
• [46] The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
• [47] Chemical genomic screening for methylation-silenced genes in gastric cancer cell lines using 5-aza-2'-deoxycytidine treatment and oligonucleotide microarray. Cancer Sci. 2006 Jan;97(1):64-71.
• [48] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [49] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [50] Gene expression signatures after ethanol exposure in differentiating embryoid bodies. Toxicol In Vitro. 2018 Feb;46:66-76.
• [51] Characterization of DNA reactive and non-DNA reactive anticancer drugs by gene expression profiling. Mutat Res. 2007 Jun 1;619(1-2):16-29. doi: 10.1016/j.mrfmmm.2006.12.007. Epub 2007 Feb 8.
• [52] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [53] Genomic profiling uncovers a molecular pattern for toxicological characterization of mutagens and promutagens in vitro. Toxicol Sci. 2011 Jul;122(1):185-97.
• [54] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [55] The molecular basis of genistein-induced mitotic arrest and exit of self-renewal in embryonal carcinoma and primary cancer cell lines. BMC Med Genomics. 2008 Oct 10;1:49.
• [56] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [57] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [58] DON shares a similar mode of action as the ribotoxic stress inducer anisomycin while TBTO shares ER stress patterns with the ER stress inducer thapsigargin based on comparative gene expression profiling in Jurkat T cells. Toxicol Lett. 2014 Jan 30;224(3):395-406. doi: 10.1016/j.toxlet.2013.11.005. Epub 2013 Nov 15.
• [59] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [60] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [61] Persistence of epigenomic effects after recovery from repeated treatment with two nephrocarcinogens. Front Genet. 2018 Dec 3;9:558.