Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQY9S7F)

• DOT Name: Krueppel-like factor 6 (KLF6)
• Synonyms: B-cell-derived protein 1; Core promoter element-binding protein; GC-rich sites-binding factor GBF; Proto-oncogene BCD1; Suppressor of tumorigenicity 12 protein; Transcription factor Zf9
• Gene Name: KLF6
• Related Disease:
  Prostate adenocarcinoma
  Adenocarcinoma
  Astrocytoma
  Bone osteosarcoma
  Brain neoplasm
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Colon cancer
  Colorectal neoplasm
  Epithelial ovarian cancer
  Fatty liver disease
  Gastric cancer
  Gastric neoplasm
  Glioblastoma multiforme
  Glioma
  Hepatocellular carcinoma
  Keratoconus
  Lung cancer
  Lung carcinoma
  Melanoma
  Migraine disorder
  Nasopharyngeal carcinoma
  Non-alcoholic fatty liver disease
  Non-small-cell lung cancer
  Osteosarcoma
  Ovarian cancer
  Ovarian neoplasm
  Plasma cell myeloma
  Post-traumatic stress disorder
  Schizophrenia
  Stomach cancer
  Type-1/2 diabetes
  Carcinoma
  Diabetic kidney disease
  Familial prostate carcinoma
  Lung adenocarcinoma
  Renal carcinoma
  Renal cell carcinoma
  Acute myelogenous leukaemia
  Adult glioblastoma
  Clear cell renal carcinoma
  Head-neck squamous cell carcinoma
  Hepatitis C virus infection
  Prostate neoplasm
  Retinoblastoma
  Small lymphocytic lymphoma
• UniProt ID: KLF6_HUMAN
• Pfam ID: PF00096
• Sequence:
  MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQ
  EDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELS
  PTAKFTSDPIGEVLVSSGKLSSSVTSTPPSSPELSREPSQLWGCVPGELPSPGKVRSGTS
  GKPGDKGNGDASPDGRRRVHRCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWR
  FARSDELTRHFRKHTGAKPFKCSHCDRCFSRSDHLALHMKRHL
• Function: Transcriptional activator. Binds a GC box motif. Could play a role in B-cell growth and development.
• Tissue Specificity: Highly expressed in placenta followed by spleen, thymus, prostate, testis, small intestine and colon. Weakly expressed in pancreas, lung, liver, heart and skeletal muscle. Also expressed in fetal brain, spleen and thymus.

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Prostate adenocarcinoma	DISBZYU8	Definitive	Biomarker	[1]
Adenocarcinoma	DIS3IHTY	Strong	Biomarker	[2]
Astrocytoma	DISL3V18	Strong	Genetic Variation	[3]
Bone osteosarcoma	DIST1004	Strong	Biomarker	[4]
Brain neoplasm	DISY3EKS	Strong	Altered Expression	[5]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[6]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[6]
Breast neoplasm	DISNGJLM	Strong	Genetic Variation	[6]
Colon cancer	DISVC52G	Strong	Biomarker	[7]
Colorectal neoplasm	DISR1UCN	Strong	Genetic Variation	[8]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[9]
Fatty liver disease	DIS485QZ	Strong	Biomarker	[10]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[11]
Gastric neoplasm	DISOKN4Y	Strong	Genetic Variation	[12]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[13]
Glioma	DIS5RPEH	Strong	Biomarker	[5]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[14]
Keratoconus	DISOONXH	Strong	Altered Expression	[15]
Lung cancer	DISCM4YA	Strong	Altered Expression	[16]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[16]
Melanoma	DIS1RRCY	Strong	Biomarker	[17]
Migraine disorder	DISFCQTG	Strong	Biomarker	[18]
Nasopharyngeal carcinoma	DISAOTQ0	Strong	Biomarker	[19]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Biomarker	[20]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[21]
Osteosarcoma	DISLQ7E2	Strong	Biomarker	[4]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[9]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[9]
Plasma cell myeloma	DIS0DFZ0	Strong	Genetic Variation	[22]
Post-traumatic stress disorder	DISHL1EY	Strong	Biomarker	[23]
Schizophrenia	DISSRV2N	Strong	Biomarker	[24]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[11]
Type-1/2 diabetes	DISIUHAP	Strong	Altered Expression	[25]
Carcinoma	DISH9F1N	moderate	Altered Expression	[26]
Diabetic kidney disease	DISJMWEY	moderate	Altered Expression	[27]
Familial prostate carcinoma	DISL9KNO	moderate	Genetic Variation	[28]
Lung adenocarcinoma	DISD51WR	moderate	Biomarker	[29]
Renal carcinoma	DISER9XT	moderate	Biomarker	[30]
Renal cell carcinoma	DISQZ2X8	moderate	Biomarker	[30]
Acute myelogenous leukaemia	DISCSPTN	Limited	Altered Expression	[31]
Adult glioblastoma	DISVP4LU	Limited	Biomarker	[13]
Clear cell renal carcinoma	DISBXRFJ	Limited	Altered Expression	[30]
Head-neck squamous cell carcinoma	DISF7P24	Limited	Biomarker	[32]
Hepatitis C virus infection	DISQ0M8R	Limited	Biomarker	[33]
Prostate neoplasm	DISHDKGQ	Limited	Altered Expression	[34]
Retinoblastoma	DISVPNPB	Limited	Altered Expression	[35]
Small lymphocytic lymphoma	DIS30POX	Limited	Altered Expression	[22]

50 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Krueppel-like factor 6 (KLF6).	[36]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Krueppel-like factor 6 (KLF6).	[37]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Krueppel-like factor 6 (KLF6).	[38]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Krueppel-like factor 6 (KLF6).	[39]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Krueppel-like factor 6 (KLF6).	[40]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Krueppel-like factor 6 (KLF6).	[41]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Krueppel-like factor 6 (KLF6).	[42]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Krueppel-like factor 6 (KLF6).	[43]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Krueppel-like factor 6 (KLF6).	[44]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Krueppel-like factor 6 (KLF6).	[45]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Krueppel-like factor 6 (KLF6).	[46]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Krueppel-like factor 6 (KLF6).	[47]
Selenium	DM25CGV	Approved	Selenium increases the expression of Krueppel-like factor 6 (KLF6).	[48]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Krueppel-like factor 6 (KLF6).	[49]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Krueppel-like factor 6 (KLF6).	[50]
Menadione	DMSJDTY	Approved	Menadione increases the expression of Krueppel-like factor 6 (KLF6).	[44]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Krueppel-like factor 6 (KLF6).	[39]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Krueppel-like factor 6 (KLF6).	[51]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Krueppel-like factor 6 (KLF6).	[52]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Krueppel-like factor 6 (KLF6).	[53]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of Krueppel-like factor 6 (KLF6).	[54]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of Krueppel-like factor 6 (KLF6).	[55]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Krueppel-like factor 6 (KLF6).	[56]
Etoposide	DMNH3PG	Approved	Etoposide decreases the expression of Krueppel-like factor 6 (KLF6).	[57]
Mitomycin	DMH0ZJE	Approved	Mitomycin decreases the expression of Krueppel-like factor 6 (KLF6).	[57]
Azacitidine	DMTA5OE	Approved	Azacitidine increases the expression of Krueppel-like factor 6 (KLF6).	[58]
Simvastatin	DM30SGU	Approved	Simvastatin increases the expression of Krueppel-like factor 6 (KLF6).	[59]
Colchicine	DM2POTE	Approved	Colchicine increases the expression of Krueppel-like factor 6 (KLF6).	[57]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Krueppel-like factor 6 (KLF6).	[60]
Curcumin	DMQPH29	Phase 3	Curcumin increases the expression of Krueppel-like factor 6 (KLF6).	[61]
Rigosertib	DMOSTXF	Phase 3	Rigosertib increases the expression of Krueppel-like factor 6 (KLF6).	[62]
Phenol	DM1QSM3	Phase 2/3	Phenol increases the expression of Krueppel-like factor 6 (KLF6).	[63]
DNCB	DMDTVYC	Phase 2	DNCB increases the expression of Krueppel-like factor 6 (KLF6).	[64]
Lithium	DMZ3OU6	Phase 2	Lithium affects the expression of Krueppel-like factor 6 (KLF6).	[65]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Krueppel-like factor 6 (KLF6).	[66]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Krueppel-like factor 6 (KLF6).	[67]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Krueppel-like factor 6 (KLF6).	[68]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of Krueppel-like factor 6 (KLF6).	[70]
MG-132	DMKA2YS	Preclinical	MG-132 increases the expression of Krueppel-like factor 6 (KLF6).	[71]
Wortmannin	DM8EVK5	Terminated	Wortmannin decreases the expression of Krueppel-like factor 6 (KLF6).	[44]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Krueppel-like factor 6 (KLF6).	[72]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Krueppel-like factor 6 (KLF6).	[73]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Krueppel-like factor 6 (KLF6).	[74]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Krueppel-like factor 6 (KLF6).	[42]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Krueppel-like factor 6 (KLF6).	[75]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Krueppel-like factor 6 (KLF6).	[63]
geraniol	DMS3CBD	Investigative	geraniol increases the expression of Krueppel-like factor 6 (KLF6).	[76]
Arachidonic acid	DMUOQZD	Investigative	Arachidonic acid increases the expression of Krueppel-like factor 6 (KLF6).	[44]
PD98059	DMZC90M	Investigative	PD98059 decreases the expression of Krueppel-like factor 6 (KLF6).	[44]
2,6-Dihydroanthra/1,9-Cd/Pyrazol-6-One	DMDN12L	Investigative	2,6-Dihydroanthra/1,9-Cd/Pyrazol-6-One decreases the expression of Krueppel-like factor 6 (KLF6).	[44]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Krueppel-like factor 6 (KLF6).	[69]

References

• [1] Tumor suppression and apoptosis of human prostate carcinoma mediated by a genetic locus within human chromosome 10pter-q11.Proc Natl Acad Sci U S A. 1996 Mar 19;93(6):2551-6. doi: 10.1073/pnas.93.6.2551.
• [2] PACAP and PAC1 receptor expression in pancreatic ductal carcinoma.Oncol Lett. 2019 Dec;18(6):5725-5730. doi: 10.3892/ol.2019.10971. Epub 2019 Oct 8.
• [3] Absence of mutation in the putative tumor-suppressor gene KLF6 in colorectal cancers.Oncogene. 2005 Nov 3;24(48):7253-6. doi: 10.1038/sj.onc.1208867.
• [4] Effects of Kruppel-like factor 6 on osteosarcoma cell biological behavior.Tumour Biol. 2013 Apr;34(2):1097-105. doi: 10.1007/s13277-013-0651-0. Epub 2013 Jan 16.
• [5] Immunohistochemical Characterization of Procaspase-3 Overexpression as a Druggable Target With PAC-1, a Procaspase-3 Activator, in Canine and Human Brain Cancers.Front Oncol. 2019 Feb 25;9:96. doi: 10.3389/fonc.2019.00096. eCollection 2019.
• [6] Mutations and Krppel-like factor 6 (KLF6) expression levels in breast cancer.Tumour Biol. 2014 Jun;35(6):5219-25. doi: 10.1007/s13277-014-1678-6. Epub 2014 Feb 12.
• [7] Differential coupling of the PAC1 SV1 splice variant on human colonic tumors to the activation of intracellular cAMP but not intracellular Ca2+ does not activate tumor proliferation.J Mol Neurosci. 2004;22(1-2):83-92. doi: 10.1385/JMN:22:1-2:83.
• [8] Involvement of Kruppel-like factor 6 (KLF6) mutation in the development of nonpolypoid colorectal carcinoma.World J Gastroenterol. 2007 Aug 7;13(29):3932-8. doi: 10.3748/wjg.v13.i29.3932.
• [9] Long non-coding RNA OR3A4 promotes metastasis of ovarian cancer via inhibiting KLF6.Eur Rev Med Pharmacol Sci. 2019 Mar;23(6):2360-2365. doi: 10.26355/eurrev_201903_17380.
• [10] Post-transcriptional activation of PPAR alpha by KLF6 in hepatic steatosis.J Hepatol. 2013 May;58(5):1000-6. doi: 10.1016/j.jhep.2013.01.020. Epub 2013 Jan 23.
• [11] MicroRNA?8b acts as an oncogene in gastric cancer by directly targeting Kruppellike factor 6.Mol Med Rep. 2019 Mar;19(3):1926-1934. doi: 10.3892/mmr.2019.9830. Epub 2019 Jan 8.
• [12] Genetic alterations of the KLF6 gene in gastric cancer.Oncogene. 2005 Jun 30;24(28):4588-90. doi: 10.1038/sj.onc.1208670.
• [13] KLF6 depletion promotes NF-B signaling in glioblastoma.Oncogene. 2017 Jun 22;36(25):3562-3575. doi: 10.1038/onc.2016.507. Epub 2017 Feb 6.
• [14] Krppel-like factor 6 is a transcriptional activator of autophagy in acute liver injury.Sci Rep. 2017 Aug 14;7(1):8119. doi: 10.1038/s41598-017-08680-w.
• [15] Expression of Sp1 and KLF6 in the developing human cornea.Mol Vis. 2007 Aug 27;13:1451-7.
• [16] Krppel like factor 6 splice variant 1 (KLF6-SV1) overexpression recruits macrophages to participate in lung cancer metastasis by up-regulating TWIST1.Cancer Biol Ther. 2019;20(5):680-691. doi: 10.1080/15384047.2018.1550570. Epub 2018 Dec 27.
• [17] KLF6 Gene and early melanoma development in a collagen I-rich extracellular environment.J Natl Cancer Inst. 2010 Aug 4;102(15):1131-47. doi: 10.1093/jnci/djq218. Epub 2010 Jul 21.
• [18] Dynamic changes in CGRP, PACAP, and PACAP receptors in the trigeminovascular system of a novel repetitive electrical stimulation rat model: Relevant to migraine.Mol Pain. 2019 Jan-Dec;15:1744806918820452. doi: 10.1177/1744806918820452.
• [19] Overexpression of the Oncogenic Variant (KLF6-SV1) in Young NPC Patients and Correlation with Lack of E-Cadherin.Anal Cell Pathol (Amst). 2018 Apr 19;2018:9654067. doi: 10.1155/2018/9654067. eCollection 2018.
• [20] Genetic inactivation of the LIGHT (TNFSF14) cytokine in mice restores glucose homeostasis and diminishes hepatic steatosis.Diabetologia. 2019 Nov;62(11):2143-2157. doi: 10.1007/s00125-019-4962-6. Epub 2019 Aug 6.
• [21] The KLF6 splice variant KLF6-SV1 promotes proliferation and invasion of non-small cell lung cancer by up-regultating PI3K-AKT signaling pathway.J Cancer. 2019 Aug 29;10(22):5324-5331. doi: 10.7150/jca.34212. eCollection 2019.
• [22] Autologous T cells expressing the oncogenic transcription factor KLF6-SV1 prevent apoptosis of chronic lymphocytic leukemia cells.PLoS One. 2018 Feb 12;13(2):e0192839. doi: 10.1371/journal.pone.0192839. eCollection 2018.
• [23] Neural Mechanism of a Sex-Specific Risk Variant for Posttraumatic Stress Disorder in the Type I Receptor of the Pituitary Adenylate Cyclase Activating Polypeptide.Biol Psychiatry. 2015 Dec 15;78(12):840-7. doi: 10.1016/j.biopsych.2014.12.018. Epub 2015 Jan 9.
• [24] PACAP Protects Adult Neural Stem Cells from the Neurotoxic Effect of Ketamine Associated with Decreased Apoptosis, ER Stress and mTOR Pathway Activation.PLoS One. 2017 Jan 26;12(1):e0170496. doi: 10.1371/journal.pone.0170496. eCollection 2017.
• [25] The roles of Kruppel-like factor 6 and peroxisome proliferator-activated receptor- in the regulation of macrophage inflammatory protein-3 at early onset of diabetes.Int J Biochem Cell Biol. 2011 Mar;43(3):383-92. doi: 10.1016/j.biocel.2010.11.008. Epub 2010 Nov 23.
• [26] E-cadherin is a novel transcriptional target of the KLF6 tumor suppressor.Oncogene. 2006 Sep 28;25(44):6026-31. doi: 10.1038/sj.onc.1209611. Epub 2006 May 15.
• [27] Podocyte-Specific Loss of Krppel-Like Factor 6 Increases Mitochondrial Injury in Diabetic Kidney Disease.Diabetes. 2018 Nov;67(11):2420-2433. doi: 10.2337/db17-0958. Epub 2018 Aug 16.
• [28] Association between Krppel like factor 6 intervening sequence 1-27 G > A and cancer susceptibility: A meta-analysis.J Cancer Res Ther. 2018 Jun;14(Supplement):S499-S504. doi: 10.4103/0973-1482.174553.
• [29] Targeting the FOXO1/KLF6 axis regulates EGFR signaling and treatment response.J Clin Invest. 2012 Jul;122(7):2637-51. doi: 10.1172/JCI62058. Epub 2012 Jun 1.
• [30] A KLF6-driven transcriptional network links lipid homeostasis and tumour growth in renal carcinoma.Nat Commun. 2019 Mar 11;10(1):1152. doi: 10.1038/s41467-019-09116-x.
• [31] Cooperation between RUNX1-ETO9a and novel transcriptional partner KLF6 in upregulation of Alox5 in acute myeloid leukemia.PLoS Genet. 2013;9(10):e1003765. doi: 10.1371/journal.pgen.1003765. Epub 2013 Oct 10.
• [32] Expression profile analysis of head and neck squamous cell carcinomas using data from The Cancer Genome Atlas.Mol Med Rep. 2016 May;13(5):4259-65. doi: 10.3892/mmr.2016.5054. Epub 2016 Mar 28.
• [33] Enhanced hepatocarcinogenesis in mouse models and human hepatocellular carcinoma by coordinate KLF6 depletion and increased messenger RNA splicing.Hepatology. 2012 Oct;56(4):1361-70. doi: 10.1002/hep.25810. Epub 2012 Aug 27.
• [34] Characterization of the prostate cancer susceptibility gene KLF6 in human and mouse prostate cancers.Prostate. 2013 Jan;73(2):182-93. doi: 10.1002/pros.22554. Epub 2012 Jul 10.
• [35] Artesunate induces mitochondria-mediated apoptosis of human retinoblastoma cells by upregulating Kruppel-like factor 6.Cell Death Dis. 2019 Nov 13;10(11):862. doi: 10.1038/s41419-019-2084-1.
• [36] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [37] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [38] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [39] Cell-type-specific responses to chemotherapeutics in breast cancer. Cancer Res. 2004 Jun 15;64(12):4218-26.
• [40] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [41] The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
• [42] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [43] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [44] Oxidative stress modulates KLF6Full and its splice variants. Alcohol Clin Exp Res. 2012 Nov;36(11):1851-62. doi: 10.1111/j.1530-0277.2012.01798.x. Epub 2012 Apr 6.
• [45] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [46] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [47] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [48] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [49] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [50] Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
• [51] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [52] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [53] Cannabidiol enhances cytotoxicity of anti-cancer drugs in human head and neck squamous cell carcinoma. Sci Rep. 2020 Nov 26;10(1):20622. doi: 10.1038/s41598-020-77674-y.
• [54] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [55] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [56] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [57] Utilization of CDKN1A/p21 gene for class discrimination of DNA damage-induced clastogenicity. Toxicology. 2014 Jan 6;315:8-16. doi: 10.1016/j.tox.2013.10.009. Epub 2013 Nov 6.
• [58] Differential regulation of the p73 cistrome by mammalian target of rapamycin reveals transcriptional programs of mesenchymal differentiation and tumorigenesis. Proc Natl Acad Sci U S A. 2011 Feb 1;108(5):2076-81. doi: 10.1073/pnas.1011936108. Epub 2011 Jan 18.
• [59] Simvastatin inactivates beta1-integrin and extracellular signal-related kinase signaling and inhibits cell proliferation in head and neck squamous cell carcinoma cells. Cancer Sci. 2007 Jun;98(6):890-9.
• [60] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [61] Gene expression profiling identifies activating transcription factor 3 as a novel contributor to the proapoptotic effect of curcumin. Mol Cancer Ther. 2005 Feb;4(2):233-41.
• [62] ON 01910.Na is selectively cytotoxic for chronic lymphocytic leukemia cells through a dual mechanism of action involving PI3K/AKT inhibition and induction of oxidative stress. Clin Cancer Res. 2012 Apr 1;18(7):1979-91. doi: 10.1158/1078-0432.CCR-11-2113. Epub 2012 Feb 20.
• [63] Classification of heavy-metal toxicity by human DNA microarray analysis. Environ Sci Technol. 2007 May 15;41(10):3769-74.
• [64] MIP-1beta, a novel biomarker for in vitro sensitization test using human monocytic cell line. Toxicol In Vitro. 2006 Aug;20(5):736-42.
• [65] A genetic network model of cellular responses to lithium treatment and cocaine abuse in bipolar disorder. BMC Syst Biol. 2010 Nov 19;4:158. doi: 10.1186/1752-0509-4-158.
• [66] Inter- and intra-laboratory study to determine the reproducibility of toxicogenomics datasets. Toxicology. 2011 Nov 28;290(1):50-8.
• [67] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [68] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [69] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [70] Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
• [71] Proteasome inhibition creates a chromatin landscape favorable to RNA Pol II processivity. J Biol Chem. 2020 Jan 31;295(5):1271-1287. doi: 10.1074/jbc.RA119.011174. Epub 2019 Dec 5.
• [72] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [73] In vitro effects of aldehydes present in tobacco smoke on gene expression in human lung alveolar epithelial cells. Toxicol In Vitro. 2013 Apr;27(3):1072-81.
• [74] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [75] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [76] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.