Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPXHRKU)

• DOT Name: Pentraxin-related protein PTX3 (PTX3)
• Synonyms: Pentaxin-related protein PTX3; Tumor necrosis factor alpha-induced protein 5; TNF alpha-induced protein 5; Tumor necrosis factor-inducible gene 14 protein; TSG-14
• Gene Name: PTX3
• Related Disease:
  Chronic renal failure
  Esophageal squamous cell carcinoma
  Non-insulin dependent diabetes
  Systemic lupus erythematosus
  Vascular disease
  Acute coronary syndrome
  Age-related macular degeneration
  Arteriosclerosis
  Atherosclerosis
  Breast carcinoma
  Cardiac failure
  Cardiovascular disease
  Chronic kidney disease
  Chronic obstructive pulmonary disease
  Classic Hodgkin lymphoma
  Colorectal carcinoma
  Congestive heart failure
  Coronary atherosclerosis
  Fetal growth restriction
  Glioma
  Hepatocellular carcinoma
  High blood pressure
  Huntington disease
  Invasive aspergillosis
  Invasive pulmonary aspergillosis
  Liver cirrhosis
  Major depressive disorder
  Metastatic malignant neoplasm
  Migraine disorder
  Myocardial infarction
  Obesity
  Periodontitis
  Pulmonary fibrosis
  Skin disease
  Systemic sclerosis
  Type-1/2 diabetes
  Vasculitis
  Acute myocardial infarction
  Autoimmune disease
  Head-neck squamous cell carcinoma
  Lupus nephritis
  Ankylosing spondylitis
  Arthritis
  Diabetic kidney disease
  Bacterial infection
  Breast cancer
  Cervical carcinoma
  Melanoma
• UniProt ID: PTX3_HUMAN
• PDB ID: 7ZL1
• Pfam ID: PF00354
• Sequence:
  MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCACGQEHSEWDKLF
  IMLENSQMRERMLLQATDDVLRGELQRLREELGRLAESLARPCAPGAPAEARLTSALDEL
  LQATRDAGRRLARMEGAEAQRPEEAGRALAAVLEELRQTRADLHAVQGWAARSWLPAGCE
  TAILFPMRSKKIFGSVHPVRPMRLESFSACIWVKATDVLNKTILFSYGTKRNPYEIQLYL
  SYQSIVFVVGGEENKLVAEAMVSLGRWTHLCGTWNSEEGLTSLWVNGELAATTVEMATGH
  IVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIR
  GNIVGWGVTEIQPHGGAQYVS
• Function: Plays a role in the regulation of innate resistance to pathogens, inflammatory reactions, possibly clearance of self-components and female fertility.
• Reactome Pathway: Neutrophil degranulation (R-HSA-6798695)

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Chronic renal failure	DISGG7K6	Definitive	Biomarker	[1]
Esophageal squamous cell carcinoma	DIS5N2GV	Definitive	Altered Expression	[2]
Non-insulin dependent diabetes	DISK1O5Z	Definitive	Biomarker	[3]
Systemic lupus erythematosus	DISI1SZ7	Definitive	Biomarker	[4]
Vascular disease	DISVS67S	Definitive	Biomarker	[5]
Acute coronary syndrome	DIS7DYEW	Strong	Altered Expression	[6]
Age-related macular degeneration	DIS0XS2C	Strong	Altered Expression	[7]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[8]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[8]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[9]
Cardiac failure	DISDC067	Strong	Biomarker	[10]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[11]
Chronic kidney disease	DISW82R7	Strong	Biomarker	[12]
Chronic obstructive pulmonary disease	DISQCIRF	Strong	Biomarker	[13]
Classic Hodgkin lymphoma	DISV1LU6	Strong	Biomarker	[14]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[15]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[10]
Coronary atherosclerosis	DISKNDYU	Strong	Biomarker	[16]
Fetal growth restriction	DIS5WEJ5	Strong	Altered Expression	[17]
Glioma	DIS5RPEH	Strong	Biomarker	[18]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[19]
High blood pressure	DISY2OHH	Strong	Altered Expression	[20]
Huntington disease	DISQPLA4	Strong	Biomarker	[14]
Invasive aspergillosis	DISAI029	Strong	Genetic Variation	[21]
Invasive pulmonary aspergillosis	DISIZ0VJ	Strong	Biomarker	[22]
Liver cirrhosis	DIS4G1GX	Strong	Altered Expression	[23]
Major depressive disorder	DIS4CL3X	Strong	Biomarker	[24]
Metastatic malignant neoplasm	DIS86UK6	Strong	Altered Expression	[19]
Migraine disorder	DISFCQTG	Strong	Altered Expression	[25]
Myocardial infarction	DIS655KI	Strong	Biomarker	[6]
Obesity	DIS47Y1K	Strong	Biomarker	[26]
Periodontitis	DISI9JOI	Strong	Altered Expression	[27]
Pulmonary fibrosis	DISQKVLA	Strong	Biomarker	[28]
Skin disease	DISDW8R6	Strong	Biomarker	[29]
Systemic sclerosis	DISF44L6	Strong	Altered Expression	[30]
Type-1/2 diabetes	DISIUHAP	Strong	Altered Expression	[5]
Vasculitis	DISQRKDX	Strong	Altered Expression	[31]
Acute myocardial infarction	DISE3HTG	moderate	Altered Expression	[32]
Autoimmune disease	DISORMTM	moderate	Biomarker	[33]
Head-neck squamous cell carcinoma	DISF7P24	moderate	Biomarker	[34]
Lupus nephritis	DISCVGPZ	moderate	Biomarker	[4]
Ankylosing spondylitis	DISRC6IR	Disputed	Altered Expression	[35]
Arthritis	DIST1YEL	Disputed	Biomarker	[36]
Diabetic kidney disease	DISJMWEY	Disputed	Biomarker	[37]
Bacterial infection	DIS5QJ9S	Limited	Biomarker	[38]
Breast cancer	DIS7DPX1	Limited	Biomarker	[9]
Cervical carcinoma	DIST4S00	Limited	Altered Expression	[39]
Melanoma	DIS1RRCY	Limited	Biomarker	[40]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Topotecan	DMP6G8T	Approved	Pentraxin-related protein PTX3 (PTX3) affects the response to substance of Topotecan.	[71]
Vinblastine	DM5TVS3	Approved	Pentraxin-related protein PTX3 (PTX3) affects the response to substance of Vinblastine.	[71]

32 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Pentraxin-related protein PTX3 (PTX3).	[41]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Pentraxin-related protein PTX3 (PTX3).	[42]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Pentraxin-related protein PTX3 (PTX3).	[43]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Pentraxin-related protein PTX3 (PTX3).	[44]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Pentraxin-related protein PTX3 (PTX3).	[45]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Pentraxin-related protein PTX3 (PTX3).	[46]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of Pentraxin-related protein PTX3 (PTX3).	[29]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Pentraxin-related protein PTX3 (PTX3).	[48]
Selenium	DM25CGV	Approved	Selenium increases the expression of Pentraxin-related protein PTX3 (PTX3).	[49]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Pentraxin-related protein PTX3 (PTX3).	[50]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Pentraxin-related protein PTX3 (PTX3).	[51]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of Pentraxin-related protein PTX3 (PTX3).	[52]
Nicotine	DMWX5CO	Approved	Nicotine decreases the expression of Pentraxin-related protein PTX3 (PTX3).	[53]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Pentraxin-related protein PTX3 (PTX3).	[54]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Pentraxin-related protein PTX3 (PTX3).	[55]
Isoflavone	DM7U58J	Phase 4	Isoflavone affects the expression of Pentraxin-related protein PTX3 (PTX3).	[56]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Pentraxin-related protein PTX3 (PTX3).	[57]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of Pentraxin-related protein PTX3 (PTX3).	[57]
GSK2110183	DMZHB37	Phase 2	GSK2110183 decreases the expression of Pentraxin-related protein PTX3 (PTX3).	[58]
PD-0325901	DM27D4J	Phase 2	PD-0325901 decreases the expression of Pentraxin-related protein PTX3 (PTX3).	[59]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Pentraxin-related protein PTX3 (PTX3).	[53]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Pentraxin-related protein PTX3 (PTX3).	[60]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Pentraxin-related protein PTX3 (PTX3).	[61]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Pentraxin-related protein PTX3 (PTX3).	[62]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Pentraxin-related protein PTX3 (PTX3).	[63]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Pentraxin-related protein PTX3 (PTX3).	[64]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate decreases the expression of Pentraxin-related protein PTX3 (PTX3).	[65]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid increases the expression of Pentraxin-related protein PTX3 (PTX3).	[66]
Lithium chloride	DMHYLQ2	Investigative	Lithium chloride decreases the expression of Pentraxin-related protein PTX3 (PTX3).	[67]
Manganese	DMKT129	Investigative	Manganese increases the expression of Pentraxin-related protein PTX3 (PTX3).	[68]
crotylaldehyde	DMTWRQI	Investigative	crotylaldehyde decreases the expression of Pentraxin-related protein PTX3 (PTX3).	[69]
Nitrobenzanthrone	DMN6L70	Investigative	Nitrobenzanthrone increases the expression of Pentraxin-related protein PTX3 (PTX3).	[70]

References

• [1] Long Pentraxin 3 as a Broader Biomarker for Multiple Risk Factors in End-Stage Renal Disease: Association with All-Cause Mortality.Mediators Inflamm. 2019 Jun 16;2019:3295725. doi: 10.1155/2019/3295725. eCollection 2019.
• [2] Inhibitory Role of Pentraxin-3 in Esophageal Squamous Cell Carcinoma.Chin Med J (Engl). 2016 Sep 20;129(18):2233-40. doi: 10.4103/0366-6999.189921.
• [3] The association study of high-sensitivity C-reactive protein, pentraxin 3, nitrotyrosine, and insulin dose in patients with insulin-treated type 2 diabetes mellitus.Ther Clin Risk Manag. 2018 May 28;14:955-963. doi: 10.2147/TCRM.S162086. eCollection 2018.
• [4] Circulating Pentraxin3-Specific B Cells Are Decreased in Lupus Nephritis.Front Immunol. 2019 Jan 25;10:29. doi: 10.3389/fimmu.2019.00029. eCollection 2019.
• [5] Circulating pentraxin 3 is positively associated with chronic hyperglycemia but negatively associated with plasma aldosterone concentration.PLoS One. 2018 May 1;13(5):e0196526. doi: 10.1371/journal.pone.0196526. eCollection 2018.
• [6] Pentraxin-3 vs C-reactive protein and other prognostic biomarkers in acute coronary syndrome: A substudy of the Platelet Inhibition and Patients Outcomes (PLATO) trial.Eur Heart J Acute Cardiovasc Care. 2020 Jun;9(4):313-322. doi: 10.1177/2048872619846334. Epub 2019 Apr 24.
• [7] Oxidative Stress-Induced Pentraxin 3 Expression Human Retinal Pigment Epithelial Cells is Involved in the Pathogenesis of Age-Related Macular Degeneration.Int J Mol Sci. 2019 Nov 29;20(23):6028. doi: 10.3390/ijms20236028.
• [8] Association of Plasma Pentraxin-3 Level with Lipid Levels and Cardiovascular Risk Factors in People with No History of Lipid-Lowering Medication: the Dong-gu Study.J Atheroscler Thromb. 2019 Aug 1;26(8):738-745. doi: 10.5551/jat.47167. Epub 2019 Jan 23.
• [9] Scorpion Venom Analgesic Peptide, BmK AGAP Inhibits Stemness, and Epithelial-Mesenchymal Transition by Down-Regulating PTX3 in Breast Cancer.Front Oncol. 2019 Jan 25;9:21. doi: 10.3389/fonc.2019.00021. eCollection 2019.
• [10] Assessing inflammation in Chinese subjects with subtypes of heart failure: an observational study of the Chinese PLA Hospital Heart Failure Registry.J Geriatr Cardiol. 2019 Apr;16(4):313-319. doi: 10.11909/j.issn.1671-5411.2019.04.002.
• [11] Changes of serum pentraxin-3 and hypersensitive CRP levels during pregnancy and their relationship with gestational diabetes mellitus.PLoS One. 2019 Nov 13;14(11):e0224739. doi: 10.1371/journal.pone.0224739. eCollection 2019.
• [12] The Long Pentraxin PTX3 Is an Endogenous Inhibitor of Hyperoxaluria-Related Nephrocalcinosis and Chronic Kidney Disease.Front Immunol. 2018 Sep 25;9:2173. doi: 10.3389/fimmu.2018.02173. eCollection 2018.
• [13] Serum levels and gene expression of pentraxin 3 are elevated in COPD.Adv Med Sci. 2019 Mar;64(1):85-89. doi: 10.1016/j.advms.2018.08.006. Epub 2018 Dec 17.
• [14] Inevitable isolation and the change of stress markers in hemodialysis patients during the 2015 MERS-CoV outbreak in Korea.Sci Rep. 2019 Apr 5;9(1):5676. doi: 10.1038/s41598-019-41964-x.
• [15] Increased serum pentraxin-3 level predicts poor prognosis in patients with colorectal cancer after curative surgery, a cohort study.Medicine (Baltimore). 2018 Oct;97(40):e11780. doi: 10.1097/MD.0000000000011780.
• [16] Pentraxin-3 in coronary artery disease: A meta-analysis.Cytokine. 2019 Jul;119:197-201. doi: 10.1016/j.cyto.2019.03.017. Epub 2019 Apr 4.
• [17] The expression of pentraxin 3 and tumor necrosis factor-alpha is increased in preeclamptic placental tissue and maternal serum.Inflamm Res. 2012 Sep;61(9):1005-12. doi: 10.1007/s00011-012-0507-x. Epub 2012 Jun 20.
• [18] Inhibition of pentraxin 3 in glioma cells impairs proliferation and invasion in vitro and in vivo.J Neurooncol. 2016 Sep;129(2):201-9. doi: 10.1007/s11060-016-2168-z. Epub 2016 Jun 9.
• [19] Pentraxin 3 overexpression accelerated tumor metastasis and indicated poor prognosis in hepatocellular carcinoma via driving epithelial-mesenchymal transition.J Cancer. 2018 Jun 23;9(15):2650-2658. doi: 10.7150/jca.25188. eCollection 2018.
• [20] Serum pentraxin-3 levels and flow-mediated dilation in dipper and non-dipper hypertension.J Clin Lab Anal. 2019 Mar;33(3):e22718. doi: 10.1002/jcla.22718. Epub 2018 Nov 9.
• [21] Pentraxin 3 Gene Polymorphisms and Pulmonary Aspergillosis in Chronic Obstructive Pulmonary Disease Patients.Clin Infect Dis. 2018 Jan 6;66(2):261-267. doi: 10.1093/cid/cix749.
• [22] Pentraxin 3 in bronchoalveolar lavage fluid and plasma in non-neutropenic patients with pulmonary aspergillosis.Clin Microbiol Infect. 2019 Apr;25(4):504-510. doi: 10.1016/j.cmi.2018.06.015. Epub 2018 Jun 28.
• [23] Circulating levels of pentraxin-3 (PTX3) in patients with liver cirrhosis.Ann Hepatol. 2017 Sep-Oct;16(5):780-787. doi: 10.5604/01.3001.0010.2789.
• [24] Differential expression of pentraxin 3 in fibroblasts from patients with major depression.Neuropsychopharmacology. 2004 Jan;29(1):126-32. doi: 10.1038/sj.npp.1300307.
• [25] Pentraxin 3 level in acute migraine attack with aura: Patient management in the emergency department.Am J Emerg Med. 2020 Jan;38(1):38-42. doi: 10.1016/j.ajem.2019.04.004. Epub 2019 Apr 4.
• [26] Pentraxin 3 deficiency protects from the metabolic inflammation associated to diet-induced obesity.Cardiovasc Res. 2019 Nov 1;115(13):1861-1872. doi: 10.1093/cvr/cvz068.
• [27] Severe periodontitis is linked with increased peripheral levels of sTWEAK and PTX3 in chronic migraineurs.Clin Oral Investig. 2020 Feb;24(2):597-606. doi: 10.1007/s00784-019-02950-9. Epub 2019 May 20.
• [28] The role of pentraxin-3 as a prognostic biomarker in paraquat poisoning.Toxicol Lett. 2012 Jul 20;212(2):157-60. doi: 10.1016/j.toxlet.2011.12.007. Epub 2011 Dec 22.
• [29] Gene expression profiles in peripheral lymphocytes by arsenic exposure and skin lesion status in a Bangladeshi population. Cancer Epidemiol Biomarkers Prev. 2006 Jul;15(7):1367-75. doi: 10.1158/1055-9965.EPI-06-0106.
• [30] Low serum fibroblast growth factor 2 levels not accompanied by increased serum pentraxin 3 levels in patients with systemic sclerosis.Clin Rheumatol. 2017 Feb;36(2):367-372. doi: 10.1007/s10067-016-3483-7. Epub 2016 Nov 22.
• [31] Study on Serum Pentraxin-3 Levels in Vasculitis with Hypertension.J Interferon Cytokine Res. 2019 Sep;39(9):522-530. doi: 10.1089/jir.2018.0150. Epub 2019 Jul 2.
• [32] Pentraxin 3 in Cardiovascular Disease.Front Immunol. 2019 Apr 17;10:823. doi: 10.3389/fimmu.2019.00823. eCollection 2019.
• [33] Toll-Like Receptor 3 Deficiency Leads to Altered Immune Responses to Chlamydia trachomatis Infection in Human Oviduct Epithelial Cells.Infect Immun. 2019 Sep 19;87(10):e00483-19. doi: 10.1128/IAI.00483-19. Print 2019 Oct.
• [34] Oleate-induced PTX3 promotes head and neck squamous cell carcinoma metastasis through the up-regulation of vimentin.Oncotarget. 2017 Jun 20;8(25):41364-41378. doi: 10.18632/oncotarget.17326.
• [35] Plasma levels of pentraxin 3 in patients with spondyloarthritis.Biomarkers. 2018 Feb;23(1):14-17. doi: 10.1080/1354750X.2016.1278265. Epub 2017 Jan 17.
• [36] The Long Pentraxin 3 Contributes to Joint Inflammation in Gout by Facilitating the Phagocytosis of Monosodium Urate Crystals.J Immunol. 2019 Mar 15;202(6):1807-1814. doi: 10.4049/jimmunol.1701531. Epub 2019 Feb 4.
• [37] Investigation of the Mechanism Underlying Calcium Dobesilate-Mediated Improvement of Endothelial Dysfunction and Inflammation Caused by High Glucose.Mediators Inflamm. 2019 Oct 21;2019:9893682. doi: 10.1155/2019/9893682. eCollection 2019.
• [38] Pseudomonas aeruginosa GroEL Stimulates Production of PTX3 by Activating the NF-B Pathway and Simultaneously Downregulating MicroRNA-9.Infect Immun. 2017 Feb 23;85(3):e00935-16. doi: 10.1128/IAI.00935-16. Print 2017 Mar.
• [39] MicroRNA-224 inhibition prevents progression of cervical carcinoma by targeting PTX3.J Cell Biochem. 2018 Dec;119(12):10278-10290. doi: 10.1002/jcb.27370. Epub 2018 Aug 20.
• [40] Cancer cell-derived long pentraxin 3 (PTX3) promotes melanoma migration through a toll-like receptor 4 (TLR4)/NF-B signaling pathway.Oncogene. 2019 Jul;38(30):5873-5889. doi: 10.1038/s41388-019-0848-9. Epub 2019 Jun 28.
• [41] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [42] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [43] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [44] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [45] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [46] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [47] Gene expression profiles in peripheral lymphocytes by arsenic exposure and skin lesion status in a Bangladeshi population. Cancer Epidemiol Biomarkers Prev. 2006 Jul;15(7):1367-75. doi: 10.1158/1055-9965.EPI-06-0106.
• [48] Arsenic and fluoride induce apoptosis, inflammation and oxidative stress in cultured human umbilical vein endothelial cells. Chemosphere. 2017 Jan;167:454-461. doi: 10.1016/j.chemosphere.2016.10.025. Epub 2016 Oct 14.
• [49] Changes in gene expression profiles in response to selenium supplementation among individuals with arsenic-induced pre-malignant skin lesions. Toxicol Lett. 2007 Mar 8;169(2):162-76. doi: 10.1016/j.toxlet.2007.01.006. Epub 2007 Jan 19.
• [50] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [51] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [52] Synergistic antiproliferative effect of arsenic trioxide combined with bortezomib in HL60 cell line and primary blasts from patients affected by myeloproliferative disorders. Cancer Genet Cytogenet. 2010 Jun;199(2):110-20. doi: 10.1016/j.cancergencyto.2010.02.010.
• [53] Effects of tobacco compounds on gene expression in fetal lung fibroblasts. Environ Toxicol. 2008 Aug;23(4):423-34.
• [54] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [55] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [56] Soy isoflavones alter expression of genes associated with cancer progression, including interleukin-8, in androgen-independent PC-3 human prostate cancer cells. J Nutr. 2006 Jan;136(1):75-82.
• [57] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [58] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [59] PRC2 loss amplifies Ras-driven transcription and confers sensitivity to BRD4-based therapies. Nature. 2014 Oct 9;514(7521):247-51.
• [60] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [61] Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
• [62] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [63] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.
• [64] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [65] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [66] Roles of acyl-CoA synthetase long-chain family member 5 and colony stimulating factor 2 in inhibition of palmitic or stearic acids in lung cancer cell proliferation and metabolism. Cell Biol Toxicol. 2021 Feb;37(1):15-34. doi: 10.1007/s10565-020-09520-w. Epub 2020 Apr 28.
• [67] Effects of lithium and valproic acid on gene expression and phenotypic markers in an NT2 neurosphere model of neural development. PLoS One. 2013;8(3):e58822.
• [68] Gene expression profiling of human primary astrocytes exposed to manganese chloride indicates selective effects on several functions of the cells. Neurotoxicology. 2007 May;28(3):478-89.
• [69] Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.
• [70] 3-Nitrobenzanthrone promotes malignant transformation in human lung epithelial cells through the epiregulin-signaling pathway. Cell Biol Toxicol. 2022 Oct;38(5):865-887. doi: 10.1007/s10565-021-09612-1. Epub 2021 May 25.
• [71] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.