General Information of Drug Off-Target (DOT) (ID: OTHZBM4X)

DOT Name Dystonin (DST)
Synonyms 230 kDa bullous pemphigoid antigen; 230/240 kDa bullous pemphigoid antigen; Bullous pemphigoid antigen 1; BPA; Bullous pemphigoid antigen; Dystonia musculorum protein; Hemidesmosomal plaque protein
Gene Name DST
Related Disease
Hereditary sensory and autonomic neuropathy type 6 ( )
Neoplasm ( )
Adenocarcinoma ( )
Advanced cancer ( )
Alzheimer disease ( )
Autism spectrum disorder ( )
Autoimmune disease ( )
Colon cancer ( )
Colon carcinoma ( )
Colonic neoplasm ( )
Dementia ( )
Depression ( )
Dystonia ( )
Epidermolysis bullosa simplex ( )
Epidermolysis bullosa simplex 3, localized or generalized intermediate, with BP230 deficiency ( )
Head-neck squamous cell carcinoma ( )
High blood pressure ( )
Major depressive disorder ( )
Metabolic disorder ( )
Nasopharyngeal carcinoma ( )
Non-insulin dependent diabetes ( )
Obesity ( )
Oral cancer ( )
Schizophrenia ( )
Skin disease ( )
Systemic lupus erythematosus ( )
Tuberculosis ( )
Type-1/2 diabetes ( )
Uterine fibroids ( )
Bullous pemphigoid ( )
Hereditary sensory and autonomic neuropathy ( )
Pancreatic cancer ( )
Epidermolysis bullosa ( )
Multiple sclerosis ( )
Nephropathy ( )
Adult glioblastoma ( )
Breast cancer ( )
Breast carcinoma ( )
Bulimia nervosa ( )
Glioblastoma multiforme ( )
Melanoma ( )
Nervous system disease ( )
Parkinson disease ( )
Prostate cancer ( )
Prostate carcinoma ( )
Rheumatoid arthritis ( )
Squamous cell carcinoma ( )
UniProt ID
DYST_HUMAN
PDB ID
3GJO; 7OLG
Pfam ID
PF00307 ; PF13499 ; PF02187 ; PF00681 ; PF17902 ; PF00435 ; PF18373 ; PF21019 ; PF21020 ; PF21097
Sequence
MAGYLSPAAYLYVEEQEYLQAYEDVLERYKDERDKVQKKTFTKWINQHLMKVRKHVNDLY
EDLRDGHNLISLLEVLSGDTLPREKGRMRFHRLQNVQIALDYLKRRQVKLVNIRNDDITD
GNPKLTLGLIWTIILHFQISDIHVTGESEDMSAKERLLLWTQQATEGYAGIRCENFTTCW
RDGKLFNAIIHKYRPDLIDMNTVAVQSNLANLEHAFYVAEKIGVIRLLDPEDVDVSSPDE
KSVITYVSSLYDAFPKVPEGGEGIGANDVEVKWIEYQNMVNYLIQWIRHHVTTMSERTFP
NNPVELKALYNQYLQFKETEIPPKETEKSKIKRLYKLLEIWIEFGRIKLLQGYHPNDIEK
EWGKLIIAMLEREKALRPEVERLEMLQQIANRVQRDSVICEDKLILAGNALQSDSKRLES
GVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNEC
SSVYSKGRILTTEQTKLMISGITQSLNSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLS
SGMTSRLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTE
EEINMKFVQDLLNWVDEMQVQLDRTEWGSDLPSVESHLENHKNVHRAIEEFESSLKEAKI
SEIQMTAPLKLTYAEKLHRLESQYAKLLNTSRNQERHLDTLHNFVSRATNELIWLNEKEE
EEVAYDWSERNTNIARKKDYHAELMRELDQKEENIKSVQEIAEQLLLENHPARLTIEAYR
AAMQTQWSWILQLCQCVEQHIKENTAYFEFFNDAKEATDYLRNLKDAIQRKYSCDRSSSI
HKLEDLVQESMEEKEELLQYKSTIANLMGKAKTIIQLKPRNSDCPLKTSIPIKAICDYRQ
IEITIYKDDECVLANNSHRAKWKVISPTGNEAMVPSVCFTVPPPNKEAVDLANRIEQQYQ
NVLTLWHESHINMKSVVSWHYLINEIDRIRASNVASIKTMLPGEHQQVLSNLQSRFEDFL
EDSQESQVFSGSDITQLEKEVNVCKQYYQELLKSAEREEQEESVYNLYISEVRNIRLRLE
NCEDRLIRQIRTPLERDDLHESVFRITEQEKLKKELERLKDDLGTITNKCEEFFSQAAAS
SSVPTLRSELNVVLQNMNQVYSMSSTYIDKLKTVNLVLKNTQAAEALVKLYETKLCEEEA
VIADKNNIENLISTLKQWRSEVDEKRQVFHALEDELQKAKAISDEMFKTYKERDLDFDWH
KEKADQLVERWQNVHVQIDNRLRDLEGIGKSLKYYRDTYHPLDDWIQQVETTQRKIQENQ
PENSKTLATQLNQQKMLVSEIEMKQSKMDECQKYAEQYSATVKDYELQTMTYRAMVDSQQ
KSPVKRRRMQSSADLIIQEFMDLRTRYTALVTLMTQYIKFAGDSLKRLEEEEKSLEEEKK
EHVEKAKELQKWVSNISKTLKDAEKAGKPPFSKQKISSEEISTKKEQLSEALQTIQLFLA
KHGDKMTDEERNELEKQVKTLQESYNLLFSESLKQLQESQTSGDVKVEEKLDKVIAGTID
QTTGEVLSVFQAVLRGLIDYDTGIRLLETQLMISGLISPELRKCFDLKDAKSHGLIDEQI
LCQLKELSKAKEIISAASPTTIPVLDALAQSMITESMAIKVLEILLSTGSLVIPATGEQL
TLQKAFQQNLVSSALFSKVLERQNMCKDLIDPCTSEKVSLIDMVQRSTLQENTGMWLLPV
RPQEGGRITLKCGRNISILRAAHEGLIDRETMFRLLSAQLLSGGLINSNSGQRMTVEEAV
REGVIDRDTASSILTYQVQTGGIIQSNPAKRLTVDEAVQCDLITSSSALLVLEAQRGYVG
LIWPHSGEIFPTSSSLQQELITNELAYKILNGRQKIAALYIPESSQVIGLDAAKQLGIID
NNTASILKNITLPDKMPDLGDLEACKNARRWLSFCKFQPSTVHDYRQEEDVFDGEEPVTT
QTSEETKKLFLSYLMINSYMDANTGQRLLLYDGDLDEAVGMLLEGCHAEFDGNTAIKECL
DVLSSSGVFLNNASGREKDECTATPSSFNKCHCGEPEHEETPENRKCAIDEEFNEMRNTV
INSEFSQSGKLASTISIDPKVNSSPSVCVPSLISYLTQTELADISMLRSDSENILTNYEN
QSRVETNERANECSHSKNIQNFPSDLIENPIMKSKMSKFCGVNETENEDNTNRDSPIFDY
SPRLSALLSHDKLMHSQGSFNDTHTPESNGNKCEAPALSFSDKTMLSGQRIGEKFQDQFL
GIAAINISLPGEQYGQKSLNMISSNPQVQYHNDKYISNTSGEDEKTHPGFQQMPEDKEDE
SEIEEYSCAVTPGGDTDNAIVSLTCATPLLDETISASDYETSLLNDQQNNTGTDTDSDDD
FYDTPLFEDDDHDSLLLDGDDRDCLHPEDYDTLQEENDETASPADVFYDVSKENENSMVP
QGAPVGSLSVKNKAHCLQDFLMDVEKDELDSGEKIHLNPVGSDKVNGQSLETGSERECTN
ILEGDESDSLTDYDIVGGKESFTASLKFDDSGSWRGRKEEYVTGQEFHSDTDHLDSMQSE
ESYGDYIYDSNDQDDDDDDGIDEEGGGIRDENGKPRCQNVAEDMDIQLCASILNENSDEN
ENINTMILLDKMHSCSSLEKQQRVNVVQLASPSENNLVTEKSNLPEYTTEIAGKSKENLL
NHEMVLKDVLPPIIKDTESEKTFGPASISHDNNNISSTSELGTDLANTKVKLIQGSELPE
LTDSVKGKDEYFKNMTPKVDSSLDHIICTEPDLIGKPAEESHLSLIASVTDKDPQGNGSD
LIKGRDGKSDILIEDETSIQKMYLGEGEVLVEGLVEEENRHLKLLPGKNTRDSFKLINSQ
FPFPQITNNEELNQKGSLKKATVTLKDEPNNLQIIVSKSPVQFENLEEIFDTSVSKEISD
DITSDITSWEGNTHFEESFTDGPEKELDLFTYLKHCAKNIKAKDVAKPNEDVPSHVLITA
PPMKEHLQLGVNNTKEKSTSTQKDSPLNDMIQSNDLCSKESISGGGTEISQFTPESIEAT
LSILSRKHVEDVGKNDFLQSERCANGLGNDNSSNTLNTDYSFLEINNKKERIEQQLPKEQ
ALSPRSQEKEVQIPELSQVFVEDVKDILKSRLKEGHMNPQEVEEPSACADTKILIQNLIK
RITTSQLVNEASTVPSDSQMSDSSGVSPMTNSSELKPESRDDPFCIGNLKSELLLNILKQ
DQHSQKITGVFELMRELTHMEYDLEKRGITSKVLPLQLENIFYKLLADGYSEKIEHVGDF
NQKACSTSEMMEEKPHILGDIKSKEGNYYSPNLETVKEIGLESSTVWASTLPRDEKLKDL
CNDFPSHLECTSGSKEMASGDSSTEQFSSELQQCLQHTEKMHEYLTLLQDMKPPLDNQES
LDNNLEALKNQLRQLETFELGLAPIAVILRKDMKLAEEFLKSLPSDFPRGHVEELSISHQ
SLKTAFSSLSNVSSERTKQIMLAIDSEMSKLAVSHEEFLHKLKSFSDWVSEKSKSVKDIE
IVNVQDSEYVKKRLEFLKNVLKDLGHTKMQLETTAFDVQFFISEYAQDLSPNQSKQLLRL
LNTTQKCFLDVQESVTTQVERLETQLHLEQDLDDQKIVAERQQEYKEKLQGICDLLTQTE
NRLIGHQEAFMIGDGTVELKKYQSKQEELQKDMQGSAQALAEVVKNTENFLKENGEKLSQ
EDKALIEQKLNEAKIKCEQLNLKAEQSKKELDKVVTTAIKEETEKVAAVKQLEESKTKIE
NLLDWLSNVDKDSERAGTKHKQVIEQNGTHFQEGDGKSAIGEEDEVNGNLLETDVDGQVG
TTQENLNQQYQKVKAQHEKIISQHQAVIIATQSAQVLLEKQGQYLSPEEKEKLQKNMKEL
KVHYETALAESEKKMKLTHSLQEELEKFDADYTEFEHWLQQSEQELENLEAGADDINGLM
TKLKRQKSFSEDVISHKGDLRYITISGNRVLEAAKSCSKRDGGKVDTSATHREVQRKLDH
ATDRFRSLYSKCNVLGNNLKDLVDKYQHYEDASCGLLAGLQACEATASKHLSEPIAVDPK
NLQRQLEETKALQGQISSQQVAVEKLKKTAEVLLDARGSLLPAKNDIQKTLDDIVGRYED
LSKSVNERNEKLQITLTRSLSVQDGLDEMLDWMGNVESSLKEQGQVPLNSTALQDIISKN
IMLEQDIAGRQSSINAMNEKVKKFMETTDPSTASSLQAKMKDLSARFSEASHKHKETLAK
MEELKTKVELFENLSEKLQTFLETKTQALTEVDVPGKDVTELSQYMQESTSEFLEHKKHL
EVLHSLLKEISSHGLPSDKALVLEKTNNLSKKFKEMEDTIKEKKEAVTSCQEQLDAFQVL
VKSLKSWIKETTKKVPIVQPSFGAEDLGKSLEDTKKLQEKWSLKTPEIQKVNNSGISLCN
LISAVTTPAKAIAAVKSGGAVLNGEGTATNTEEFWANKGLTSIKKDMTDISHGYEDLGLL
LKDKIAELNTKLSKLQKAQEESSAMMQWLQKMNKTATKWQQTPAPTDTEAVKTQVEQNKS
FEAELKQNVNKVQELKDKLTELLEENPDTPEAPRWKQMLTEIDSKWQELNQLTIDRQQKL
EESSNNLTQFQTVEAQLKQWLVEKELMVSVLGPLSIDPNMLNTQRQQVQILLQEFATRKP
QYEQLTAAGQGILSRPGEDPSLRGIVKEQLAAVTQKWDSLTGQLSDRCDWIDQAIVKSTQ
YQSLLRSLSDKLSDLDNKLSSSLAVSTHPDAMNQQLETAQKMKQEIQQEKKQIKVAQALC
EDLSALVKEEYLKAELSRQLEGILKSFKDVEQKAENHVQHLQSACASSHQFQQMSRDFQA
WLDTKKEEQNKSHPISAKLDVLESLIKDHKDFSKTLTAQSHMYEKTIAEGENLLLKTQGS
EKAALQLQLNTIKTNWDTFNKQVKERENKLKESLEKALKYKEQVETLWPWIDKCQNNLEE
IKFCLDPAEGENSIAKLKSLQKEMDQHFGMVELLNNTANSLLSVCEIDKEVVTDENKSLI
QKVDMVTEQLHSKKFCLENMTQKFKEFQEVSKESKRQLQCAKEQLDIHDSLGSQAYSNKY
LTMLQTQQKSLQALKHQVDLAKRLAQDLVVEASDSKGTSDVLLQVETIAQEHSTLSQQVD
EKCSFLETKLQGIGHFQNTIREMFSQFAEFDDELDSMAPVGRDAETLQKQKETIKAFLKK
LEALMASNDNANKTCKMMLATEETSPDLVGIKRDLEALSKQCNKLLDRAQAREEQVEGTI
KRLEEFYSKLKEFSILLQKAEEHEESQGPVGMETETINQQLNMFKVFQKEEIEPLQGKQQ
DVNWLGQGLIQSAAKSTSTQGLEHDLDDVNARWKTLNKKVAQRAAQLQEALLHCGRFQDA
LESLLSWMVDTEELVANQKPPSAEFKVVKAQIQEQKLLQRLLDDRKSTVEVIKREGEKIA
TTAEPADKVKILKQLSLLDSRWEALLNKAETRNRQLEGISVVAQQFHETLEPLNEWLTTI
EKRLVNCEPIGTQASKLEEQIAQHKALEDDIINHNKHLHQAVSIGQSLKVLSSREDKDMV
QSKLDFSQVWYIEIQEKSHSRSELLQQALCNAKIFGEDEVELMNWLNEVHDKLSKLSVQD
YSTEGLWKQQSELRVLQEDILLRKQNVDQALLNGLELLKQTTGDEVLIIQDKLEAIKARY
KDITKLSTDVAKTLEQALQLARRLHSTHEELCTWLDKVEVELLSYETQVLKGEEASQAQM
RPKELKKEAKNNKALLDSLNEVSSALLELVPWRAREGLEKMVAEDNERYRLVSDTITQKV
EEIDAAILRSQQFDQAADAELSWITETEKKLMSLGDIRLEQDQTSAQLQVQKTFTMEILR
HKDIIDDLVKSGHKIMTACSEEEKQSMKKKLDKVLKNYDTICQINSERYLQLERAQSLVN
QFWETYEELWPWLTETQSIISQLPAPALEYETLRQQQEEHRQLRELIAEHKPHIDKMNKT
GPQLLELSPGEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQSTQFHDKIDQILES
LERIVERLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKQRGEEMIARSGGTD
KDISAKAVQDKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLIVTIKDTQDF
IRDLEDPGIDPSVVKQQQEAAETIREEIDGLQEELDIVINLGSELIAACGEPDKPIVKKS
IDELNSAWDSLNKAWKDRIDKLEEAMQAAVQYQDGLQAVFDWVDIAGGKLASMSPIGTDL
ETVKQQIEELKQFKSEAYQQQIEMERLNHQAELLLKKVTEESDKHTVQDPLMELKLIWDS
LEERIINRQHKLEGALLALGQFQHALDELLAWLTHTEGLLSEQKPVGGDPKAIEIELAKH
HVLQNDVLAHQSTVEAVNKAGNDLIESSAGEEASNLQNKLEVLNQRWQNVLEKTEQRKQQ
LDGALRQAKGFHGEIEDLQQWLTDTERHLLASKPLGGLPETAKEQLNVHMEVCAAFEAKE
ETYKSLMQKGQQMLARCPKSAETNIDQDINNLKEKWESVETKLNERKTKLEEALNLAMEF
HNSLQDFINWLTQAEQTLNVASRPSLILDTVLFQIDEHKVFANEVNSHREQIIELDKTGT
HLKYFSQKQDVVLIKNLLISVQSRWEKVVQRLVERGRSLDDARKRAKQFHEAWSKLMEWL
EESEKSLDSELEIANDPDKIKTQLAQHKEFQKSLGAKHSVYDTTNRTGRSLKEKTSLADD
NLKLDDMLSELRDKWDTICGKSVERQNKLEEALLFSGQFTDALQALIDWLYRVEPQLAED
QPVHGDIDLVMNLIDNHKAFQKELGKRTSSVQALKRSARELIEGSRDDSSWVKVQMQELS
TRWETVCALSISKQTRLEAALRQAEEFHSVVHALLEWLAEAEQTLRFHGVLPDDEDALRT
LIDQHKEFMKKLEEKRAELNKATTMGDTVLAICHPDSITTIKHWITIIRARFEEVLAWAK
QHQQRLASALAGLIAKQELLEALLAWLQWAETTLTDKDKEVIPQEIEEVKALIAEHQTFM
EEMTRKQPDVDKVTKTYKRRAADPSSLQSHIPVLDKGRAGRKRFPASSLYPSGSQTQIET
KNPRVNLLVSKWQQVWLLALERRRKLNDALDRLEELREFANFDFDIWRKKYMRWMNHKKS
RVMDFFRRIDKDQDGKITRQEFIDGILSSKFPTSRLEMSAVADIFDRDGDGYIDYYEFVA
ALHPNKDAYKPITDADKIEDEVTRQVAKCKCAKRFQVEQIGDNKYRFFLGNQFGDSQQLR
LVRILRSTVMVRVGGGWMALDEFLVKNDPCRVHHHGSKMLRSESNSSITTTQPTIAKGRT
NMELREKFILADGASQGMAAFRPRGRRSRPSSRGASPNRSTSVSSQAAQAASPQVPATTT
PKGTPIQGSKLRLPGYLSGKGFHSGEDSGLITTAAARVRTQFADSKKTPSRPGSRAGSKA
GSRASSRRGSDASDFDISEIQSVCSDVETVPQTHRPTPRAGSRPSTAKPSKIPTPQRKSP
ASKLDKSSKR
Function
Cytoskeletal linker protein. Acts as an integrator of intermediate filaments, actin and microtubule cytoskeleton networks. Required for anchoring either intermediate filaments to the actin cytoskeleton in neural and muscle cells or keratin-containing intermediate filaments to hemidesmosomes in epithelial cells. The proteins may self-aggregate to form filaments or a two-dimensional mesh. Regulates the organization and stability of the microtubule network of sensory neurons to allow axonal transport. Mediates docking of the dynein/dynactin motor complex to vesicle cargos for retrograde axonal transport through its interaction with TMEM108 and DCTN1; [Isoform 3]: Plays a structural role in the assembly of hemidesmosomes of epithelial cells; anchors keratin-containing intermediate filaments to the inner plaque of hemidesmosomes. Required for the regulation of keratinocyte polarity and motility; mediates integrin ITGB4 regulation of RAC1 activity.; [Isoform 6]: Required for bundling actin filaments around the nucleus; [Isoform 7]: Regulates the organization and stability of the microtubule network of sensory neurons to allow axonal transport.
Tissue Specificity Isoform 1 is expressed in myoblasts (at protein level). Isoform 3 is expressed in the skin. Isoform 6 is expressed in the brain. Highly expressed in skeletal muscle and cultured keratinocytes.
Reactome Pathway
RHOU GTPase cycle (R-HSA-9013420 )
RHOV GTPase cycle (R-HSA-9013424 )
RND3 GTPase cycle (R-HSA-9696264 )
RND2 GTPase cycle (R-HSA-9696270 )
RND1 GTPase cycle (R-HSA-9696273 )
Type I hemidesmosome assembly (R-HSA-446107 )

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Hereditary sensory and autonomic neuropathy type 6 DIS0MINU Definitive Autosomal recessive [1]
Neoplasm DISZKGEW Definitive Biomarker [2]
Adenocarcinoma DIS3IHTY Strong Altered Expression [3]
Advanced cancer DISAT1Z9 Strong Biomarker [4]
Alzheimer disease DISF8S70 Strong Biomarker [5]
Autism spectrum disorder DISXK8NV Strong Biomarker [6]
Autoimmune disease DISORMTM Strong Altered Expression [7]
Colon cancer DISVC52G Strong Biomarker [8]
Colon carcinoma DISJYKUO Strong Biomarker [8]
Colonic neoplasm DISSZ04P Strong Biomarker [9]
Dementia DISXL1WY Strong Biomarker [10]
Depression DIS3XJ69 Strong Biomarker [11]
Dystonia DISJLFGW Strong Genetic Variation [12]
Epidermolysis bullosa simplex DIS2CZ6X Strong Genetic Variation [13]
Epidermolysis bullosa simplex 3, localized or generalized intermediate, with BP230 deficiency DISUXSR3 Strong Autosomal recessive [14]
Head-neck squamous cell carcinoma DISF7P24 Strong Biomarker [15]
High blood pressure DISY2OHH Strong Genetic Variation [16]
Major depressive disorder DIS4CL3X Strong Biomarker [17]
Metabolic disorder DIS71G5H Strong Biomarker [18]
Nasopharyngeal carcinoma DISAOTQ0 Strong Biomarker [19]
Non-insulin dependent diabetes DISK1O5Z Strong Genetic Variation [16]
Obesity DIS47Y1K Strong Biomarker [20]
Oral cancer DISLD42D Strong Biomarker [2]
Schizophrenia DISSRV2N Strong Genetic Variation [21]
Skin disease DISDW8R6 Strong Biomarker [22]
Systemic lupus erythematosus DISI1SZ7 Strong Biomarker [23]
Tuberculosis DIS2YIMD Strong Genetic Variation [24]
Type-1/2 diabetes DISIUHAP Strong Biomarker [5]
Uterine fibroids DISBZRMJ Strong Biomarker [25]
Bullous pemphigoid DISOJLKV moderate Biomarker [26]
Hereditary sensory and autonomic neuropathy DIS2VOAM moderate Genetic Variation [12]
Pancreatic cancer DISJC981 moderate Biomarker [27]
Epidermolysis bullosa DISVOTZQ Disputed Genetic Variation [28]
Multiple sclerosis DISB2WZI Disputed Genetic Variation [29]
Nephropathy DISXWP4P Disputed Biomarker [30]
Adult glioblastoma DISVP4LU Limited Biomarker [31]
Breast cancer DIS7DPX1 Limited Biomarker [32]
Breast carcinoma DIS2UE88 Limited Biomarker [32]
Bulimia nervosa DISGQ59Y Limited Biomarker [33]
Glioblastoma multiforme DISK8246 Limited Biomarker [31]
Melanoma DIS1RRCY Limited Biomarker [34]
Nervous system disease DISJ7GGT Limited Biomarker [35]
Parkinson disease DISQVHKL Limited Genetic Variation [36]
Prostate cancer DISF190Y Limited Genetic Variation [32]
Prostate carcinoma DISMJPLE Limited Genetic Variation [32]
Rheumatoid arthritis DISTSB4J Limited Genetic Variation [37]
Squamous cell carcinoma DISQVIFL Limited Altered Expression [3]
------------------------------------------------------------------------------------
⏷ Show the Full List of 47 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 2 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Cisplatin DMRHGI9 Approved Dystonin (DST) affects the response to substance of Cisplatin. [67]
Fluorouracil DMUM7HZ Approved Dystonin (DST) affects the response to substance of Fluorouracil. [67]
------------------------------------------------------------------------------------
6 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Dystonin (DST). [38]
Quercetin DM3NC4M Approved Quercetin increases the phosphorylation of Dystonin (DST). [45]
Fulvestrant DM0YZC6 Approved Fulvestrant increases the methylation of Dystonin (DST). [50]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Dystonin (DST). [45]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of Dystonin (DST). [62]
Coumarin DM0N8ZM Investigative Coumarin decreases the phosphorylation of Dystonin (DST). [45]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)
25 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Dystonin (DST). [39]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Dystonin (DST). [40]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Dystonin (DST). [41]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Dystonin (DST). [42]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Dystonin (DST). [43]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Dystonin (DST). [44]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Dystonin (DST). [46]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Dystonin (DST). [47]
Progesterone DMUY35B Approved Progesterone decreases the expression of Dystonin (DST). [48]
Panobinostat DM58WKG Approved Panobinostat decreases the expression of Dystonin (DST). [49]
Folic acid DMEMBJC Approved Folic acid decreases the expression of Dystonin (DST). [51]
Bortezomib DMNO38U Approved Bortezomib increases the expression of Dystonin (DST). [52]
Irinotecan DMP6SC2 Approved Irinotecan decreases the expression of Dystonin (DST). [53]
Indomethacin DMSC4A7 Approved Indomethacin decreases the expression of Dystonin (DST). [54]
Melphalan DMOLNHF Approved Melphalan decreases the expression of Dystonin (DST). [55]
Clorgyline DMCEUJD Approved Clorgyline increases the expression of Dystonin (DST). [56]
Tamibarotene DM3G74J Phase 3 Tamibarotene decreases the expression of Dystonin (DST). [40]
Seocalcitol DMKL9QO Phase 3 Seocalcitol increases the expression of Dystonin (DST). [58]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Dystonin (DST). [59]
Geldanamycin DMS7TC5 Discontinued in Phase 2 Geldanamycin increases the expression of Dystonin (DST). [60]
Torcetrapib DMDHYM7 Discontinued in Phase 2 Torcetrapib increases the expression of Dystonin (DST). [61]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Dystonin (DST). [63]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Dystonin (DST). [64]
GALLICACID DM6Y3A0 Investigative GALLICACID decreases the expression of Dystonin (DST). [65]
4-hydroxy-2-nonenal DM2LJFZ Investigative 4-hydroxy-2-nonenal decreases the expression of Dystonin (DST). [66]
------------------------------------------------------------------------------------
⏷ Show the Full List of 25 Drug(s)
1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ximelegatran DMU8ANS Approved Ximelegatran affects the localization of Dystonin (DST). [57]
------------------------------------------------------------------------------------

References

1 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
2 Boron neutron capture therapy (BNCT) translational studies in the hamster cheek pouch model of oral cancer at the new "B2" configuration of the RA-6 nuclear reactor.Radiat Environ Biophys. 2017 Nov;56(4):377-387. doi: 10.1007/s00411-017-0710-9. Epub 2017 Sep 4.
3 Differential gene expression in human lung adenocarcinomas and squamous cell carcinomas.Clin Cancer Res. 2002 Apr;8(4):1127-38.
4 Mucus and adiponectin deficiency: role in chronic inflammation-induced colon cancer.Int J Colorectal Dis. 2013 Sep;28(9):1267-79. doi: 10.1007/s00384-013-1664-2. Epub 2013 Mar 9.
5 Dystonin/BPAG1 modulates diabetes and Alzheimer's disease cross-talk: a meta-analysis.Neurol Sci. 2019 Aug;40(8):1577-1582. doi: 10.1007/s10072-019-03879-3. Epub 2019 Apr 8.
6 The association of environmental toxicants and autism spectrum disorders in children.Environ Pollut. 2017 Aug;227:234-242. doi: 10.1016/j.envpol.2017.04.039. Epub 2017 May 2.
7 The effects of bisphenol A on some plasma cytokine levels and distribution of CD8(+) and CD4(+) T lymphocytes in spleen, ileal Peyer's patch and bronchus associated lymphoid tissue in rats.Acta Histochem. 2018 Nov;120(8):728-733. doi: 10.1016/j.acthis.2018.08.002. Epub 2018 Aug 11.
8 Construing the Biochemical and Molecular Mechanism Underlying the In Vivo and In Vitro Chemotherapeutic Efficacy of Ruthenium-Baicalein Complex in Colon Cancer.Int J Biol Sci. 2019 Apr 22;15(5):1052-1071. doi: 10.7150/ijbs.31143. eCollection 2019.
9 Genetic analysis of colon cancer susceptibility in mice.Genomics. 1994 Jul 15;22(2):381-7. doi: 10.1006/geno.1994.1399.
10 Biological predictors shared by dementia and bullous pemphigoid patients point out a cross-antigenicity between BP180/BP230 brain and skin isoforms.Immunol Res. 2018 Oct;66(5):567-576. doi: 10.1007/s12026-018-9028-1.
11 Objective and Subjective Cognitive Problems among Caregivers and Matched Non-caregivers.Gerontologist. 2017 Aug 1;57(4):637-647. doi: 10.1093/geront/gnv690.
12 Characterization of gastrointestinal pathologies in the dystonia musculorum mouse model for hereditary sensory and autonomic neuropathy type VI.Neurogastroenterol Motil. 2020 Apr;32(4):e13773. doi: 10.1111/nmo.13773. Epub 2019 Dec 9.
13 Expanding the phenotype of DST-related disorder: A case report suggesting a genotype/phenotype correlation.Am J Med Genet A. 2017 Oct;173(10):2743-2746. doi: 10.1002/ajmg.a.38367. Epub 2017 Aug 2.
14 The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
15 Expression microarray analysis reveals alternative splicing of LAMA3 and DST genes in head and neck squamous cell carcinoma.PLoS One. 2014 Mar 27;9(3):e91263. doi: 10.1371/journal.pone.0091263. eCollection 2014.
16 Cortisol Secretion, Sensitivity, and Activity Are Associated With Hypertension in Postmenopausal Eucortisolemic Women.J Clin Endocrinol Metab. 2019 Oct 1;104(10):4441-4448. doi: 10.1210/jc.2019-00037.
17 The role of psychosocial and biological variables in separating chronic and non-chronic major depression and early-late-onset dysthymia.J Affect Disord. 1994 Sep;32(1):1-11. doi: 10.1016/0165-0327(94)90055-8.
18 Effects of perinatal exposure to BPA, BPF and BPAF on liver function in male mouse offspring involving in oxidative damage and metabolic disorder.Environ Pollut. 2019 Apr;247:935-943. doi: 10.1016/j.envpol.2019.01.116. Epub 2019 Jan 30.
19 Reexploring the possible roles of some genes associated with nasopharyngeal carcinoma using microarray-based detection.Acta Biochim Biophys Sin (Shanghai). 2005 Aug;37(8):541-6. doi: 10.1111/j.1745-7270.2005.00074.x.
20 Bisphenol A, phthalate metabolites and glucose homeostasis in healthy normal-weight children.Endocr Connect. 2018 Jan;7(1):232-238. doi: 10.1530/EC-17-0344. Epub 2017 Dec 13.
21 Evidence of association of the DISC1 interactome gene set with schizophrenia from GWAS.Prog Neuropsychopharmacol Biol Psychiatry. 2019 Dec 20;95:109729. doi: 10.1016/j.pnpbp.2019.109729. Epub 2019 Aug 6.
22 Neurodegenerative disorders, bullous pemphigoid and psoriasis: a comparative study in ethnic Poles indicates that Parkinson's disease is more relevant to bullous pemphigoid.Postepy Dermatol Alergol. 2017 Feb;34(1):42-46. doi: 10.5114/ada.2017.65619. Epub 2017 Feb 7.
23 Bisphenol A modified DNA: A possible immunogenic stimulus for anti-DNA autoantibodies in systemic lupus erythematosus.Autoimmunity. 2019 Nov-Dec;52(7-8):272-280. doi: 10.1080/08916934.2019.1683545. Epub 2019 Oct 26.
24 Disputed rpoB mutations can frequently cause important rifampicin resistance among new tuberculosis patients.Int J Tuberc Lung Dis. 2015 Feb;19(2):185-90. doi: 10.5588/ijtld.14.0651.
25 Bisphenol A induces human uterine leiomyoma cell proliferation through membrane-associated ER36 via nongenomic signaling pathways. Mol Cell Endocrinol. 2019 Mar 15;484:59-68. doi: 10.1016/j.mce.2019.01.001. Epub 2019 Jan 4.
26 Development of bullous pemphigoid in junctional epidermolysis bullosa.J Eur Acad Dermatol Venereol. 2020 Mar;34(3):e146-e148. doi: 10.1111/jdv.16057. Epub 2020 Feb 13.
27 Collagen gel droplet-embedded culture drug sensitivity test (CD-DST) predicts the effect of adjuvant chemotherapy on pancreatic cancer.Surg Today. 2019 Dec;49(12):1035-1043. doi: 10.1007/s00595-019-01842-5. Epub 2019 Jul 2.
28 BPAG1, a distinctive role in skin and neurological diseases.Semin Cell Dev Biol. 2017 Sep;69:34-39. doi: 10.1016/j.semcdb.2017.06.005. Epub 2017 Jun 13.
29 Bullous pemphigoid antigen 1 isoforms: potential new target autoantigens in multiple sclerosis?.Br J Dermatol. 2005 Mar;152(3):537-40. doi: 10.1111/j.1365-2133.2004.06338.x.
30 Extrarenal effects on the pathogenesis and relapse of idiopathic nephrotic syndrome in Buffalo/Mna rats.J Clin Invest. 2002 Feb;109(4):491-8. doi: 10.1172/JCI12858.
31 Impact of oxygen status on 10B-BPA uptake into human glioblastoma cells, referring to significance in boron neutron capture therapy.J Radiat Res. 2018 Mar 1;59(2):122-128. doi: 10.1093/jrr/rrx080.
32 Exposure to bisphenol A: current levels from food intake are toxic to human cells.Mol Biol Rep. 2019 Apr;46(2):2555-2559. doi: 10.1007/s11033-019-04666-1. Epub 2019 Feb 7.
33 The dexamethasone suppression test in bulimia: nonsuppression associated with depression and suboptimal weight.J Clin Psychiatry. 1988 Mar;49(3):94-6.
34 The Barrier Molecules Junction Plakoglobin, Filaggrin, and Dystonin Play Roles in Melanoma Growth and Angiogenesis.Ann Surg. 2019 Oct;270(4):712-722. doi: 10.1097/SLA.0000000000003522.
35 Bullous pemphigoid in a leg affected with hemiparesia: a possible relation of neurological diseases with bullous pemphigoid?.Eur J Dermatol. 2001 May-Jun;11(3):230-3.
36 Leucine-rich repeat kinase 2 and alternative splicing in Parkinson's disease.Mov Disord. 2012 Jul;27(8):1004-11. doi: 10.1002/mds.25005. Epub 2012 Apr 23.
37 Simultaneous evaluation of in vivo glucocorticoid sensitivity and expression of glucocorticoid receptor alpha-isoform in rheumatoid arthritis patients.Arq Bras Endocrinol Metabol. 2009 Feb;53(1):24-30. doi: 10.1590/s0004-27302009000100005.
38 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
39 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
40 Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
41 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
42 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
43 Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
44 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
45 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
46 Chronic occupational exposure to arsenic induces carcinogenic gene signaling networks and neoplastic transformation in human lung epithelial cells. Toxicol Appl Pharmacol. 2012 Jun 1;261(2):204-16.
47 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
48 Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
49 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
50 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
51 Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
52 Bortezomib induces caspase-dependent apoptosis in Hodgkin lymphoma cell lines and is associated with reduced c-FLIP expression: a gene expression profiling study with implications for potential combination therapies. Leuk Res. 2008 Feb;32(2):275-85. doi: 10.1016/j.leukres.2007.05.024. Epub 2007 Jul 19.
53 Clinical determinants of response to irinotecan-based therapy derived from cell line models. Clin Cancer Res. 2008 Oct 15;14(20):6647-55.
54 Mechanisms of indomethacin-induced alterations in the choline phospholipid metabolism of breast cancer cells. Neoplasia. 2006 Sep;8(9):758-71.
55 Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
56 Anti-oncogenic and pro-differentiation effects of clorgyline, a monoamine oxidase A inhibitor, on high grade prostate cancer cells. BMC Med Genomics. 2009 Aug 20;2:55. doi: 10.1186/1755-8794-2-55.
57 Myosin-mediated cytoskeleton contraction and Rho GTPases regulate laminin-5 matrix assembly. Cell Motil Cytoskeleton. 2004 Feb;57(2):107-17. doi: 10.1002/cm.10161.
58 Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
59 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
60 Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
61 Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
62 Expression and DNA methylation changes in human breast epithelial cells after bisphenol A exposure. Int J Oncol. 2012 Jul;41(1):369-77.
63 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
64 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
65 Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.
66 Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
67 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.