Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBPNKJQ)

• DOT Name: Suppressor of cytokine signaling 2 (SOCS2)
• Synonyms: SOCS-2; Cytokine-inducible SH2 protein 2; CIS-2; STAT-induced STAT inhibitor 2; SSI-2
• Gene Name: SOCS2
• Related Disease:
  Narcolepsy
  Narcolepsy type 1
  Thyroid gland papillary carcinoma
  Acute myelogenous leukaemia
  Advanced cancer
  Allergic contact dermatitis
  Autoimmune disease
  Breast cancer
  Breast neoplasm
  Carcinoma
  Cardiovascular disease
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Cystic fibrosis
  Hepatitis B virus infection
  Inflammatory bowel disease
  Leukemia
  Lung adenocarcinoma
  Myeloproliferative neoplasm
  Non-insulin dependent diabetes
  Non-small-cell lung cancer
  Obesity
  Osteoarthritis
  Plasma cell myeloma
  Pneumonia
  Pneumonitis
  Prostate cancer
  Prostate carcinoma
  Prostate neoplasm
  Rheumatoid arthritis
  Schizophrenia
  Squamous cell carcinoma
  Systemic lupus erythematosus
  Tuberculosis
  Breast carcinoma
  Diabetic kidney disease
  Metastatic malignant neoplasm
  Carcinoma of liver and intrahepatic biliary tract
  Chronic renal failure
  Colitis
  Endometrial cancer
  Endometrial carcinoma
  Hepatocellular carcinoma
  Liver cancer
  Lung cancer
  Lung carcinoma
  Melanoma
  Neoplasm
  Nervous system inflammation
• UniProt ID: SOCS2_HUMAN
• PDB ID: 2C9W; 4JGH; 5BO4; 6I4X; 6I5J; 6I5N; 7M6T; 7ZLM; 7ZLN; 7ZLO; 7ZLP; 7ZLR; 7ZLS
• Pfam ID: PF00017 ; PF07525
• Sequence:
  MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKE
  KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
  SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWG
  LPLPTRLKDYLEEYKFQV
• Function: SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS2 appears to be a negative regulator in the growth hormone/IGF1 signaling pathway. Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
• Tissue Specificity: High expression in heart, placenta, lung, kidney and prostate. Predominantly expressed in pulmonary epithelia cells, specifically type II pneumocytes.
• KEGG Pathway:
  JAK-STAT sig.ling pathway (hsa04630)
  Insulin sig.ling pathway (hsa04910)
  Prolactin sig.ling pathway (hsa04917)
  Type II diabetes mellitus (hsa04930)
  Growth hormone synthesis, secretion and action (hsa04935)
• Reactome Pathway:
  Neddylation (R-HSA-8951664)
  Negative regulation of FLT3 (R-HSA-9706369)
  Growth hormone receptor signaling (R-HSA-982772)
  Interleukin-7 signaling (R-HSA-1266695)

Molecular Interaction Atlas (MIA) of This DOT

50 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Narcolepsy	DISLCNLI	Definitive	Biomarker	[1]
Narcolepsy type 1	DISH7Y6Q	Definitive	Biomarker	[1]
Thyroid gland papillary carcinoma	DIS48YMM	Definitive	Biomarker	[2]
Acute myelogenous leukaemia	DISCSPTN	Strong	Altered Expression	[3]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[4]
Allergic contact dermatitis	DISFFVF9	Strong	Biomarker	[5]
Autoimmune disease	DISORMTM	Strong	Biomarker	[6]
Breast cancer	DIS7DPX1	Strong	Biomarker	[7]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[8]
Carcinoma	DISH9F1N	Strong	Altered Expression	[9]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[10]
Colon cancer	DISVC52G	Strong	Altered Expression	[11]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[11]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[12]
Cystic fibrosis	DIS2OK1Q	Strong	Biomarker	[13]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[14]
Inflammatory bowel disease	DISGN23E	Strong	Altered Expression	[15]
Leukemia	DISNAKFL	Strong	Altered Expression	[16]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[17]
Myeloproliferative neoplasm	DIS5KAPA	Strong	Altered Expression	[18]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Altered Expression	[19]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[20]
Obesity	DIS47Y1K	Strong	Biomarker	[21]
Osteoarthritis	DIS05URM	Strong	Altered Expression	[22]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[23]
Pneumonia	DIS8EF3M	Strong	Biomarker	[24]
Pneumonitis	DIS88E0K	Strong	Biomarker	[24]
Prostate cancer	DISF190Y	Strong	Altered Expression	[25]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[25]
Prostate neoplasm	DISHDKGQ	Strong	Altered Expression	[26]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[27]
Schizophrenia	DISSRV2N	Strong	Biomarker	[28]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[29]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[27]
Tuberculosis	DIS2YIMD	Strong	Altered Expression	[30]
Breast carcinoma	DIS2UE88	moderate	Altered Expression	[31]
Diabetic kidney disease	DISJMWEY	moderate	Altered Expression	[32]
Metastatic malignant neoplasm	DIS86UK6	moderate	Biomarker	[33]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Limited	Biomarker	[34]
Chronic renal failure	DISGG7K6	Limited	Altered Expression	[35]
Colitis	DISAF7DD	Limited	Altered Expression	[11]
Endometrial cancer	DISW0LMR	Limited	Altered Expression	[36]
Endometrial carcinoma	DISXR5CY	Limited	Altered Expression	[36]
Hepatocellular carcinoma	DIS0J828	Limited	Biomarker	[37]
Liver cancer	DISDE4BI	Limited	Biomarker	[34]
Lung cancer	DISCM4YA	Limited	Biomarker	[38]
Lung carcinoma	DISTR26C	Limited	Biomarker	[38]
Melanoma	DIS1RRCY	Limited	Altered Expression	[39]
Neoplasm	DISZKGEW	Limited	Altered Expression	[25]
Nervous system inflammation	DISB3X5A	Limited	Altered Expression	[40]

39 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[41]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[42]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[43]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[44]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[45]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[46]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[47]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[48]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[49]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[50]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[51]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Suppressor of cytokine signaling 2 (SOCS2).	[52]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Suppressor of cytokine signaling 2 (SOCS2).	[53]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[54]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Suppressor of cytokine signaling 2 (SOCS2).	[55]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[56]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[57]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[58]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[59]
Isotretinoin	DM4QTBN	Approved	Isotretinoin increases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[43]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid decreases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[60]
Alitretinoin	DMME8LH	Approved	Alitretinoin increases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[43]
Clorgyline	DMCEUJD	Approved	Clorgyline increases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[61]
Enzalutamide	DMGL19D	Approved	Enzalutamide decreases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[62]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[63]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[62]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[57]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[64]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene increases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[65]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[67]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[68]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[69]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[70]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[71]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[72]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[73]
Glyphosate	DM0AFY7	Investigative	Glyphosate decreases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[74]
[3H]methyltrienolone	DMTSGOW	Investigative	[3H]methyltrienolone increases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[75]
all-trans-4-oxo-retinoic acid	DMM2R1N	Investigative	all-trans-4-oxo-retinoic acid increases the expression of Suppressor of cytokine signaling 2 (SOCS2).	[43]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Suppressor of cytokine signaling 2 (SOCS2).	[66]

References

• [1] Reduced expression of TAC1, PENK and SOCS2 in Hcrtr-2 mutated narcoleptic dog brain.BMC Neurosci. 2007 May 23;8:34. doi: 10.1186/1471-2202-8-34.
• [2] Significance of expression of suppressor of cytokine signaling proteins: Suppressor of cytokine signaling-1, suppressor of cytokine signaling-2, and suppressor of cytokine signaling-3 in papillary thyroid cancer.J Cancer Res Ther. 2017 Apr-Jun;13(2):337-345. doi: 10.4103/0973-1482.174172.
• [3] SOCS2 is part of a highly prognostic 4-gene signature in AML and promotes disease aggressiveness.Sci Rep. 2019 Jun 24;9(1):9139. doi: 10.1038/s41598-019-45579-0.
• [4] SOCS2 correlates with malignancy and exerts growth-promoting effects in prostate cancer.Endocr Relat Cancer. 2014 Jan 30;21(2):175-87. doi: 10.1530/ERC-13-0446. Print 2014 Apr.
• [5] Gene transcripts as potential diagnostic markers for allergic contact dermatitis.Contact Dermatitis. 2005 Aug;53(2):100-6. doi: 10.1111/j.0105-1873.2005.00658.x.
• [6] Tolerogenic nanoparticles inhibit T cell-mediated autoimmunity through SOCS2.Sci Signal. 2016 Jun 21;9(433):ra61. doi: 10.1126/scisignal.aad0612.
• [7] Genetic variation in the JAK/STAT/SOCS signaling pathway influences breast cancer-specific mortality through interaction with cigarette smoking and use of aspirin/NSAIDs: the Breast Cancer Health Disparities Study.Breast Cancer Res Treat. 2014 Aug;147(1):145-58. doi: 10.1007/s10549-014-3071-y. Epub 2014 Aug 8.
• [8] Differential hypermethylation of SOCS genes in ovarian and breast carcinomas.Oncogene. 2004 Oct 7;23(46):7726-33. doi: 10.1038/sj.onc.1207787.
• [9] Favorable prognostic value of SOCS2 and IGF-I in breast cancer.BMC Cancer. 2007 Jul 25;7:136. doi: 10.1186/1471-2407-7-136.
• [10] Suppressor of cytokine signaling (SOCS) 2, a protein with multiple functions.Cytokine Growth Factor Rev. 2006 Dec;17(6):431-9. doi: 10.1016/j.cytogfr.2006.09.008. Epub 2006 Oct 27.
• [11] Alterations in the p53-SOCS2 axis contribute to tumor growth in colon cancer.Exp Mol Med. 2018 Apr 6;50(4):1-10. doi: 10.1038/s12276-017-0001-1.
• [12] Identification of SOCS2 and SOCS6 as biomarkers in human colorectal cancer.Br J Cancer. 2014 Aug 12;111(4):726-35. doi: 10.1038/bjc.2014.377. Epub 2014 Jul 15.
• [13] Bacterial cis-2-unsaturated fatty acids found in the cystic fibrosis airway modulate virulence and persistence of Pseudomonas aeruginosa.ISME J. 2012 May;6(5):939-50. doi: 10.1038/ismej.2011.167. Epub 2011 Dec 1.
• [14] Hepatitis B Virus e Antigen Activates the Suppressor of Cytokine Signaling 2 to Repress Interferon Action.Sci Rep. 2017 May 11;7(1):1729. doi: 10.1038/s41598-017-01773-6.
• [15] Suppressor of cytokine signaling 2 (Socs2) deletion protects bone health of mice with DSS-induced inflammatory bowel disease.Dis Model Mech. 2018 Jan 17;11(1):dmm028456. doi: 10.1242/dmm.028456.
• [16] SOCS2 Controls Proliferation and Stemness of Hematopoietic Cells under Stress Conditions and Its Deregulation Marks Unfavorable Acute Leukemias.Cancer Res. 2015 Jun 1;75(11):2387-99. doi: 10.1158/0008-5472.CAN-14-3625. Epub 2015 Apr 9.
• [17] Suppressor of cytokine signalling-2 limits IGF1R-mediated regulation of epithelial-mesenchymal transition in lung adenocarcinoma.Cell Death Dis. 2018 Apr 1;9(4):429. doi: 10.1038/s41419-018-0457-5.
• [18] SOCS2: inhibitor of JAK2V617F-mediated signal transduction.Leukemia. 2008 Dec;22(12):2169-75. doi: 10.1038/leu.2008.226. Epub 2008 Sep 4.
• [19] SOCS2 exacerbates myocardial injury induced by ischemia/reperfusion in diabetic mice and H9c2 cells through inhibiting the JAK-STAT-IGF-1 pathway.Life Sci. 2017 Nov 1;188:101-109. doi: 10.1016/j.lfs.2017.08.036. Epub 2017 Sep 1.
• [20] MiR-875 can regulate the proliferation and apoptosis of non-small cell lung cancer cells via targeting SOCS2.Eur Rev Med Pharmacol Sci. 2019 Jun;23(12):5235-5241. doi: 10.26355/eurrev_201906_18189.
• [21] SOCS2 modulates adipose tissue inflammation and expansion in mice.J Nutr Biochem. 2020 Feb;76:108304. doi: 10.1016/j.jnutbio.2019.108304. Epub 2019 Nov 23.
• [22] Suppressors of cytokine signalling (SOCS) are reduced in osteoarthritis.Biochem Biophys Res Commun. 2011 Apr 1;407(1):54-9. doi: 10.1016/j.bbrc.2011.02.101. Epub 2011 Feb 23.
• [23] Differential oncogene-related gene expressions in myeloma cells resistant to prednisone and vincristine.Biomed Pharmacother. 2012 Oct;66(7):506-11. doi: 10.1016/j.biopha.2012.02.007. Epub 2012 May 9.
• [24] KIAA0317 regulates pulmonary inflammation through SOCS2 degradation.JCI Insight. 2019 Oct 3;4(19):e129110. doi: 10.1172/jci.insight.129110.
• [25] MiR-492 exerts tumor-promoting function in prostate cancer through repressing SOCS2 expression.Eur Rev Med Pharmacol Sci. 2019 Feb;23(3):992-1001. doi: 10.26355/eurrev_201902_16986.
• [26] Evolution of the androgen receptor pathway during progression of prostate cancer.Cancer Res. 2006 May 15;66(10):5012-20. doi: 10.1158/0008-5472.CAN-05-3082.
• [27] The analysis of CIS, SOCS1, SOSC2 and SOCS3 transcript levels in peripheral blood mononuclear cells of systemic lupus erythematosus and rheumatoid arthritis patients.Clin Exp Med. 2008 Dec;8(4):179-85. doi: 10.1007/s10238-008-0006-0. Epub 2008 Sep 27.
• [28] Dopaminergic activity and behaviour in SOCS2 transgenic mice: Revealing a potential drug target for schizophrenia.Prog Neuropsychopharmacol Biol Psychiatry. 2015 Jan 2;56:247-53. doi: 10.1016/j.pnpbp.2014.09.009. Epub 2014 Oct 5.
• [29] IL-8 induces miR-424-5p expression and modulates SOCS2/STAT5 signaling pathway in oral squamous cell carcinoma.Mol Oncol. 2016 Jun;10(6):895-909. doi: 10.1016/j.molonc.2016.03.001. Epub 2016 Mar 22.
• [30] Suppressors of cytokine signaling in tuberculosis.PLoS One. 2017 Apr 21;12(4):e0176377. doi: 10.1371/journal.pone.0176377. eCollection 2017.
• [31] Suppressor of cytokine signaling (SOCS) genes are downregulated in breast cancer.World J Surg Oncol. 2018 Nov 19;16(1):226. doi: 10.1186/s12957-018-1529-9.
• [32] Inhibitor of IGF1 receptor alleviates the inflammation process in the diabetic kidney mouse model without activating SOCS2.Drug Des Devel Ther. 2018 Sep 11;12:2887-2896. doi: 10.2147/DDDT.S171638. eCollection 2018.
• [33] The suppressor of cytokine signaling 2 (SOCS2) inhibits tumor metastasis in hepatocellular carcinoma.Tumour Biol. 2016 Oct;37(10):13521-13531. doi: 10.1007/s13277-016-5215-7. Epub 2016 Jul 28.
• [34] RNA N6-methyladenosine methyltransferase-like 3 promotes liver cancer progression through YTHDF2-dependent posttranscriptional silencing of SOCS2.Hepatology. 2018 Jun;67(6):2254-2270. doi: 10.1002/hep.29683. Epub 2018 Apr 19.
• [35] Indoxyl sulfate-induced TNF- is regulated by crosstalk between the aryl hydrocarbon receptor, NF-B, and SOCS2 in human macrophages.FASEB J. 2019 Oct;33(10):10844-10858. doi: 10.1096/fj.201900730R. Epub 2019 Jul 5.
• [36] Molecular markers of endometrial carcinoma detected in uterine aspirates.Int J Cancer. 2011 Nov 15;129(10):2435-44. doi: 10.1002/ijc.25901. Epub 2011 Apr 8.
• [37] MicroRNA-196a/-196b regulate the progression of hepatocellular carcinoma through modulating the JAK/STAT pathway via targeting SOCS2.Cell Death Dis. 2019 Apr 15;10(5):333. doi: 10.1038/s41419-019-1530-4.
• [38] A herpes simplex virus type 2-encoded microRNA promotes tumor cell metastasis by targeting suppressor of cytokine signaling 2 in lung cancer.Tumour Biol. 2017 May;39(5):1010428317701633. doi: 10.1177/1010428317701633.
• [39] IFN-Dependent Tissue-Immune Homeostasis Is Co-opted in the Tumor Microenvironment.Cell. 2017 Jun 29;170(1):127-141.e15. doi: 10.1016/j.cell.2017.06.016.
• [40] Type I interferons and microbial metabolites of tryptophan modulate astrocyte activity and central nervous system inflammation via the aryl hydrocarbon receptor.Nat Med. 2016 Jun;22(6):586-97. doi: 10.1038/nm.4106. Epub 2016 May 9.
• [41] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [42] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [43] Retinoic acid and its 4-oxo metabolites are functionally active in human skin cells in vitro. J Invest Dermatol. 2005 Jul;125(1):143-53.
• [44] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [45] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [46] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [47] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [48] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [49] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [50] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [51] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [52] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [53] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [54] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [55] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [56] Progesterone promotes differentiation of human cord blood fetal T cells into T regulatory cells but suppresses their differentiation into Th17 cells. J Immunol. 2011 Aug 15;187(4):1778-87. doi: 10.4049/jimmunol.1003919. Epub 2011 Jul 18.
• [57] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [58] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [59] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [60] Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
• [61] Anti-oncogenic and pro-differentiation effects of clorgyline, a monoamine oxidase A inhibitor, on high grade prostate cancer cells. BMC Med Genomics. 2009 Aug 20;2:55. doi: 10.1186/1755-8794-2-55.
• [62] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [63] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [64] Gene expression profiling in Ishikawa cells: a fingerprint for estrogen active compounds. Toxicol Appl Pharmacol. 2009 Apr 1;236(1):85-96.
• [65] Molecular mechanism of action of bisphenol and bisphenol A mediated by oestrogen receptor alpha in growth and apoptosis of breast cancer cells. Br J Pharmacol. 2013 May;169(1):167-78.
• [66] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [67] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [68] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [69] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [70] Gene expression profiling reveals novel regulation by bisphenol-A in estrogen receptor-alpha-positive human cells. Environ Res. 2006 Jan;100(1):86-92.
• [71] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [72] Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.
• [73] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [74] Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
• [75] Identification of genes targeted by the androgen and PKA signaling pathways in prostate cancer cells. Oncogene. 2006 Nov 23;25(55):7311-23.