Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTI31178)

• DOT Name: Collagen alpha-1(I) chain (COL1A1)
• Synonyms: Alpha-1 type I collagen
• Gene Name: COL1A1
• Related Disease:
  Caffey disease
  Combined osteogenesis imperfecta and Ehlers-Danlos syndrome 1
  Ehlers-Danlos syndrome, arthrochalasia type
  Osteogenesis imperfecta type 1
  Osteogenesis imperfecta type 2
  Osteogenesis imperfecta type 3
  Osteogenesis imperfecta type 4
  Advanced cancer
  Autoimmune disease
  Autoimmune lymphoproliferative syndrome type 2B
  Cholangitis
  Cholestasis
  Coagulation defect
  Congestive heart failure
  Dentinogenesis imperfecta
  Diabetic kidney disease
  Ehlers-Danlos syndrome
  High blood pressure
  Liver and intrahepatic bile duct neoplasm
  Liver cirrhosis
  Nasopharyngeal carcinoma
  Nephrotic syndrome
  Pulmonary hypertension
  Skeletal dysplasia
  Skin neoplasm
  Systemic sclerosis
  Calcinosis
  Chronic pancreatitis
  Ehlers-Danlos syndrome, classic type, 1
  Familial tumoral calcinosis
  Heart valve disorder
  Keloid
  Osteoporosis
  Pulmonary fibrosis
  Ehlers-Danlos syndrome, classic type
  Ehlers-Danlos/osteogenesis imperfecta syndrome
  High bone mass osteogenesis imperfecta
  Primary biliary cholangitis
  Asthma
  Gastric cancer
  Glaucoma/ocular hypertension
  Myocardial infarction
  Myopia
  Postmenopausal osteoporosis
  Stomach cancer
• UniProt ID: CO1A1_HUMAN
• PDB ID: 1Q7D; 2LLP; 3EJH; 3GXE; 5CTD; 5CTI; 5CVA; 5CVB; 5K31; 5OU8; 5OU9; 7E7B; 7E7D
• Pfam ID: PF01410 ; PF01391 ; PF00093
• Sequence:
  MFSFVDLRLLLLLAATALLTHGQEEGQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRI
  CVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPR
  GPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPQLSYGYDEKSTGGISVPGP
  MGPSGPRGLPGPPGAPGPQGFQGPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGR
  PGERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQ
  MGPRGLPGERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEAGPQGP
  RGSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGP
  QGPGGPPGPKGNSGEPGAPGSKGDTGAKGEPGPVGVQGPPGPAGEEGKRGARGEPGPTGL
  PGPPGERGGPGSRGFPGADGVAGPKGPAGERGSPGPAGPKGSPGEAGRPGEAGLPGAKGL
  TGSPGSPGPDGKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPGKAGERGV
  PGPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGE
  QGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGANGAPGNDGAKGDAGAPGAPGS
  QGAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGSPGKDGVRGLTGPIGPPGPAGAPGD
  KGESGPSGPAGPTGARGAPGDRGEPGPPGPAGFAGPPGADGQPGAKGEPGDAGAKGDAGP
  PGPAGPAGPPGPIGNVGAPGAKGARGSAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGP
  AGKEGGKGPRGETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGAPGTPGPQGIAGQRGV
  VGLPGQRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGAPGA
  EGSPGRDGSPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKSGDRGETGPAGPAGPVGP
  VGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGP
  RGPPGSAGAPGKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSAGFDFSF
  LPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCR
  DLKMCHSDWKSGEYWIDPNQGCNLDAIKVFCNMETGETCVYPTQPSVAQKNWYISKNPKD
  KRHVWFGESMTDGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQ
  TGNLKKALLLQGSNEIEIRAEGNSRFTYSVTVDGCTSHTGAWGKTVIEYKTTKTSRLPII
  DVAPLDVGAPDQEFGFDVGPVCFL
• Function: Type I collagen is a member of group I collagen (fibrillar forming collagen).
• Tissue Specificity: Forms the fibrils of tendon, ligaments and bones. In bones the fibrils are mineralized with calcium hydroxyapatite.
• KEGG Pathway:
  PI3K-Akt sig.ling pathway (hsa04151)
  Focal adhesion (hsa04510)
  ECM-receptor interaction (hsa04512)
  Platelet activation (hsa04611)
  Cytoskeleton in muscle cells (hsa04820)
  Relaxin sig.ling pathway (hsa04926)
  AGE-RAGE sig.ling pathway in diabetic complications (hsa04933)
  Protein digestion and absorption (hsa04974)
  Amoebiasis (hsa05146)
  Human papillomavirus infection (hsa05165)
  Proteoglycans in cancer (hsa05205)
  Diabetic cardiomyopathy (hsa05415)
• Reactome Pathway:
  Collagen degradation (R-HSA-1442490)
  Extracellular matrix organization (R-HSA-1474244)
  Collagen biosynthesis and modifying enzymes (R-HSA-1650814)
  Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933)
  Assembly of collagen fibrils and other multimeric structures (R-HSA-2022090)
  Cell surface interactions at the vascular wall (R-HSA-202733)
  Integrin cell surface interactions (R-HSA-216083)
  Anchoring fibril formation (R-HSA-2214320)
  Crosslinking of collagen fibrils (R-HSA-2243919)
  Syndecan interactions (R-HSA-3000170)
  Non-integrin membrane-ECM interactions (R-HSA-3000171)
  ECM proteoglycans (R-HSA-3000178)
  Scavenging by Class A Receptors (R-HSA-3000480)
  GP1b-IX-V activation signalling (R-HSA-430116)
  Platelet Adhesion to exposed collagen (R-HSA-75892)
  Platelet Aggregation (Plug Formation) (R-HSA-76009)
  MET activates PTK2 signaling (R-HSA-8874081)
  RUNX2 regulates osteoblast differentiation (R-HSA-8940973)
  Collagen chain trimerization (R-HSA-8948216)
  GPVI-mediated activation cascade (R-HSA-114604)

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Caffey disease	DISVIILK	Definitive	Autosomal dominant	[1]
Combined osteogenesis imperfecta and Ehlers-Danlos syndrome 1	DISK8VRL	Definitive	Autosomal dominant	[1]
Ehlers-Danlos syndrome, arthrochalasia type	DISSQ1CQ	Definitive	Autosomal dominant	[1]
Osteogenesis imperfecta type 1	DISPEDS3	Definitive	Autosomal dominant	[1]
Osteogenesis imperfecta type 2	DISMGSS3	Definitive	Autosomal dominant	[1]
Osteogenesis imperfecta type 3	DISFJVSJ	Definitive	Autosomal dominant	[1]
Osteogenesis imperfecta type 4	DIS8S46L	Definitive	Autosomal dominant	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Autoimmune disease	DISORMTM	Strong	Biomarker	[3]
Autoimmune lymphoproliferative syndrome type 2B	DIS7EXGM	Strong	Genetic Variation	[4]
Cholangitis	DIS9U3YN	Strong	Biomarker	[3]
Cholestasis	DISDJJWE	Strong	Biomarker	[5]
Coagulation defect	DIS9X3H6	Strong	Biomarker	[6]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[7]
Dentinogenesis imperfecta	DISJLZU4	Strong	Biomarker	[8]
Diabetic kidney disease	DISJMWEY	Strong	Biomarker	[9]
Ehlers-Danlos syndrome	DISSVBRR	Strong	Genetic Variation	[10]
High blood pressure	DISY2OHH	Strong	Biomarker	[11]
Liver and intrahepatic bile duct neoplasm	DISRQ76N	Strong	ModifyingMutation	[12]
Liver cirrhosis	DIS4G1GX	Strong	Genetic Variation	[13]
Nasopharyngeal carcinoma	DISAOTQ0	Strong	Altered Expression	[14]
Nephrotic syndrome	DISSPSC2	Strong	Altered Expression	[15]
Pulmonary hypertension	DIS1RSP5	Strong	Therapeutic	[16]
Skeletal dysplasia	DIS5Z8U6	Strong	Genetic Variation	[17]
Skin neoplasm	DIS16DDV	Strong	Genetic Variation	[18]
Systemic sclerosis	DISF44L6	Strong	Altered Expression	[19]
Calcinosis	DISQP4OR	moderate	Biomarker	[20]
Chronic pancreatitis	DISBUOMJ	moderate	Therapeutic	[21]
Ehlers-Danlos syndrome, classic type, 1	DIS4BR9L	Moderate	Autosomal dominant	[1]
Familial tumoral calcinosis	DISYJZKG	moderate	Biomarker	[20]
Heart valve disorder	DIS84O7T	moderate	Biomarker	[20]
Keloid	DISV09JY	moderate	Altered Expression	[22]
Osteoporosis	DISF2JE0	moderate	Biomarker	[23]
Pulmonary fibrosis	DISQKVLA	moderate	Biomarker	[24]
Ehlers-Danlos syndrome, classic type	DISKOTBA	Supportive	Autosomal dominant	[25]
Ehlers-Danlos/osteogenesis imperfecta syndrome	DISK4W8M	Supportive	Autosomal dominant	[26]
High bone mass osteogenesis imperfecta	DIS9U2CU	Supportive	Autosomal dominant	[27]
Primary biliary cholangitis	DIS43E0O	Disputed	Therapeutic	[28]
Asthma	DISW9QNS	Limited	Altered Expression	[29]
Gastric cancer	DISXGOUK	Limited	Altered Expression	[30]
Glaucoma/ocular hypertension	DISLBXBY	Limited	Biomarker	[31]
Myocardial infarction	DIS655KI	Limited	Therapeutic	[32]
Myopia	DISK5S60	Limited	Genetic Variation	[33]
Postmenopausal osteoporosis	DISS0RQZ	Limited	Altered Expression	[34]
Stomach cancer	DISKIJSX	Limited	Altered Expression	[30]

This DOT Affected the Drug Response of 4 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Temozolomide	DMKECZD	Approved	Collagen alpha-1(I) chain (COL1A1) affects the response to substance of Temozolomide.	[105]
Nicotine	DMWX5CO	Approved	Collagen alpha-1(I) chain (COL1A1) increases the Cell death ADR of Nicotine.	[106]
DTI-015	DMXZRW0	Approved	Collagen alpha-1(I) chain (COL1A1) affects the response to substance of DTI-015.	[105]
Penicillamine	DM40EF6	Approved	Collagen alpha-1(I) chain (COL1A1) increases the Congenital, familial and genetic disorders ADR of Penicillamine.	[106]

89 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[35]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[36]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[37]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[38]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[39]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[40]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Collagen alpha-1(I) chain (COL1A1).	[41]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[42]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[43]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[44]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Collagen alpha-1(I) chain (COL1A1).	[45]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[46]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Collagen alpha-1(I) chain (COL1A1).	[47]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[48]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Collagen alpha-1(I) chain (COL1A1).	[49]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[50]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[51]
Menadione	DMSJDTY	Approved	Menadione decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[52]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[53]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Collagen alpha-1(I) chain (COL1A1).	[54]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Collagen alpha-1(I) chain (COL1A1).	[55]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Collagen alpha-1(I) chain (COL1A1).	[56]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Collagen alpha-1(I) chain (COL1A1).	[57]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[58]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Collagen alpha-1(I) chain (COL1A1).	[59]
Paclitaxel	DMLB81S	Approved	Paclitaxel increases the expression of Collagen alpha-1(I) chain (COL1A1).	[60]
Piroxicam	DMTK234	Approved	Piroxicam increases the expression of Collagen alpha-1(I) chain (COL1A1).	[57]
Simvastatin	DM30SGU	Approved	Simvastatin decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[61]
Gemcitabine	DMSE3I7	Approved	Gemcitabine decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[53]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[62]
Alitretinoin	DMME8LH	Approved	Alitretinoin increases the expression of Collagen alpha-1(I) chain (COL1A1).	[63]
Phenytoin	DMNOKBV	Approved	Phenytoin decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[64]
Prednisolone	DMQ8FR2	Approved	Prednisolone increases the expression of Collagen alpha-1(I) chain (COL1A1).	[57]
Vitamin C	DMXJ7O8	Approved	Vitamin C increases the expression of Collagen alpha-1(I) chain (COL1A1).	[65]
Beta-carotene	DM0RXBT	Approved	Beta-carotene decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[63]
Methylprednisolone	DM4BDON	Approved	Methylprednisolone increases the expression of Collagen alpha-1(I) chain (COL1A1).	[57]
Dinoprostone	DMTYOPD	Approved	Dinoprostone decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[64]
Dactinomycin	DM2YGNW	Approved	Dactinomycin decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[66]
Vitamin A	DMJ2AH4	Approved	Vitamin A increases the expression of Collagen alpha-1(I) chain (COL1A1).	[63]
Glucosamine	DM4ZLFD	Approved	Glucosamine decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[68]
Tacrolimus	DMZ7XNQ	Approved	Tacrolimus increases the expression of Collagen alpha-1(I) chain (COL1A1).	[69]
Sodium chloride	DMM3950	Approved	Sodium chloride increases the expression of Collagen alpha-1(I) chain (COL1A1).	[70]
Diazepam	DM08E9O	Approved	Diazepam increases the expression of Collagen alpha-1(I) chain (COL1A1).	[71]
Chloramphenicol	DMFXEWT	Approved	Chloramphenicol increases the expression of Collagen alpha-1(I) chain (COL1A1).	[72]
Pamidronate	DMB4AVP	Approved	Pamidronate decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[50]
Hydralazine	DMU8JGH	Approved	Hydralazine decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[73]
Ademetionine	DMYQDBO	Approved	Ademetionine decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[74]
Ceruletide	DM2WE5K	Approved	Ceruletide increases the expression of Collagen alpha-1(I) chain (COL1A1).	[75]
Pirfenidone	DM6VZFQ	Approved	Pirfenidone decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[35]
Berberine	DMC5Q8X	Phase 4	Berberine increases the expression of Collagen alpha-1(I) chain (COL1A1).	[76]
Isoflavone	DM7U58J	Phase 4	Isoflavone affects the expression of Collagen alpha-1(I) chain (COL1A1).	[77]
Diacerein	DMN2Q5I	Phase 4	Diacerein decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[68]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Collagen alpha-1(I) chain (COL1A1).	[78]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[79]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the expression of Collagen alpha-1(I) chain (COL1A1).	[80]
Coprexa	DMA0WEK	Phase 3	Coprexa increases the expression of Collagen alpha-1(I) chain (COL1A1).	[81]
Atorvastatin	DMF28YC	Phase 3 Trial	Atorvastatin increases the expression of Collagen alpha-1(I) chain (COL1A1).	[82]
HMPL-004	DM29XGY	Phase 3	HMPL-004 decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[83]
Guaiacol	DMN4E7T	Phase 3	Guaiacol increases the expression of Collagen alpha-1(I) chain (COL1A1).	[80]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[84]
Phenol	DM1QSM3	Phase 2/3	Phenol increases the expression of Collagen alpha-1(I) chain (COL1A1).	[72]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[86]
Tetrandrine	DMAOJBX	Phase 1	Tetrandrine decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[35]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[35]
Tetramethylpyrazine	DMC0WNB	Discontinued in Phase 2	Tetramethylpyrazine decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[87]
SB 203580	DMAET6F	Terminated	SB 203580 decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[35]
Methylthioadenosine	DMC8J6F	Terminated	Methylthioadenosine decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[74]
Dizocilpine	DMMGYXR	Terminated	Dizocilpine increases the expression of Collagen alpha-1(I) chain (COL1A1).	[88]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Collagen alpha-1(I) chain (COL1A1).	[89]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Collagen alpha-1(I) chain (COL1A1).	[90]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[91]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Collagen alpha-1(I) chain (COL1A1).	[92]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[93]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Collagen alpha-1(I) chain (COL1A1).	[94]
D-glucose	DMMG2TO	Investigative	D-glucose decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[95]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal increases the expression of Collagen alpha-1(I) chain (COL1A1).	[96]
all-trans-4-oxo-retinoic acid	DMM2R1N	Investigative	all-trans-4-oxo-retinoic acid increases the expression of Collagen alpha-1(I) chain (COL1A1).	[63]
Oleic acid	DM54O1Z	Investigative	Oleic acid increases the expression of Collagen alpha-1(I) chain (COL1A1).	[97]
NAPQI	DM8F5LR	Investigative	NAPQI increases the expression of Collagen alpha-1(I) chain (COL1A1).	[98]
Chlorogenic acid	DM2Y3P4	Investigative	Chlorogenic acid increases the expression of Collagen alpha-1(I) chain (COL1A1).	[80]
I-BET151	DMYRUH2	Investigative	I-BET151 decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[86]
Isoarnebin 4	DM0B7NO	Investigative	Isoarnebin 4 decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[99]
PFI-1	DMVFK3J	Investigative	PFI-1 decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[86]
ROSMARINIC ACID	DMQ6SJT	Investigative	ROSMARINIC ACID decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[35]
20-HETE	DM5BAJ9	Investigative	20-HETE increases the expression of Collagen alpha-1(I) chain (COL1A1).	[100]
Alpha-ketoglutaric acid	DM5LFYN	Investigative	Alpha-ketoglutaric acid increases the expression of Collagen alpha-1(I) chain (COL1A1).	[101]
(L-)-S-adenosyl-L-homocysteine	DMDUN83	Investigative	(L-)-S-adenosyl-L-homocysteine decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[74]
LY2109761	DMAWTG3	Investigative	LY2109761 decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[102]
Guajazulen	DMGYMW4	Investigative	Guajazulen decreases the expression of Collagen alpha-1(I) chain (COL1A1).	[104]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Olanzapine	DMPFN6Y	Approved	Olanzapine decreases the phosphorylation of Collagen alpha-1(I) chain (COL1A1).	[67]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Collagen alpha-1(I) chain (COL1A1).	[85]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Elaidoylamide	DMP8VDT	Investigative	Elaidoylamide decreases the secretion of Collagen alpha-1(I) chain (COL1A1).	[103]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Biomarker identification and trans-regulatory network analyses in esophageal adenocarcinoma and Barrett's esophagus.World J Gastroenterol. 2019 Jan 14;25(2):233-244. doi: 10.3748/wjg.v25.i2.233.
• [3] Toxicogenomic analysis reveals profibrogenic effects of trichloroethylene in autoimmune-mediated cholangitis in mice.Toxicol Sci. 2014 Oct;141(2):515-23. doi: 10.1093/toxsci/kfu148. Epub 2014 Jul 23.
• [4] Delineation of Ehlers-Danlos syndrome phenotype due to the c.934C>T, p.(Arg312Cys) mutation in COL1A1: Report on a three-generation family without cardiovascular events, and literature review.Am J Med Genet A. 2017 Feb;173(2):524-530. doi: 10.1002/ajmg.a.38035. Epub 2016 Nov 7.
• [5] Aqueous extract of Artemisia iwayomogi Kitamura attenuates cholestatic liver fibrosis in a rat model of bile duct ligation.Food Chem Toxicol. 2012 Oct;50(10):3505-13. doi: 10.1016/j.fct.2012.07.018. Epub 2012 Jul 20.
• [6] Familial Ehlers-Danlos syndrome with lethal arterial events caused by a mutation in COL5A1.Am J Med Genet A. 2015 Jun;167(6):1196-203. doi: 10.1002/ajmg.a.36997. Epub 2015 Apr 2.
• [7] MicroRNA29: a mechanistic contributor and potential biomarker in atrial fibrillation.Circulation. 2013 Apr 9;127(14):1466-75, 1475e1-28. doi: 10.1161/CIRCULATIONAHA.112.001207. Epub 2013 Mar 4.
• [8] Dentin dysplasia type I-A dental disease with genetic heterogeneity.Oral Dis. 2019 Mar;25(2):439-446. doi: 10.1111/odi.12861. Epub 2018 Apr 10.
• [9] Gene expression profiling in glomeruli of diabetic nephropathy rat.Exp Biol Med (Maywood). 2012 Aug;237(8):903-11. doi: 10.1258/ebm.2012.012032. Epub 2012 Aug 17.
• [10] Classical Ehlers-Danlos syndrome with a propensity to arterial events: A new report on a French family with a COL1A1 p.(Arg312Cys) variant.Clin Genet. 2020 Feb;97(2):357-361. doi: 10.1111/cge.13643. Epub 2019 Oct 1.
• [11] Renoprotective effects of carvedilol in hypertensive-stroke prone rats may involve inhibition of TGF beta expression.Br J Pharmacol. 2001 Nov;134(5):977-84. doi: 10.1038/sj.bjp.0704329.
• [12] Concomitant apoptosis and regeneration of liver cells as a mechanism of liver-tumor promotion by -naphthoflavone involving TNF-signaling due to oxidative cellular stress in rats.Toxicology. 2011 Apr 28;283(1):8-17. doi: 10.1016/j.tox.2011.01.020. Epub 2011 Feb 2.
• [13] Epigenetic Effects of an Adenosine Derivative in a Wistar Rat Model of Liver Cirrhosis.J Cell Biochem. 2018 Jan;119(1):401-413. doi: 10.1002/jcb.26192. Epub 2017 Jul 4.
• [14] Improved Radiotherapy Sensitivity of Nasopharyngeal Carcinoma Cells by miR-29-3p Targeting COL1A1 3'-UTR.Med Sci Monit. 2019 Apr 29;25:3161-3169. doi: 10.12659/MSM.915624.
• [15] Urinary sediment mRNA level of extracellular matrix molecules in adult nephrotic syndrome.Clin Chim Acta. 2016 May 1;456:157-162. doi: 10.1016/j.cca.2016.03.006. Epub 2016 Mar 16.
• [16] Effects of angiotensin II intervention on MMP-2, MMP-9, TIMP-1, and collagen expression in rats with pulmonary hypertension.Genet Mol Res. 2015 Mar 6;14(1):1707-17. doi: 10.4238/2015.March.6.17.
• [17] Diagnostic conundrums in antenatal presentation of a skeletal dysplasia with description of a heterozygous C-propeptide mutation in COL1A1 associated with a severe presentation of osteogenesis imperfecta.Am J Med Genet A. 2016 Dec;170(12):3303-3307. doi: 10.1002/ajmg.a.37943. Epub 2016 Aug 23.
• [18] Transforming activity of the chimeric sequence formed by the fusion of collagen gene COL1A1 and the platelet derived growth factor b-chain gene in dermatofibrosarcoma protuberans.Oncogene. 1998 Sep 10;17(10):1313-9. doi: 10.1038/sj.onc.1202051.
• [19] Epidermal Growth Factor Like-domain 7 and miR-126 are abnormally expressed in diffuse Systemic Sclerosis fibroblasts.Sci Rep. 2019 Mar 14;9(1):4589. doi: 10.1038/s41598-019-39485-8.
• [20] Raloxifene attenuates Gas6 and apoptosis in experimental aortic valve disease in renal failure.Am J Physiol Heart Circ Physiol. 2011 May;300(5):H1829-40. doi: 10.1152/ajpheart.00240.2010. Epub 2011 Feb 18.
• [21] Comparison of antioxidative and antifibrotic effects of -tocopherol with those of tocotrienol-rich fraction in a rat model of chronic pancreatitis.Pancreas. 2011 Oct;40(7):1091-6. doi: 10.1097/MPA.0b013e31821b59c6.
• [22] miR-96 promotes collagen deposition in keloids by targeting Smad7.Exp Ther Med. 2019 Jan;17(1):773-781. doi: 10.3892/etm.2018.7008. Epub 2018 Nov 23.
• [23] Identification of novel genes associated with fracture healing in osteoporosis induced by Krm2 overexpression or Lrp5 deficiency.Mol Med Rep. 2017 Jun;15(6):3969-3976. doi: 10.3892/mmr.2017.6544. Epub 2017 May 3.
• [24] Cleavage factor 25 deregulation contributes to pulmonary fibrosis through alternative polyadenylation.J Clin Invest. 2019 Feb 28;129(5):1984-1999. doi: 10.1172/JCI122106. Print 2019 May 1.
• [25] Classical Ehlers-Danlos syndrome caused by a mutation in type I collagen. Am J Hum Genet. 2000 Apr;66(4):1398-402. doi: 10.1086/302859. Epub 2000 Mar 17.
• [26] Mutations near amino end of alpha1(I) collagen cause combined osteogenesis imperfecta/Ehlers-Danlos syndrome by interference with N-propeptide processing. J Biol Chem. 2005 May 13;280(19):19259-69. doi: 10.1074/jbc.M414698200. Epub 2005 Feb 22.
• [27] COL1 C-propeptide cleavage site mutations cause high bone mass osteogenesis imperfecta. Hum Mutat. 2011 Jun;32(6):598-609. doi: 10.1002/humu.21475. Epub 2011 Apr 7.
• [28] Macrophage-mediated phagocytosis of apoptotic cholangiocytes contributes to reversal of experimental biliary fibrosis.Am J Physiol Gastrointest Liver Physiol. 2010 Mar;298(3):G323-34. doi: 10.1152/ajpgi.00394.2009. Epub 2010 Jan 7.
• [29] Fibroblast gene expression following asthmatic bronchial epithelial cell conditioning correlates with epithelial donor lung function and exacerbation history.Sci Rep. 2018 Oct 25;8(1):15768. doi: 10.1038/s41598-018-34021-6.
• [30] LncRNA COL1A1-014 is involved in the progression of gastric cancer via regulating CXCL12-CXCR4 axis.Gastric Cancer. 2020 Mar;23(2):260-272. doi: 10.1007/s10120-019-01011-0. Epub 2019 Oct 24.
• [31] Activation of the NFAT-Calcium Signaling Pathway in Human Lamina Cribrosa Cells in Glaucoma.Invest Ophthalmol Vis Sci. 2018 Feb 1;59(2):831-842. doi: 10.1167/iovs.17-22531.
• [32] microRNA-29b Mediates the Antifibrotic Effect of Tanshinone IIA in Postinfarct Cardiac Remodeling.J Cardiovasc Pharmacol. 2015 May;65(5):456-64. doi: 10.1097/FJC.0000000000000214.
• [33] COL1A1 and COL2A1 genes and myopia susceptibility: evidence of association and suggestive linkage to the COL2A1 locus.Invest Ophthalmol Vis Sci. 2009 Sep;50(9):4080-6. doi: 10.1167/iovs.08-3346. Epub 2009 Apr 22.
• [34] MicroRNA-218-5p relieves postmenopausal osteoporosis through promoting the osteoblast differentiation of bone marrow mesenchymal stem cells.J Cell Biochem. 2020 Feb;121(2):1216-1226. doi: 10.1002/jcb.29355. Epub 2019 Sep 3.
• [35] Human precision-cut liver slices as a model to test antifibrotic drugs in the early onset of liver fibrosis. Toxicol In Vitro. 2016 Sep;35:77-85. doi: 10.1016/j.tiv.2016.05.012. Epub 2016 May 26.
• [36] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [37] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [38] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [39] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [40] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [41] Estrogen Regulates MAPK-Related Genes through Genomic and Nongenomic Interactions between IGF-I Receptor Tyrosine Kinase and Estrogen Receptor-Alpha Signaling Pathways in Human Uterine Leiomyoma Cells. J Signal Transduct. 2012;2012:204236. doi: 10.1155/2012/204236. Epub 2012 Oct 9.
• [42] Antifibrotic effects of quercetin in primary orbital fibroblasts and orbital fat tissue cultures of Graves' orbitopathy. Invest Ophthalmol Vis Sci. 2012 Aug 31;53(9):5921-9. doi: 10.1167/iovs.12-9646.
• [43] Arsenic trioxide inhibits the differentiation of fibroblasts to myofibroblasts through nuclear factor erythroid 2-like 2 (NFE2L2) protein and the Smad2/3 pathway. J Cell Physiol. 2019 Mar;234(3):2606-2617. doi: 10.1002/jcp.27073. Epub 2018 Oct 14.
• [44] Protective effects of myricitrin against osteoporosis via reducing reactive oxygen species and bone-resorbing cytokines. Toxicol Appl Pharmacol. 2014 Nov 1;280(3):550-60.
• [45] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [46] Primary Human Hepatocyte Spheroids as Tools to Study the Hepatotoxic Potential of Non-Pharmaceutical Chemicals. Int J Mol Sci. 2021 Oct 12;22(20):11005. doi: 10.3390/ijms222011005.
• [47] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [48] Gene expression profiling of rheumatoid arthritis synovial cells treated with antirheumatic drugs. J Biomol Screen. 2007 Apr;12(3):328-40. doi: 10.1177/1087057107299261. Epub 2007 Mar 22.
• [49] CpG hypermethylation of collagen type I alpha 2 contributes to proliferation and migration activity of human bladder cancer. Int J Oncol. 2009 Jun;34(6):1593-602. doi: 10.3892/ijo_00000289.
• [50] Expression profile and synthesis of different collagen types I, II, III, and V of human gingival fibroblasts, osteoblasts, and SaOS-2 cells after bisphosphonate treatment. Clin Oral Investig. 2010 Feb;14(1):51-8. doi: 10.1007/s00784-009-0312-2. Epub 2009 Jul 14.
• [51] Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
• [52] Vitamin K promotes mineralization, osteoblast-to-osteocyte transition, and an anticatabolic phenotype by {gamma}-carboxylation-dependent and -independent mechanisms. Am J Physiol Cell Physiol. 2009 Dec;297(6):C1358-67. doi: 10.1152/ajpcell.00216.2009. Epub 2009 Aug 12.
• [53] The anthelmintic drug niclosamide induces GSK--mediated -catenin degradation to potentiate gemcitabine activity, reduce immune evasion ability and suppress pancreatic cancer progression. Cell Death Dis. 2022 Feb 3;13(2):112. doi: 10.1038/s41419-022-04573-7.
• [54] Investigation of in vitro odonto/osteogenic capacity of cannabidiol on human dental pulp cell. J Dent. 2021 Jun;109:103673. doi: 10.1016/j.jdent.2021.103673. Epub 2021 Apr 16.
• [55] MMP-14 and TIMP-2 overexpression protects against hydroquinone-induced oxidant injury in RPE: implications for extracellular matrix turnover. Invest Ophthalmol Vis Sci. 2007 Dec;48(12):5662-70. doi: 10.1167/iovs.07-0392.
• [56] Effects of chronic rosiglitazone therapy on gene expression in human adipose tissue in vivo in patients with type 2 diabetes. J Clin Endocrinol Metab. 2007 Feb;92(2):720-4.
• [57] Antirheumatic drug response signatures in human chondrocytes: potential molecular targets to stimulate cartilage regeneration. Arthritis Res Ther. 2009;11(1):R15.
• [58] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [59] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [60] Identification of selective inhibitors of cancer stem cells by high-throughput screening. Cell. 2009 Aug 21;138(4):645-659. doi: 10.1016/j.cell.2009.06.034. Epub 2009 Aug 13.
• [61] Inhibition of systemic sclerosis dermal fibroblast type I collagen production and gene expression by simvastatin. Arthritis Rheum. 2006 Apr;54(4):1298-308. doi: 10.1002/art.21723.
• [62] Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
• [63] Beta-carotene and apocarotenals promote retinoid signaling in BEAS-2B human bronchioepithelial cells. Arch Biochem Biophys. 2006 Nov 1;455(1):48-60.
• [64] Interleukin-1 beta and phenytoin reduce alpha 1 (I) procollagen mRNA expression in human gingival fibroblasts. J Periodontal Res. 1996 Nov;31(8):563-9. doi: 10.1111/j.1600-0765.1996.tb00521.x.
• [65] Ascorbic acid induces collagenase-1 in human periodontal ligament cells but not in MC3T3-E1 osteoblast-like cells: potential association between collagenase expression and changes in alkaline phosphatase phenotype. J Bone Miner Res. 2003 Jan;18(1):67-77. doi: 10.1359/jbmr.2003.18.1.67.
• [66] The effects of particulate wear debris, cytokines, and growth factors on the functions of MG-63 osteoblasts. J Bone Joint Surg Am. 2001 Feb;83(2):201-11. doi: 10.2106/00004623-200102000-00007.
• [67] Effects of olanzapine on serum protein phosphorylation patterns in patients with schizophrenia. Proteomics Clin Appl. 2015 Oct;9(9-10):907-16. doi: 10.1002/prca.201400148. Epub 2015 May 15.
• [68] Comparison between chondroprotective effects of glucosamine, curcumin, and diacerein in IL-1beta-stimulated C-28/I2 chondrocytes. Osteoarthritis Cartilage. 2008 Oct;16(10):1205-12. doi: 10.1016/j.joca.2008.01.013. Epub 2008 Mar 5.
• [69] Tacrolimus-induced nephrotoxicity in mice is associated with microRNA deregulation. Arch Toxicol. 2018 Apr;92(4):1539-1550. doi: 10.1007/s00204-018-2158-3. Epub 2018 Jan 23.
• [70] Neoplastic-like transformation effect of single-walled and multi-walled carbon nanotubes compared to asbestos on human lung small airway epithelial cells. Nanotoxicology. 2014 Aug;8(5):485-507.
• [71] Patterns of some extracellular matrix gene expression are similar in cells from cleft lip-palate patients and in human palatal fibroblasts exposed to diazepam in culture. Toxicology. 2009 Mar 4;257(1-2):10-6. doi: 10.1016/j.tox.2008.12.002. Epub 2008 Dec 9.
• [72] Sensitivity of human dental pulp cells to eighteen chemical agents used for endodontic treatments in dentistry. Odontology. 2013 Jan;101(1):43-51.
• [73] Hydralazine inhibits human peritoneal mesothelial cell proliferation and collagen synthesis. Nephrol Dial Transplant. 1996 Nov;11(11):2276-81. doi: 10.1093/oxfordjournals.ndt.a027148.
• [74] S-adenosylmethionine blocks collagen I production by preventing transforming growth factor-beta induction of the COL1A2 promoter. J Biol Chem. 2005 Sep 2;280(35):30963-74. doi: 10.1074/jbc.M503569200. Epub 2005 Jun 27.
• [75] Acinar cell-specific knockout of the PTHrP gene decreases the proinflammatory and profibrotic responses in pancreatitis. Am J Physiol Gastrointest Liver Physiol. 2014 Sep 1;307(5):G533-49. doi: 10.1152/ajpgi.00428.2013. Epub 2014 Jul 17.
• [76] Berberine promotes bone marrow-derived mesenchymal stem cells osteogenic differentiation via canonical Wnt/-catenin signaling pathway. Toxicol Lett. 2016 Jan 5;240(1):68-80. doi: 10.1016/j.toxlet.2015.10.007. Epub 2015 Oct 22.
• [77] Soy isoflavones alter expression of genes associated with cancer progression, including interleukin-8, in androgen-independent PC-3 human prostate cancer cells. J Nutr. 2006 Jan;136(1):75-82.
• [78] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [79] Resveratrol inhibits fibrogenesis and induces apoptosis in keloid fibroblasts. Wound Repair Regen. 2013 Jul-Aug;21(4):616-23. doi: 10.1111/wrr.12062.
• [80] Examining the genomic influence of skin antioxidants in vitro. Mediators Inflamm. 2010;2010.
• [81] Copper deprivation enhances the chemosensitivity of pancreatic cancer to rapamycin by mTORC1/2 inhibition. Chem Biol Interact. 2023 Sep 1;382:110546. doi: 10.1016/j.cbi.2023.110546. Epub 2023 Jun 7.
• [82] Simvastatin and atorvastatin enhance gene expression of collagen type 1 and osteocalcin in primary human osteoblasts and MG-63 cultures. J Cell Biochem. 2007 Aug 15;101(6):1430-8. doi: 10.1002/jcb.21259.
• [83] Natural product andrographolide alleviated APAP-induced liver fibrosis by activating Nrf2 antioxidant pathway. Toxicology. 2018 Mar 1;396-397:1-12.
• [84] A high concentration of genistein down-regulates activin A, Smad3 and other TGF-beta pathway genes in human uterine leiomyoma cells. Exp Mol Med. 2012 Apr 30;44(4):281-92.
• [85] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [86] BRD4 is a novel therapeutic target for liver fibrosis. Proc Natl Acad Sci U S A. 2015 Dec 22;112(51):15713-8. doi: 10.1073/pnas.1522163112. Epub 2015 Dec 7.
• [87] Nrf2 knockdown attenuates the ameliorative effects of ligustrazine on hepatic fibrosis by targeting hepatic stellate cell transdifferentiation. Toxicology. 2016 Jul 15;365:35-47. doi: 10.1016/j.tox.2016.07.018. Epub 2016 Jul 28.
• [88] The excitotoxity of NMDA receptor NR2D subtype mediates human fetal lung fibroblasts proliferation and collagen production. Toxicol In Vitro. 2018 Feb;46:47-57. doi: 10.1016/j.tiv.2017.10.008. Epub 2017 Oct 5.
• [89] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [90] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [91] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [92] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [93] Methylparaben-induced decrease in collagen production and viability of cultured human dermal fibroblasts. J Appl Toxicol. 2017 Sep;37(9):1117-1124. doi: 10.1002/jat.3466. Epub 2017 Apr 6.
• [94] Paraquat increases connective tissue growth factor and collagen expression via angiotensin signaling pathway in human lung fibroblasts. Toxicol In Vitro. 2010 Apr;24(3):803-8. doi: 10.1016/j.tiv.2009.12.015. Epub 2009 Dec 24.
• [95] Phytic acid improves osteogenesis and inhibits the senescence of human bone marrow mesenchymal stem cells under high-glucose conditions via the ERK pathway. Chem Biol Interact. 2024 Jan 5;387:110818. doi: 10.1016/j.cbi.2023.110818. Epub 2023 Nov 22.
• [96] 4-Hydroxynonenal as a selective pro-fibrogenic stimulus for activated human hepatic stellate cells. J Hepatol. 2004 Jan;40(1):60-8. doi: 10.1016/s0168-8278(03)00480-x.
• [97] Sorafenib reduces steatosis-induced fibrogenesis in a human 3D co-culture model of non-alcoholic fatty liver disease. Environ Toxicol. 2021 Feb;36(2):168-176. doi: 10.1002/tox.23021. Epub 2020 Sep 12.
• [98] Long-term acetaminophen treatment induced liver fibrosis in mice and the involvement of Egr-1. Toxicology. 2017 May 1;382:47-58. doi: 10.1016/j.tox.2017.03.008. Epub 2017 Mar 9.
• [99] Functional and mechanistic investigation of Shikonin in scarring. Chem Biol Interact. 2015 Feb 25;228:18-27. doi: 10.1016/j.cbi.2014.12.037. Epub 2015 Jan 12.
• [100] 20-Hydroxytetraenoic acid induces hepatic fibrosis via the TGF-1/Smad3 signaling pathway. Toxicol Lett. 2023 Jan 15;373:1-12. doi: 10.1016/j.toxlet.2022.11.001. Epub 2022 Nov 9.
• [101] Alpha ketoglutarate exerts a pro-osteogenic effect in osteoblast cell lines through activation of JNK and mTOR/S6K1/S6 signaling pathways. Toxicol Appl Pharmacol. 2019 Jul 1;374:53-64.
• [102] In vitro and ex vivo anti-fibrotic effects of LY2109761, a small molecule inhibitor against TGF-. Toxicol Appl Pharmacol. 2018 Sep 15;355:127-137. doi: 10.1016/j.taap.2018.07.001. Epub 2018 Jul 3.
• [103] Gap junction communications influence upon fibroblast synthesis of Type I collagen and fibronectin. J Cell Biochem. 2006 Jul 1;98(4):735-43. doi: 10.1002/jcb.20852.
• [104] Cytotoxic activity of guaiazulene on gingival fibroblasts and the influence of light exposure on guaiazulene-induced cell death. Toxicol In Vitro. 2011 Feb;25(1):64-72. doi: 10.1016/j.tiv.2010.09.008. Epub 2010 Sep 18.
• [105] Tumor necrosis factor-alpha-induced protein 3 as a putative regulator of nuclear factor-kappaB-mediated resistance to O6-alkylating agents in human glioblastomas. J Clin Oncol. 2006 Jan 10;24(2):274-87. doi: 10.1200/JCO.2005.02.9405. Epub 2005 Dec 19.
• [106] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.