Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIOZQAB)

• DOT Name: Extracellular superoxide dismutase (SOD3)
• Synonyms: EC-SOD; EC 1.15.1.1
• Gene Name: SOD3
• Related Disease:
  Chronic kidney disease
  Diabetic kidney disease
  Nephropathy
  Type-1/2 diabetes
  Alzheimer disease
  Arteriosclerosis
  Atherosclerosis
  Autism spectrum disorder
  Autoimmune disease
  Breast cancer
  Breast carcinoma
  Cardiac failure
  Cerebral infarction
  Chronic obstructive pulmonary disease
  Congestive heart failure
  Contact dermatitis
  Dermatitis
  Glioma
  High blood pressure
  Inflammatory bowel disease
  Myocardial ischemia
  Neoplasm
  Obesity
  Pancreatic cancer
  Parkinson disease
  Prostate cancer
  Prostate carcinoma
  Psoriasis
  Retinitis pigmentosa
  Rheumatoid arthritis
  Thyroid cancer
  Thyroid gland carcinoma
  Triple negative breast cancer
  Advanced cancer
  Cardiovascular disease
  Non-insulin dependent diabetes
  Thyroid tumor
  Thyroid gland papillary carcinoma
  Type-1 diabetes
  Amyotrophic lateral sclerosis
  Asthma
  B-cell lymphoma
  Coronary atherosclerosis
  Coronary heart disease
  Myocardial infarction
  Neuroblastoma
  Osteoarthritis
  Pulmonary fibrosis
• UniProt ID: SODE_HUMAN
• PDB ID: 2JLP
• EC Number: 1.15.1.1
• Pfam ID: PF00080
• Sequence:
  MLALLCSCLLLAAGASDAWTGEDSAEPNSDSAEWIRDMYAKVTEIWQEVMQRRDDDGALH
  AACQVQPSATLDAAQPRVTGVVLFRQLAPRAKLDAFFALEGFPTEPNSSSRAIHVHQFGD
  LSQGCESTGPHYNPLAVPHPQHPGDFGNFAVRDGSLWRYRAGLAASLAGPHSIVGRAVVV
  HAGEDDLGRGGNQASVENGNAGRRLACCVVGVCGPGLWERQAREHSERKKRRRESECKAA
• Function: Protect the extracellular space from toxic effect of reactive oxygen intermediates by converting superoxide radicals into hydrogen peroxide and oxygen.
• Tissue Specificity: Expressed in blood vessels, heart, lung, kidney and placenta. Major SOD isoenzyme in extracellular fluids such as plasma, lymph and synovial fluid.
• Reactome Pathway:
  NFE2L2 regulating anti-oxidant/detoxification enzymes (R-HSA-9818027)
  Detoxification of Reactive Oxygen Species (R-HSA-3299685)
• BioCyc Pathway: MetaCyc:HS03242-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Chronic kidney disease	DISW82R7	Definitive	Altered Expression	[1]
Diabetic kidney disease	DISJMWEY	Definitive	Altered Expression	[1]
Nephropathy	DISXWP4P	Definitive	Biomarker	[1]
Type-1/2 diabetes	DISIUHAP	Definitive	Altered Expression	[1]
Alzheimer disease	DISF8S70	Strong	Biomarker	[2]
Arteriosclerosis	DISK5QGC	Strong	Genetic Variation	[3]
Atherosclerosis	DISMN9J3	Strong	Genetic Variation	[3]
Autism spectrum disorder	DISXK8NV	Strong	Biomarker	[4]
Autoimmune disease	DISORMTM	Strong	Biomarker	[5]
Breast cancer	DIS7DPX1	Strong	Posttranslational Modification	[6]
Breast carcinoma	DIS2UE88	Strong	Posttranslational Modification	[6]
Cardiac failure	DISDC067	Strong	Genetic Variation	[7]
Cerebral infarction	DISR1WNP	Strong	Biomarker	[8]
Chronic obstructive pulmonary disease	DISQCIRF	Strong	Altered Expression	[9]
Congestive heart failure	DIS32MEA	Strong	Genetic Variation	[7]
Contact dermatitis	DISQ3AU0	Strong	Therapeutic	[10]
Dermatitis	DISY5SZC	Strong	Biomarker	[11]
Glioma	DIS5RPEH	Strong	Genetic Variation	[12]
High blood pressure	DISY2OHH	Strong	Altered Expression	[9]
Inflammatory bowel disease	DISGN23E	Strong	Altered Expression	[9]
Myocardial ischemia	DISFTVXF	Strong	Genetic Variation	[13]
Neoplasm	DISZKGEW	Strong	Altered Expression	[14]
Obesity	DIS47Y1K	Strong	Biomarker	[15]
Pancreatic cancer	DISJC981	Strong	Genetic Variation	[16]
Parkinson disease	DISQVHKL	Strong	Genetic Variation	[17]
Prostate cancer	DISF190Y	Strong	Biomarker	[18]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[18]
Psoriasis	DIS59VMN	Strong	Altered Expression	[19]
Retinitis pigmentosa	DISCGPY8	Strong	Altered Expression	[20]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[21]
Thyroid cancer	DIS3VLDH	Strong	Altered Expression	[22]
Thyroid gland carcinoma	DISMNGZ0	Strong	Altered Expression	[22]
Triple negative breast cancer	DISAMG6N	Strong	Biomarker	[23]
Advanced cancer	DISAT1Z9	moderate	Biomarker	[23]
Cardiovascular disease	DIS2IQDX	moderate	Biomarker	[24]
Non-insulin dependent diabetes	DISK1O5Z	moderate	Biomarker	[1]
Thyroid tumor	DISLVKMD	moderate	Biomarker	[25]
Thyroid gland papillary carcinoma	DIS48YMM	Disputed	Altered Expression	[25]
Type-1 diabetes	DIS7HLUB	Disputed	Altered Expression	[26]
Amyotrophic lateral sclerosis	DISF7HVM	Limited	Biomarker	[27]
Asthma	DISW9QNS	Limited	Genetic Variation	[28]
B-cell lymphoma	DISIH1YQ	Limited	Biomarker	[29]
Coronary atherosclerosis	DISKNDYU	Limited	Genetic Variation	[30]
Coronary heart disease	DIS5OIP1	Limited	Genetic Variation	[30]
Myocardial infarction	DIS655KI	Limited	Genetic Variation	[31]
Neuroblastoma	DISVZBI4	Limited	Biomarker	[32]
Osteoarthritis	DIS05URM	Limited	Biomarker	[33]
Pulmonary fibrosis	DISQKVLA	Limited	Biomarker	[34]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Extracellular superoxide dismutase (SOD3).	[35]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Extracellular superoxide dismutase (SOD3).	[48]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Extracellular superoxide dismutase (SOD3).	[50]

24 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Extracellular superoxide dismutase (SOD3).	[36]
Doxorubicin	DMVP5YE	Approved	Doxorubicin affects the expression of Extracellular superoxide dismutase (SOD3).	[37]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Extracellular superoxide dismutase (SOD3).	[38]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Extracellular superoxide dismutase (SOD3).	[39]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Extracellular superoxide dismutase (SOD3).	[40]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Extracellular superoxide dismutase (SOD3).	[41]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Extracellular superoxide dismutase (SOD3).	[42]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Extracellular superoxide dismutase (SOD3).	[43]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Extracellular superoxide dismutase (SOD3).	[44]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Extracellular superoxide dismutase (SOD3).	[45]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Extracellular superoxide dismutase (SOD3).	[46]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene decreases the expression of Extracellular superoxide dismutase (SOD3).	[36]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of Extracellular superoxide dismutase (SOD3).	[46]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Extracellular superoxide dismutase (SOD3).	[46]
DNCB	DMDTVYC	Phase 2	DNCB increases the expression of Extracellular superoxide dismutase (SOD3).	[47]
Disulfiram	DMCL2OK	Phase 2 Trial	Disulfiram increases the expression of Extracellular superoxide dismutase (SOD3).	[47]
Puerarin	DMJIMXH	Phase 2	Puerarin decreases the expression of Extracellular superoxide dismutase (SOD3).	[46]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Extracellular superoxide dismutase (SOD3).	[49]
Eugenol	DM7US1H	Patented	Eugenol increases the expression of Extracellular superoxide dismutase (SOD3).	[47]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Extracellular superoxide dismutase (SOD3).	[51]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of Extracellular superoxide dismutase (SOD3).	[52]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Extracellular superoxide dismutase (SOD3).	[40]
ELLAGIC ACID	DMX8BS5	Investigative	ELLAGIC ACID decreases the expression of Extracellular superoxide dismutase (SOD3).	[53]
Chlorogenic acid	DM2Y3P4	Investigative	Chlorogenic acid decreases the expression of Extracellular superoxide dismutase (SOD3).	[46]

References

• [1] Serum and urinary SOD3 in patients with type 2 diabetes: comparison with early chronic kidney disease patients and association with development of diabetic nephropathy.Am J Physiol Renal Physiol. 2019 Jan 1;316(1):F32-F41. doi: 10.1152/ajprenal.00401.2017. Epub 2018 Oct 10.
• [2] Drug Repositioning for Alzheimer's Disease Based on Systematic 'omics' Data Mining.PLoS One. 2016 Dec 22;11(12):e0168812. doi: 10.1371/journal.pone.0168812. eCollection 2016.
• [3] Polymorphic variants of extracellular superoxide dismutase gene in a Romanian population with atheroma.Biochem Genet. 2008 Oct;46(9-10):634-43. doi: 10.1007/s10528-008-9177-3. Epub 2008 Aug 26.
• [4] Rare single nucleotide polymorphisms in the regulatory regions of the superoxide dismutase genes in autism spectrum disorder.Autism Res. 2014 Feb;7(1):138-44. doi: 10.1002/aur.1345. Epub 2013 Oct 23.
• [5] Enhanced therapeutic effects of human mesenchymal stem cells transduced with superoxide dismutase 3 in a murine atopic dermatitis-like skin inflammation model.Allergy. 2018 Dec;73(12):2364-2376. doi: 10.1111/all.13594. Epub 2018 Oct 11.
• [6] Artificial neural network-based exploration of gene-nutrient interactions in folate and xenobiotic metabolic pathways that modulate susceptibility to breast cancer.Gene. 2016 Apr 15;580(2):159-168. doi: 10.1016/j.gene.2016.01.023. Epub 2016 Jan 16.
• [7] Genetically Low Antioxidant Protection and Risk of Cardiovascular Disease and Heart Failure in Diabetic Subjects.EBioMedicine. 2015 Nov 14;2(12):2010-5. doi: 10.1016/j.ebiom.2015.11.026. eCollection 2015 Dec.
• [8] Lung-Derived SOD3 Attenuates Neurovascular Injury After Transient Global Cerebral Ischemia.J Am Heart Assoc. 2019 May 7;8(9):e011801. doi: 10.1161/JAHA.118.011801.
• [9] The copper-zinc superoxide dismutase activity in selected diseases.Eur J Clin Invest. 2019 Jan;49(1):e13036. doi: 10.1111/eci.13036. Epub 2018 Nov 6.
• [10] EC-SOD suppresses contact hypersensitivity in mouse skin by impairing Langerhans cell migration.J Invest Dermatol. 2007 Aug;127(8):1930-7. doi: 10.1038/sj.jid.5700802. Epub 2007 Mar 29.
• [11] Superoxide Dismutase 3 Inhibits LL-37/KLK-5-Mediated Skin Inflammation through Modulation of EGFR and Associated Inflammatory Cascades.J Invest Dermatol. 2020 Mar;140(3):656-665.e8. doi: 10.1016/j.jid.2019.08.434. Epub 2019 Aug 26.
• [12] Genetic oxidative stress variants and glioma risk in a Chinese population: a hospital-based case-control study.BMC Cancer. 2012 Dec 22;12:617. doi: 10.1186/1471-2407-12-617.
• [13] SOD3 Variant, R213G, Altered SOD3 Function, Leading to ROS-Mediated Inflammation and Damage in Multiple Organs of Premature Aging Mice.Antioxid Redox Signal. 2015 Oct 20;23(12):985-99. doi: 10.1089/ars.2014.6035. Epub 2015 Jun 2.
• [14] SOD3 improves the tumor response to chemotherapy by stabilizing endothelial HIF-2.Nat Commun. 2018 Feb 8;9(1):575. doi: 10.1038/s41467-018-03079-1.
• [15] SOD3 Is Secreted by Adipocytes and Mitigates High-Fat Diet-Induced Obesity, Inflammation, and Insulin Resistance.Antioxid Redox Signal. 2020 Jan 20;32(3):193-212. doi: 10.1089/ars.2018.7628.
• [16] Superoxide dismutase and nicotinamide adenine dinucleotide phosphate: quinone oxidoreductase polymorphisms and pancreatic cancer risk.Pancreas. 2011 Jan;40(1):72-8. doi: 10.1097/MPA.0b013e3181f74ad7.
• [17] Superoxide dismutase coding of gene polymorphisms associated with susceptibility to Parkinson's disease.J Integr Neurosci. 2019 Sep 30;18(3):299-303. doi: 10.31083/j.jin.2019.03.127.
• [18] SOD3 acts as a tumor suppressor in PC-3 prostate cancer cells via hydrogen peroxide accumulation.Anticancer Res. 2014 Jun;34(6):2821-31.
• [19] Effects of Human Mesenchymal Stem Cells Transduced with Superoxide Dismutase on Imiquimod-Induced Psoriasis-Like Skin Inflammation in Mice.Antioxid Redox Signal. 2016 Feb 10;24(5):233-48. doi: 10.1089/ars.2015.6368. Epub 2015 Nov 18.
• [20] Relationships Between Serum Antioxidant and Oxidant Statuses and Visual Function in Retinitis Pigmentosa.Invest Ophthalmol Vis Sci. 2019 Oct 1;60(13):4462-4468. doi: 10.1167/iovs.19-26927.
• [21] Genetic polymorphisms modifying oxidative stress are associated with disease activity in rheumatoid arthritis patients.Dis Markers. 2009;26(1):41-8. doi: 10.3233/DMA-2009-0603.
• [22] Ras oncogene-mediated progressive silencing of extracellular superoxide dismutase in tumorigenesis.Biomed Res Int. 2015;2015:780409. doi: 10.1155/2015/780409. Epub 2015 Oct 15.
• [23] Use of Antimetastatic SOD3-Mimetic Albumin as a Primer in Triple Negative Breast Cancer.J Oncol. 2019 Feb 28;2019:3253696. doi: 10.1155/2019/3253696. eCollection 2019.
• [24] Does SOD3 R213G Homozygosity Influence Morbidity, Mortality, and Lung Function in the General Population?.Antioxid Redox Signal. 2016 May 20;24(15):884-91. doi: 10.1089/ars.2016.6629. Epub 2016 Feb 22.
• [25] Extracellular Superoxide Dismutase Expression in Papillary Thyroid Cancer Mesenchymal Stem/Stromal Cells Modulates Cancer Cell Growth and Migration.Sci Rep. 2017 Feb 20;7:41416. doi: 10.1038/srep41416.
• [26] Akt2 (Protein Kinase B Beta) Stabilizes ATP7A, a Copper Transporter for Extracellular Superoxide Dismutase, in Vascular Smooth Muscle: Novel Mechanism to Limit Endothelial Dysfunction in Type 2 Diabetes Mellitus.Arterioscler Thromb Vasc Biol. 2018 Mar;38(3):529-541. doi: 10.1161/ATVBAHA.117.309819. Epub 2018 Jan 4.
• [27] Mutation analyses in amyotrophic lateral sclerosis/parkinsonism-dementia complex of the Kii peninsula, Japan.Mov Disord. 2008 Dec 15;23(16):2344-8. doi: 10.1002/mds.22262.
• [28] Two functional variants of the superoxide dismutase genes in Finnish families with asthma.Thorax. 2004 Feb;59(2):116-9. doi: 10.1136/thorax.2003.005611.
• [29] A redox signature score identifies diffuse large B-cell lymphoma patients with a poor prognosis.Blood. 2005 Nov 15;106(10):3594-601. doi: 10.1182/blood-2005-02-0487. Epub 2005 Aug 4.
• [30] SOD3 R231G polymorphism associated with coronary artery disease and myocardial infarction. The Ludwigshafen Risk and Cardiovascular Health (LURIC) study.Free Radic Res. 2009 Jul;43(7):677-84. doi: 10.1080/10715760902991763.
• [31] Plasma extracellular superoxide dismutase concentration, allelic variations in the SOD3 gene and risk of myocardial infarction and all-cause mortality in people with type 1 and type 2 diabetes.Cardiovasc Diabetol. 2015 Jan 15;14:845. doi: 10.1186/s12933-014-0163-2.
• [32] SOD3 Ameliorates A(25-35)-Induced Oxidative Damage in SH-SY5Y Cells by Inhibiting the Mitochondrial Pathway.Cell Mol Neurobiol. 2017 Apr;37(3):513-525. doi: 10.1007/s10571-016-0390-z. Epub 2016 Jun 7.
• [33] A small molecule promotes cartilage extracellular matrix generation and inhibits osteoarthritis development.Nat Commun. 2019 Apr 23;10(1):1914. doi: 10.1038/s41467-019-09839-x.
• [34] Role of SOD3 in silica-related lung fibrosis and pulmonary vascular remodeling.Respir Res. 2018 Nov 20;19(1):221. doi: 10.1186/s12931-018-0933-6.
• [35] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [36] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [37] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [38] Mechanism of cisplatin proximal tubule toxicity revealed by integrating transcriptomics, proteomics, metabolomics and biokinetics. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):117-27.
• [39] Natural antioxidants exhibit chemopreventive characteristics through the regulation of CNC b-Zip transcription factors in estrogen-induced breast carcinogenesis. J Biochem Mol Toxicol. 2014 Dec;28(12):529-38.
• [40] Quercetin reduces oxidative damage induced by paraquat via modulating expression of antioxidant genes in A549 cells. J Appl Toxicol. 2013 Dec;33(12):1460-7. doi: 10.1002/jat.2812. Epub 2012 Sep 20.
• [41] A comprehensive analysis of Wnt/beta-catenin signaling pathway-related genes and crosstalk pathways in the treatment of As2O3 in renal cancer. Ren Fail. 2018 Nov;40(1):331-339.
• [42] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [43] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [44] Functional gene expression profile underlying methotrexate-induced senescence in human colon cancer cells. Tumour Biol. 2011 Oct;32(5):965-76.
• [45] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [46] Examining the genomic influence of skin antioxidants in vitro. Mediators Inflamm. 2010;2010.
• [47] Keratinocyte gene expression profiles discriminate sensitizing and irritating compounds. Toxicol Sci. 2010 Sep;117(1):81-9.
• [48] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [49] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [50] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [51] Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.
• [52] In vitro gene expression data supporting a DNA non-reactive genotoxic mechanism for ochratoxin A. Toxicol Appl Pharmacol. 2007 Apr 15;220(2):216-24.
• [53] Interactive gene expression pattern in prostate cancer cells exposed to phenolic antioxidants. Life Sci. 2002 Mar 1;70(15):1821-39.