Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGTAGCV)

DOT Name Protein phosphatase 1 regulatory subunit 1A (PPP1R1A)
Synonyms Protein phosphatase inhibitor 1; I-1; IPP-1
Gene Name PPP1R1A
Related Disease
Advanced cancer ( )
Glioblastoma multiforme ( )
Tuberculosis ( )
Acute myelogenous leukaemia ( )
Adenocarcinoma ( )
Alzheimer disease ( )
Arteriosclerosis ( )
Arthritis ( )
Astrocytoma ( )
Atherosclerosis ( )
Cardiac failure ( )
Cardiomyopathy ( )
Cervical cancer ( )
Cervical carcinoma ( )
Cholangiocarcinoma ( )
Classic Hodgkin lymphoma ( )
Colorectal carcinoma ( )
Congestive heart failure ( )
Crohn disease ( )
Dilated cardiomyopathy 1A ( )
Epithelial ovarian cancer ( )
Head and neck cancer ( )
Head and neck carcinoma ( )
Hepatitis B virus infection ( )
Idiopathic cardiomyopathy ( )
Lung cancer ( )
Lung carcinoma ( )
Malignant glioma ( )
Metastatic malignant neoplasm ( )
Myocardial infarction ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Sarcoma ( )
Breast cancer ( )
Breast carcinoma ( )
Gastric cancer ( )
Osteoarthritis ( )
Pancreatic cancer ( )
Prostate cancer ( )
Prostate carcinoma ( )
Stomach cancer ( )
Parkinson disease ( )
Plasma cell myeloma ( )
Rheumatoid arthritis ( )
Adult glioblastoma ( )
Arrhythmia ( )
Asthma ( )
Familial adenomatous polyposis ( )
Hepatocellular carcinoma ( )
Melanoma ( )
UniProt ID
PPR1A_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF05395
Sequence
MEQDNSPRKIQFTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEIDEDRIPNPHL
KSTLAMSPRQRKKMTRITPTMKELQMMVEHHLGQQQQGEEPEGAAESTGTQESRPPGIPD
TEVESRLGTSGTAKKTAECIPKTHERGSKEPSTKEPSTHIPPLDSKGANSV
Function
Inhibitor of protein-phosphatase 1. This protein may be important in hormonal control of glycogen metabolism. Hormones that elevate intracellular cAMP increase I-1 activity in many tissues. I-1 activation may impose cAMP control over proteins that are not directly phosphorylated by PKA. Following a rise in intracellular calcium, I-1 is inactivated by calcineurin (or PP2B). Does not inhibit type-2 phosphatases.
KEGG Pathway
Adrenergic sig.ling in cardiomyocytes (hsa04261 )
Long-term potentiation (hsa04720 )

Molecular Interaction Atlas (MIA) of This DOT

50 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Definitive Biomarker [1]
Glioblastoma multiforme DISK8246 Definitive Biomarker [2]
Tuberculosis DIS2YIMD Definitive Biomarker [3]
Acute myelogenous leukaemia DISCSPTN Strong Genetic Variation [4]
Adenocarcinoma DIS3IHTY Strong Genetic Variation [5]
Alzheimer disease DISF8S70 Strong Biomarker [6]
Arteriosclerosis DISK5QGC Strong Biomarker [7]
Arthritis DIST1YEL Strong Biomarker [8]
Astrocytoma DISL3V18 Strong Biomarker [9]
Atherosclerosis DISMN9J3 Strong Biomarker [7]
Cardiac failure DISDC067 Strong Biomarker [10]
Cardiomyopathy DISUPZRG Strong Biomarker [11]
Cervical cancer DISFSHPF Strong Biomarker [12]
Cervical carcinoma DIST4S00 Strong Biomarker [12]
Cholangiocarcinoma DIS71F6X Strong Biomarker [13]
Classic Hodgkin lymphoma DISV1LU6 Strong Genetic Variation [14]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [15]
Congestive heart failure DIS32MEA Strong Altered Expression [16]
Crohn disease DIS2C5Q8 Strong Biomarker [17]
Dilated cardiomyopathy 1A DIS0RK9Z Strong Altered Expression [18]
Epithelial ovarian cancer DIS56MH2 Strong Biomarker [19]
Head and neck cancer DISBPSQZ Strong Biomarker [20]
Head and neck carcinoma DISOU1DS Strong Biomarker [20]
Hepatitis B virus infection DISLQ2XY Strong Biomarker [21]
Idiopathic cardiomyopathy DISUGBZL Strong Biomarker [11]
Lung cancer DISCM4YA Strong Genetic Variation [22]
Lung carcinoma DISTR26C Strong Genetic Variation [22]
Malignant glioma DISFXKOV Strong Biomarker [23]
Metastatic malignant neoplasm DIS86UK6 Strong Biomarker [24]
Myocardial infarction DIS655KI Strong Biomarker [25]
Ovarian cancer DISZJHAP Strong Biomarker [19]
Ovarian neoplasm DISEAFTY Strong Biomarker [19]
Sarcoma DISZDG3U Strong Biomarker [26]
Breast cancer DIS7DPX1 moderate Biomarker [27]
Breast carcinoma DIS2UE88 moderate Biomarker [27]
Gastric cancer DISXGOUK moderate Biomarker [28]
Osteoarthritis DIS05URM moderate Biomarker [29]
Pancreatic cancer DISJC981 moderate Biomarker [30]
Prostate cancer DISF190Y moderate Biomarker [31]
Prostate carcinoma DISMJPLE moderate Biomarker [31]
Stomach cancer DISKIJSX moderate Biomarker [28]
Parkinson disease DISQVHKL Disputed Genetic Variation [32]
Plasma cell myeloma DIS0DFZ0 Disputed Biomarker [33]
Rheumatoid arthritis DISTSB4J Disputed Altered Expression [34]
Adult glioblastoma DISVP4LU Limited Altered Expression [35]
Arrhythmia DISFF2NI Limited Genetic Variation [36]
Asthma DISW9QNS Limited Biomarker [37]
Familial adenomatous polyposis DISW53RE Limited Biomarker [38]
Hepatocellular carcinoma DIS0J828 Limited Biomarker [39]
Melanoma DIS1RRCY Limited Biomarker [40]
------------------------------------------------------------------------------------
⏷ Show the Full List of 50 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
19 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Protein phosphatase 1 regulatory subunit 1A (PPP1R1A). [41]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Protein phosphatase 1 regulatory subunit 1A (PPP1R1A). [42]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Protein phosphatase 1 regulatory subunit 1A (PPP1R1A). [43]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Protein phosphatase 1 regulatory subunit 1A (PPP1R1A). [44]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Protein phosphatase 1 regulatory subunit 1A (PPP1R1A). [42]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Protein phosphatase 1 regulatory subunit 1A (PPP1R1A). [45]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Protein phosphatase 1 regulatory subunit 1A (PPP1R1A). [46]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Protein phosphatase 1 regulatory subunit 1A (PPP1R1A). [47]
Zoledronate DMIXC7G Approved Zoledronate decreases the expression of Protein phosphatase 1 regulatory subunit 1A (PPP1R1A). [48]
Progesterone DMUY35B Approved Progesterone decreases the expression of Protein phosphatase 1 regulatory subunit 1A (PPP1R1A). [49]
Panobinostat DM58WKG Approved Panobinostat increases the expression of Protein phosphatase 1 regulatory subunit 1A (PPP1R1A). [50]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Protein phosphatase 1 regulatory subunit 1A (PPP1R1A). [51]
Troglitazone DM3VFPD Approved Troglitazone increases the expression of Protein phosphatase 1 regulatory subunit 1A (PPP1R1A). [52]
Rosiglitazone DMILWZR Approved Rosiglitazone decreases the expression of Protein phosphatase 1 regulatory subunit 1A (PPP1R1A). [53]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Protein phosphatase 1 regulatory subunit 1A (PPP1R1A). [42]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Protein phosphatase 1 regulatory subunit 1A (PPP1R1A). [54]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Protein phosphatase 1 regulatory subunit 1A (PPP1R1A). [55]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Protein phosphatase 1 regulatory subunit 1A (PPP1R1A). [56]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Protein phosphatase 1 regulatory subunit 1A (PPP1R1A). [57]
------------------------------------------------------------------------------------
⏷ Show the Full List of 19 Drug(s)

References

1 Targeting Epigenetics to Prevent Obesity Promoted Cancers.Cancer Prev Res (Phila). 2018 Mar;11(3):125-128. doi: 10.1158/1940-6207.CAPR-18-0043. Epub 2018 Feb 23.
2 BET bromodomain proteins are required for glioblastoma cell proliferation.Epigenetics. 2014 Apr;9(4):611-20. doi: 10.4161/epi.27906. Epub 2014 Feb 19.
3 Biochemical and structural characterization of mycobacterial aspartyl-tRNA synthetase AspS, a promising TB drug target.PLoS One. 2014 Nov 19;9(11):e113568. doi: 10.1371/journal.pone.0113568. eCollection 2014.
4 Recurrent mutations, including NPM1c, activate a BRD4-dependent core transcriptional program in acute myeloid leukemia.Leukemia. 2014 Feb;28(2):311-20. doi: 10.1038/leu.2013.338. Epub 2013 Nov 13.
5 Genetic profile and biological implication of PIN2/TRF1-interacting telomerase inhibitor 1 (PinX1) in human cancers: an analysis using The Cancer Genome Atlas.Oncotarget. 2017 Jun 21;8(40):67241-67253. doi: 10.18632/oncotarget.18589. eCollection 2017 Sep 15.
6 Synergistic Protective Effects of Mitochondrial Division Inhibitor 1 and Mitochondria-Targeted Small Peptide SS31 in Alzheimer's Disease.J Alzheimers Dis. 2018;62(4):1549-1565. doi: 10.3233/JAD-170988.
7 Calpain inhibitor I attenuates atherosclerosis and inflammation in atherosclerotic rats through eNOS/NO/NF-B pathway.Can J Physiol Pharmacol. 2018 Jan;96(1):60-67. doi: 10.1139/cjpp-2016-0652. Epub 2017 Jul 30.
8 Potential anti-arthritic and anti-inflammatory effects of TNF- processing inhibitor-1 (TAPI-1): A new approach to the treatment of S. aureus arthritis.Immunobiology. 2020 Mar;225(2):151887. doi: 10.1016/j.imbio.2019.11.022. Epub 2019 Nov 30.
9 STAT3 inhibitors attenuate interferon--induced neurotoxicity and inflammatory molecule production by human astrocytes.Neurobiol Dis. 2011 Feb;41(2):299-307. doi: 10.1016/j.nbd.2010.09.018. Epub 2010 Oct 1.
10 AAV-9 mediated phosphatase-1 inhibitor-1 overexpression improves cardiac contractility in unchallenged mice but is deleterious in pressure-overload.Gene Ther. 2018 Jan;25(1):13-19. doi: 10.1038/gt.2017.97. Epub 2018 Jan 19.
11 Constitutively active phosphatase inhibitor-1 improves cardiac contractility in young mice but is deleterious after catecholaminergic stress and with aging.J Clin Invest. 2010 Feb;120(2):617-26. doi: 10.1172/JCI40545. Epub 2010 Jan 11.
12 Arginine methyltransferase inhibitor 1 exhibits antitumor effects against cervical cancer in vitro and in vivo.Pharmazie. 2018 May 1;73(5):269-273. doi: 10.1691/ph.2018.8365.
13 Mitochondrial division inhibitor-1 potentiates cisplatin-induced apoptosis via the mitochondrial death pathway in cholangiocarcinoma cells.Biomed Pharmacother. 2019 Mar;111:109-118. doi: 10.1016/j.biopha.2018.12.051. Epub 2018 Dec 19.
14 Inactivating I kappa B epsilon mutations in Hodgkin/Reed-Sternberg cells.J Pathol. 2003 Nov;201(3):413-20. doi: 10.1002/path.1454.
15 Metallopeptidase inhibitor 1 (TIMP-1) promotes receptor tyrosine kinase c-Kit signaling in colorectal cancer.Mol Oncol. 2019 Dec;13(12):2646-2662. doi: 10.1002/1878-0261.12575. Epub 2019 Oct 24.
16 Astragalosides increase the cardiac diastolic function and regulate the "Calcium sensing receptor-protein kinase C-protein phosphatase 1" pathway in rats with heart failure.Biomed Pharmacother. 2018 Jul;103:838-843. doi: 10.1016/j.biopha.2018.04.111. Epub 2018 Apr 24.
17 A phase 1 open-label trial shows that smad7 antisense oligonucleotide (GED0301) does not increase the risk of small bowel strictures in Crohn's disease. Aliment Pharmacol Ther. 2012 Nov;36(9):850-7.
18 Collagen I and III, MMP-1 and TIMP-1 immunoexpression in dilated cardiomyopathy.Rom J Morphol Embryol. 2017;58(3):777-781.
19 The BET bromodomain inhibitor i-BET151 impairs ovarian cancer metastasis and improves antitumor immunity.Cell Tissue Res. 2018 Dec;374(3):577-585. doi: 10.1007/s00441-018-2906-y. Epub 2018 Sep 4.
20 Overcoming cancer cell resistance to VSV oncolysis with JAK1/2 inhibitors.Cancer Gene Ther. 2013 Oct;20(10):582-9. doi: 10.1038/cgt.2013.55. Epub 2013 Sep 13.
21 Pevonedistat, a Neuronal Precursor Cell-Expressed Developmentally Down-Regulated Protein 8-Activating Enzyme Inhibitor, Is a Potent Inhibitor of Hepatitis B Virus.Hepatology. 2019 May;69(5):1903-1915. doi: 10.1002/hep.30491. Epub 2019 Mar 13.
22 Chemoprevention of Preclinical Breast and Lung Cancer with the Bromodomain Inhibitor I-BET 762.Cancer Prev Res (Phila). 2018 Mar;11(3):143-156. doi: 10.1158/1940-6207.CAPR-17-0264. Epub 2017 Dec 15.
23 Proteasome inhibitors induce p53/p21-independent apoptosis in human glioma cells.Cell Physiol Biochem. 1999;9(3):117-25. doi: 10.1159/000016308.
24 Tissue Factor Pathway Inhibitor-1 Is a Valuable Marker for the Prediction of Deep Venous Thrombosis and Tumor Metastasis in Patients with Lung Cancer.Biomed Res Int. 2017;2017:8983763. doi: 10.1155/2017/8983763. Epub 2017 Jan 26.
25 AAV9.I-1c delivered via direct coronary infusion in a porcine model of heart failure improves contractility and mitigates adverse remodeling.Circ Heart Fail. 2013 Mar;6(2):310-7. doi: 10.1161/CIRCHEARTFAILURE.112.971325. Epub 2012 Dec 27.
26 Arginine methyltransferase inhibitor-1 inhibits sarcoma viability in vitro and in vivo.Oncol Lett. 2018 Aug;16(2):2161-2166. doi: 10.3892/ol.2018.8929. Epub 2018 Jun 8.
27 A Novel lncRNA HOXC-AS3 Acts as a miR-3922-5p Sponge to Promote Breast Cancer Metastasis.Cancer Invest. 2020 Jan;38(1):1-12. doi: 10.1080/07357907.2019.1695816. Epub 2019 Dec 4.
28 Arginine methyltransferase inhibitor 1 inhibits gastric cancer by downregulating eIF4E and targeting PRMT5.Toxicol Appl Pharmacol. 2017 Dec 1;336:1-7. doi: 10.1016/j.taap.2017.10.002. Epub 2017 Oct 4.
29 Cyclin-Dependent Kinase Inhibitor-1-Deficient Mice are Susceptible to Osteoarthritis Associated with Enhanced Inflammation.J Bone Miner Res. 2017 May;32(5):991-1001. doi: 10.1002/jbmr.3080. Epub 2017 Jan 27.
30 Difluoromethylornithine Combined with a Polyamine Transport Inhibitor Is Effective against Gemcitabine Resistant Pancreatic Cancer.Mol Pharm. 2018 Feb 5;15(2):369-376. doi: 10.1021/acs.molpharmaceut.7b00718. Epub 2018 Jan 4.
31 Proteasome inhibitor-I enhances tunicamycin-induced chemosensitization of prostate cancer cells through regulation of NF-B and CHOP expression.Cell Signal. 2011 May;23(5):857-65. doi: 10.1016/j.cellsig.2011.01.010. Epub 2011 Jan 27.
32 Mitochondrial division inhibitor-1 is neuroprotective in the A53T--synuclein rat model of Parkinson's disease.Sci Rep. 2017 Aug 8;7(1):7495. doi: 10.1038/s41598-017-07181-0.
33 I-BET151 suppresses osteoclast formation and inflammatory cytokines secretion by targetting BRD4 in multiple myeloma.Biosci Rep. 2019 May 14;39(5):BSR20181245. doi: 10.1042/BSR20181245. Print 2019 May 31.
34 The bromodomain protein inhibitor I-BET151 suppresses expression of inflammatory genes and matrix degrading enzymes in rheumatoid arthritis synovial fibroblasts.Ann Rheum Dis. 2016 Feb;75(2):422-9. doi: 10.1136/annrheumdis-2014-205809. Epub 2014 Dec 2.
35 Brain angiogenesis inhibitor 1 is differentially expressed in normal brain and glioblastoma independently of p53 expression.Am J Pathol. 2003 Jan;162(1):19-27. doi: 10.1016/S0002-9440(10)63794-7.
36 Human G109E-inhibitor-1 impairs cardiac function and promotes arrhythmias.J Mol Cell Cardiol. 2015 Dec;89(Pt B):349-59. doi: 10.1016/j.yjmcc.2015.10.004. Epub 2015 Oct 9.
37 Toxoplasma gondii serine-protease inhibitor-1: A new adjuvant candidate for asthma therapy.PLoS One. 2017 Oct 26;12(10):e0187002. doi: 10.1371/journal.pone.0187002. eCollection 2017.
38 Design and Synthesis of TASIN Analogues Specifically Targeting Colorectal Cancer Cell Lines with Mutant Adenomatous Polyposis Coli (APC).J Med Chem. 2019 May 23;62(10):5217-5241. doi: 10.1021/acs.jmedchem.9b00532. Epub 2019 May 9.
39 Protein phosphatase inhibitor-1 mRNA expression correlates with neoplastic transformation of epithelial liver cells and progression of hepatocellular carcinomas.Int J Oncol. 2004 Apr;24(4):869-77.
40 CAPN1 is a novel binding partner and regulator of the tumor suppressor NF1 in melanoma.Oncotarget. 2018 Jul 27;9(58):31264-31277. doi: 10.18632/oncotarget.25805. eCollection 2018 Jul 27.
41 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
42 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
43 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
44 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
45 Integrated assessment by multiple gene expression analysis of quercetin bioactivity on anticancer-related mechanisms in colon cancer cells in vitro. Eur J Nutr. 2005 Mar;44(3):143-56. doi: 10.1007/s00394-004-0503-1. Epub 2004 Apr 30.
46 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
47 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
48 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
49 Endometrial receptivity is affected in women with high circulating progesterone levels at the end of the follicular phase: a functional genomics analysis. Hum Reprod. 2011 Jul;26(7):1813-25.
50 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
51 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
52 Adipogenic Effects and Gene Expression Profiling of Firemaster? 550 Components in Human Primary Preadipocytes. Environ Health Perspect. 2017 Sep 14;125(9):097013. doi: 10.1289/EHP1318.
53 Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
54 BET bromodomain inhibitors suppress EWS-FLI1-dependent transcription and the IGF1 autocrine mechanism in Ewing sarcoma. Oncotarget. 2016 Jul 12;7(28):43504-43517. doi: 10.18632/oncotarget.9762.
55 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
56 Comparative Analysis of Transcriptomic Changes including mRNA and microRNA Expression Induced by the Xenoestrogens Zearalenone and Bisphenol A in Human Ovarian Cells. Toxins (Basel). 2023 Feb 9;15(2):140. doi: 10.3390/toxins15020140.
57 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.