Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNQQWFJ)

• DOT Name: Bcl-2-like protein 11 (BCL2L11)
• Synonyms: Bcl2-L-11; Bcl2-interacting mediator of cell death
• Gene Name: BCL2L11
• Related Disease:
  Small lymphocytic lymphoma
  Acute lymphocytic leukaemia
  Acute monocytic leukemia
  Adenoma
  Adult glioblastoma
  Adult lymphoma
  Alzheimer disease
  B-cell neoplasm
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Childhood acute lymphoblastic leukemia
  Colon cancer
  Epithelial ovarian cancer
  Familial prostate carcinoma
  Glioblastoma multiforme
  Glucocorticoid resistance
  Hepatocellular carcinoma
  Lymphoma
  Mantle cell lymphoma
  Neoplasm
  Neuroblastoma
  Non-hodgkin lymphoma
  Obesity
  Osteosarcoma
  Ovarian cancer
  Pancreatic cancer
  Pediatric lymphoma
  Primary sclerosing cholangitis
  Prostate cancer, hereditary, 1
  Prostate carcinoma
  Tuberous sclerosis
  Gastric cancer
  Lung adenocarcinoma
  Neuroendocrine neoplasm
  Stomach cancer
  Melanoma
  Acute myelogenous leukaemia
  Autoimmune disease
  Burkitt lymphoma
  Colorectal carcinoma
  Follicular lymphoma
  Non-insulin dependent diabetes
  Plasma cell myeloma
  Sclerosing cholangitis
  Small-cell lung cancer
• UniProt ID: B2L11_HUMAN
• PDB ID: 1F95 ; 2K7W ; 2NL9 ; 2V6Q ; 2VM6 ; 2WH6 ; 2YQ6 ; 2YQ7 ; 3D7V ; 3FDL ; 3IO8 ; 3IO9 ; 3KJ0 ; 3KJ1 ; 3KJ2 ; 4A1U ; 4A1W ; 4B4S ; 4D2M ; 4QVF ; 4UF3 ; 4YJ4 ; 4ZIE ; 4ZIF ; 4ZIH ; 5AGW ; 5AGX ; 5C3G ; 5VWV ; 5VWW ; 5VWX ; 5VWY ; 5VWZ ; 5VX0 ; 5VX2 ; 5VX3 ; 5WOS ; 6QFI ; 6RJP ; 6TQQ ; 6UA3 ; 6UAB ; 6VBX ; 6X8O
• Pfam ID: PF08945 ; PF06773
• Sequence:
  MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSP
  QGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPP
  CQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPR
  MVILRLLRYIVRLVWRMH
• Function: Induces apoptosis and anoikis. Isoform BimL is more potent than isoform BimEL. Isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3 induce apoptosis, although less potent than isoform BimEL, isoform BimL and isoform BimS. Isoform Bim-gamma induces apoptosis. Isoform Bim-alpha3 induces apoptosis possibly through a caspase-mediated pathway. Isoform BimAC and isoform BimABC lack the ability to induce apoptosis.
• Tissue Specificity: Isoform BimEL, isoform BimL and isoform BimS are the predominant isoforms and are widely expressed with tissue-specific variation. Isoform Bim-gamma is most abundantly expressed in small intestine and colon, and in lower levels in spleen, prostate, testis, heart, liver and kidney.
• KEGG Pathway:
  EGFR tyrosine ki.se inhibitor resistance (hsa01521)
  FoxO sig.ling pathway (hsa04068)
  PI3K-Akt sig.ling pathway (hsa04151)
  Apoptosis (hsa04210)
  Apoptosis - multiple species (hsa04215)
  Non-alcoholic fatty liver disease (hsa04932)
  Epstein-Barr virus infection (hsa05169)
  Pathways in cancer (hsa05200)
  MicroR.s in cancer (hsa05206)
  Colorectal cancer (hsa05210)
• Reactome Pathway:
  BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members (R-HSA-111453)
  NRAGE signals death through JNK (R-HSA-193648)
  Signaling by BRAF and RAF1 fusions (R-HSA-6802952)
  Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models (R-HSA-8862803)
  RUNX3 regulates BCL2L11 (BIM) transcription (R-HSA-8952158)
  FLT3 Signaling (R-HSA-9607240)
  FOXO-mediated transcription of cell death genes (R-HSA-9614657)
  Activation of BIM and translocation to mitochondria (R-HSA-111446)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Small lymphocytic lymphoma	DIS30POX	Definitive	Biomarker	[1]
Acute lymphocytic leukaemia	DISPX75S	Strong	Biomarker	[2]
Acute monocytic leukemia	DIS28NEL	Strong	Biomarker	[3]
Adenoma	DIS78ZEV	Strong	Biomarker	[4]
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[5]
Adult lymphoma	DISK8IZR	Strong	Biomarker	[6]
Alzheimer disease	DISF8S70	Strong	Altered Expression	[7]
B-cell neoplasm	DISVY326	Strong	Genetic Variation	[8]
Bone osteosarcoma	DIST1004	Strong	Biomarker	[9]
Breast cancer	DIS7DPX1	Strong	Biomarker	[10]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[11]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[12]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Strong	Biomarker	[13]
Colon cancer	DISVC52G	Strong	Biomarker	[14]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[15]
Familial prostate carcinoma	DISL9KNO	Strong	Biomarker	[16]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[5]
Glucocorticoid resistance	DIS3HNXT	Strong	Biomarker	[2]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[17]
Lymphoma	DISN6V4S	Strong	Biomarker	[6]
Mantle cell lymphoma	DISFREOV	Strong	Biomarker	[18]
Neoplasm	DISZKGEW	Strong	Altered Expression	[17]
Neuroblastoma	DISVZBI4	Strong	Biomarker	[7]
Non-hodgkin lymphoma	DISS2Y8A	Strong	Genetic Variation	[19]
Obesity	DIS47Y1K	Strong	Biomarker	[20]
Osteosarcoma	DISLQ7E2	Strong	Altered Expression	[21]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[15]
Pancreatic cancer	DISJC981	Strong	Biomarker	[22]
Pediatric lymphoma	DIS51BK2	Strong	Biomarker	[6]
Primary sclerosing cholangitis	DISTH5WJ	Strong	Biomarker	[23]
Prostate cancer, hereditary, 1	DISE2P4L	Strong	Biomarker	[16]
Prostate carcinoma	DISMJPLE	Strong	Genetic Variation	[16]
Tuberous sclerosis	DISEMUGZ	Strong	Biomarker	[24]
Gastric cancer	DISXGOUK	moderate	Biomarker	[25]
Lung adenocarcinoma	DISD51WR	moderate	Biomarker	[26]
Neuroendocrine neoplasm	DISNPLOO	moderate	Biomarker	[27]
Stomach cancer	DISKIJSX	moderate	Biomarker	[25]
Melanoma	DIS1RRCY	Disputed	Biomarker	[28]
Acute myelogenous leukaemia	DISCSPTN	Limited	Biomarker	[3]
Autoimmune disease	DISORMTM	Limited	Genetic Variation	[29]
Burkitt lymphoma	DIS9D5XU	Limited	Altered Expression	[30]
Colorectal carcinoma	DIS5PYL0	Limited	Biomarker	[31]
Follicular lymphoma	DISVEUR6	Limited	Genetic Variation	[32]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Biomarker	[33]
Plasma cell myeloma	DIS0DFZ0	Limited	Biomarker	[34]
Sclerosing cholangitis	DIS7GZNB	Limited	Biomarker	[35]
Small-cell lung cancer	DISK3LZD	Limited	Altered Expression	[36]

This DOT Affected the Drug Response of 3 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Gefitinib	DM15F0X	Approved	Bcl-2-like protein 11 (BCL2L11) increases the response to substance of Gefitinib.	[108]
Imatinib	DM7RJXL	Approved	Bcl-2-like protein 11 (BCL2L11) increases the response to substance of Imatinib.	[50]
Resveratrol	DM3RWXL	Phase 3	Bcl-2-like protein 11 (BCL2L11) increases the response to substance of Resveratrol.	[110]

81 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Bcl-2-like protein 11 (BCL2L11).	[37]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Bcl-2-like protein 11 (BCL2L11).	[38]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Bcl-2-like protein 11 (BCL2L11).	[39]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Bcl-2-like protein 11 (BCL2L11).	[40]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Bcl-2-like protein 11 (BCL2L11).	[41]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Bcl-2-like protein 11 (BCL2L11).	[42]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Bcl-2-like protein 11 (BCL2L11).	[43]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Bcl-2-like protein 11 (BCL2L11).	[44]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Bcl-2-like protein 11 (BCL2L11).	[45]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Bcl-2-like protein 11 (BCL2L11).	[46]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Bcl-2-like protein 11 (BCL2L11).	[47]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Bcl-2-like protein 11 (BCL2L11).	[48]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Bcl-2-like protein 11 (BCL2L11).	[49]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Bcl-2-like protein 11 (BCL2L11).	[50]
Selenium	DM25CGV	Approved	Selenium increases the expression of Bcl-2-like protein 11 (BCL2L11).	[40]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Bcl-2-like protein 11 (BCL2L11).	[51]
Panobinostat	DM58WKG	Approved	Panobinostat decreases the expression of Bcl-2-like protein 11 (BCL2L11).	[52]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Bcl-2-like protein 11 (BCL2L11).	[53]
Folic acid	DMEMBJC	Approved	Folic acid affects the expression of Bcl-2-like protein 11 (BCL2L11).	[54]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Bcl-2-like protein 11 (BCL2L11).	[55]
Bortezomib	DMNO38U	Approved	Bortezomib increases the activity of Bcl-2-like protein 11 (BCL2L11).	[56]
Aspirin	DM672AH	Approved	Aspirin increases the expression of Bcl-2-like protein 11 (BCL2L11).	[57]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of Bcl-2-like protein 11 (BCL2L11).	[49]
Gemcitabine	DMSE3I7	Approved	Gemcitabine increases the expression of Bcl-2-like protein 11 (BCL2L11).	[58]
Alitretinoin	DMME8LH	Approved	Alitretinoin increases the expression of Bcl-2-like protein 11 (BCL2L11).	[59]
Methamphetamine	DMPM4SK	Approved	Methamphetamine increases the expression of Bcl-2-like protein 11 (BCL2L11).	[60]
Sorafenib	DMS8IFC	Approved	Sorafenib decreases the expression of Bcl-2-like protein 11 (BCL2L11).	[61]
Isoproterenol	DMK7MEY	Approved	Isoproterenol increases the expression of Bcl-2-like protein 11 (BCL2L11).	[63]
Lovastatin	DM9OZWQ	Approved	Lovastatin increases the expression of Bcl-2-like protein 11 (BCL2L11).	[64]
Morphine	DMRMS0L	Approved	Morphine increases the expression of Bcl-2-like protein 11 (BCL2L11).	[65]
Crizotinib	DM4F29C	Approved	Crizotinib increases the expression of Bcl-2-like protein 11 (BCL2L11).	[66]
Romidepsin	DMT5GNL	Approved	Romidepsin increases the expression of Bcl-2-like protein 11 (BCL2L11).	[67]
Efavirenz	DMC0GSJ	Approved	Efavirenz increases the expression of Bcl-2-like protein 11 (BCL2L11).	[68]
Nicotinamide	DMUPE07	Approved	Nicotinamide increases the expression of Bcl-2-like protein 11 (BCL2L11).	[69]
AC220	DM8Y4JS	Approved	AC220 increases the expression of Bcl-2-like protein 11 (BCL2L11).	[70]
Dextroamphetamine	DMMIHVP	Approved	Dextroamphetamine increases the expression of Bcl-2-like protein 11 (BCL2L11).	[60]
Trametinib	DM2JGQ3	Approved	Trametinib increases the expression of Bcl-2-like protein 11 (BCL2L11).	[71]
Penfluridol	DMG1DTE	Approved	Penfluridol increases the expression of Bcl-2-like protein 11 (BCL2L11).	[72]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Bcl-2-like protein 11 (BCL2L11).	[73]
Berberine	DMC5Q8X	Phase 4	Berberine increases the expression of Bcl-2-like protein 11 (BCL2L11).	[69]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Bcl-2-like protein 11 (BCL2L11).	[52]
Curcumin	DMQPH29	Phase 3	Curcumin increases the expression of Bcl-2-like protein 11 (BCL2L11).	[74]
Rigosertib	DMOSTXF	Phase 3	Rigosertib increases the expression of Bcl-2-like protein 11 (BCL2L11).	[75]
MLN4924	DMP36KD	Phase 3	MLN4924 affects the expression of Bcl-2-like protein 11 (BCL2L11).	[76]
Remdesivir	DMBFZ6L	Phase 3 Trial	Remdesivir increases the expression of Bcl-2-like protein 11 (BCL2L11).	[77]
Rebamipide	DM2GHCR	Phase 3	Rebamipide decreases the expression of Bcl-2-like protein 11 (BCL2L11).	[51]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Bcl-2-like protein 11 (BCL2L11).	[78]
Belinostat	DM6OC53	Phase 2	Belinostat increases the expression of Bcl-2-like protein 11 (BCL2L11).	[79]
GSK2110183	DMZHB37	Phase 2	GSK2110183 increases the expression of Bcl-2-like protein 11 (BCL2L11).	[80]
Tanespimycin	DMNLQHK	Phase 2	Tanespimycin increases the expression of Bcl-2-like protein 11 (BCL2L11).	[81]
PD-0325901	DM27D4J	Phase 2	PD-0325901 increases the expression of Bcl-2-like protein 11 (BCL2L11).	[82]
GDC0941	DM1YAK6	Phase 2	GDC0941 increases the expression of Bcl-2-like protein 11 (BCL2L11).	[83]
BEZ235	DMKBRDL	Phase 2	BEZ235 affects the expression of Bcl-2-like protein 11 (BCL2L11).	[84]
INK128	DMGO7QT	Phase 2	INK128 increases the expression of Bcl-2-like protein 11 (BCL2L11).	[85]
Gossypol	DMJWE3I	Phase 2	Gossypol increases the expression of Bcl-2-like protein 11 (BCL2L11).	[86]
Duvelisib	DM7USVA	Phase 2 Trial	Duvelisib increases the expression of Bcl-2-like protein 11 (BCL2L11).	[87]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Bcl-2-like protein 11 (BCL2L11).	[89]
Mivebresib	DMCPF90	Phase 1	Mivebresib increases the expression of Bcl-2-like protein 11 (BCL2L11).	[90]
LY294002	DMY1AFS	Phase 1	LY294002 increases the expression of Bcl-2-like protein 11 (BCL2L11).	[91]
AMEP	DMFELMQ	Phase 1	AMEP increases the expression of Bcl-2-like protein 11 (BCL2L11).	[92]
VS-5584	DMMO3G5	Phase 1	VS-5584 increases the expression of Bcl-2-like protein 11 (BCL2L11).	[93]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Bcl-2-like protein 11 (BCL2L11).	[94]
PMID25656651-Compound-5	DMAI95U	Patented	PMID25656651-Compound-5 increases the expression of Bcl-2-like protein 11 (BCL2L11).	[70]
PMID26882240-Compound-32	DMJS4RP	Patented	PMID26882240-Compound-32 increases the expression of Bcl-2-like protein 11 (BCL2L11).	[81]
Hydroxyqunoline analog 4	DMGQMCZ	Patented	Hydroxyqunoline analog 4 increases the expression of Bcl-2-like protein 11 (BCL2L11).	[95]
PMID26560530-Compound-8	DMN6TG7	Patented	PMID26560530-Compound-8 increases the expression of Bcl-2-like protein 11 (BCL2L11).	[96]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Bcl-2-like protein 11 (BCL2L11).	[98]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Bcl-2-like protein 11 (BCL2L11).	[55]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Bcl-2-like protein 11 (BCL2L11).	[99]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Bcl-2-like protein 11 (BCL2L11).	[100]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate increases the expression of Bcl-2-like protein 11 (BCL2L11).	[101]
Paraquat	DMR8O3X	Investigative	Paraquat decreases the expression of Bcl-2-like protein 11 (BCL2L11).	[102]
Okadaic acid	DM47CO1	Investigative	Okadaic acid increases the expression of Bcl-2-like protein 11 (BCL2L11).	[103]
Rapamycin Immunosuppressant Drug	DM678IB	Investigative	Rapamycin Immunosuppressant Drug increases the expression of Bcl-2-like protein 11 (BCL2L11).	[41]
PATULIN	DM0RV9C	Investigative	PATULIN increases the expression of Bcl-2-like protein 11 (BCL2L11).	[104]
NORCANTHARIDIN	DM9B6Y1	Investigative	NORCANTHARIDIN increases the expression of Bcl-2-like protein 11 (BCL2L11).	[105]
BAY11-7082	DMQNOFA	Investigative	BAY11-7082 increases the expression of Bcl-2-like protein 11 (BCL2L11).	[106]
Methylenedioxymethamphetamine	DMYVU47	Investigative	Methylenedioxymethamphetamine increases the expression of Bcl-2-like protein 11 (BCL2L11).	[60]
ANTHRAQUINONE	DM29I0Y	Investigative	ANTHRAQUINONE increases the expression of Bcl-2-like protein 11 (BCL2L11).	[107]
Selumetinib	DMC7W6R	Investigative	Selumetinib increases the expression of Bcl-2-like protein 11 (BCL2L11).	[66]
2-Amino-1-(4-methylthiophenyl)propane	DMJ2Z9G	Investigative	2-Amino-1-(4-methylthiophenyl)propane increases the expression of Bcl-2-like protein 11 (BCL2L11).	[60]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Docetaxel	DMDI269	Approved	Docetaxel increases the degradation of Bcl-2-like protein 11 (BCL2L11).	[62]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Bcl-2-like protein 11 (BCL2L11).	[88]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Bcl-2-like protein 11 (BCL2L11).	[97]

References

• [1] Mitotic slippage: an old tale with a new twist.Cell Cycle. 2019 Jan;18(1):7-15. doi: 10.1080/15384101.2018.1559557. Epub 2019 Jan 2.
• [2] Glucocorticoid Resistance in Acute Lymphoblastic Leukemia: BIM Finally.Cancer Cell. 2018 Dec 10;34(6):869-871. doi: 10.1016/j.ccell.2018.11.011.
• [3] FLT3-ITD Activates RSK1 to Enhance Proliferation and Survival of AML Cells by Activating mTORC1 and eIF4B Cooperatively with PIM or PI3K and by Inhibiting Bad and BIM.Cancers (Basel). 2019 Nov 20;11(12):1827. doi: 10.3390/cancers11121827.
• [4] BIM-23A760 influences key functional endpoints in pituitary adenomas and normal pituitaries: molecular mechanisms underlying the differential response in adenomas.Sci Rep. 2017 Feb 9;7:42002. doi: 10.1038/srep42002.
• [5] Flavopiridol's antiproliferative effects in glioblastoma multiforme.J Cancer Res Ther. 2016 Apr-Jun;12(2):811-7. doi: 10.4103/0973-1482.172132.
• [6] BAM conditioning before autologous transplantation for lymphoma: a study on behalf of the Francophone Society of Bone Marrow Transplantation and Cellular Therapy (SFGM-TC).Ann Hematol. 2019 Aug;98(8):1973-1980. doi: 10.1007/s00277-019-03704-z. Epub 2019 May 20.
• [7] Interactions between BIM Protein and Beta-Amyloid May Reveal a Crucial Missing Link between Alzheimer's Disease and Neuronal Cell Death.ACS Chem Neurosci. 2019 Aug 21;10(8):3555-3564. doi: 10.1021/acschemneuro.9b00177. Epub 2019 Jun 12.
• [8] Comprehensive bioinformatics analysis of critical lncRNAs, mRNAs and miRNAs in nonalcoholic fatty liver disease.Mol Med Rep. 2019 Apr;19(4):2649-2659. doi: 10.3892/mmr.2019.9931. Epub 2019 Feb 5.
• [9] The Ubiquitination of Spinal MrgC Alleviates Bone Cancer Pain and Reduces Intracellular Calcium Concentration in Spinal Neurons in Mice.Neurochem Res. 2019 Nov;44(11):2527-2535. doi: 10.1007/s11064-019-02869-3. Epub 2019 Sep 12.
• [10] Mouse ER+/PIK3CA(H1047R) breast cancers caused by exogenous estrogen are heterogeneously dependent on estrogen and undergo BIM-dependent apoptosis with BH3 and PI3K agents.Oncogene. 2019 Jan;38(1):47-59. doi: 10.1038/s41388-018-0436-4. Epub 2018 Aug 3.
• [11] Uev1A promotes breast cancer cell survival and chemoresistance through the AKT-FOXO1-BIM pathway.Cancer Cell Int. 2019 Dec 9;19:331. doi: 10.1186/s12935-019-1050-4. eCollection 2019.
• [12] Paclitaxel-induced apoptosis is BAK-dependent, but BAX and BIM-independent in breast tumor.PLoS One. 2013;8(4):e60685. doi: 10.1371/journal.pone.0060685. Epub 2013 Apr 5.
• [13] Influence of BCL2L11 polymorphism on osteonecrosis during treatment of childhood acute lymphoblastic leukemia.Pharmacogenomics J. 2019 Feb;19(1):33-41. doi: 10.1038/s41397-017-0002-4. Epub 2017 Dec 27.
• [14] HCRP-1 regulates EGFR-AKT-BIM-mediated anoikis resistance and serves as a prognostic marker in human colon cancer.Cell Death Dis. 2018 Dec 5;9(12):1176. doi: 10.1038/s41419-018-1217-2.
• [15] LncRNA HAND2-AS1 exerts anti-oncogenic effects on ovarian cancer via restoration of BCL2L11 as a sponge of microRNA-340-5p.J Cell Physiol. 2019 Dec;234(12):23421-23436. doi: 10.1002/jcp.28911. Epub 2019 Jun 21.
• [16] Association analyses of more than 140,000 men identify 63 new prostate cancer susceptibility loci.Nat Genet. 2018 Jul;50(7):928-936. doi: 10.1038/s41588-018-0142-8. Epub 2018 Jun 11.
• [17] Inhibition of MEK suppresses hepatocellular carcinoma growth through independent MYC and BIM regulation.Cell Oncol (Dordr). 2019 Jun;42(3):369-380. doi: 10.1007/s13402-019-00432-4. Epub 2019 Feb 20.
• [18] Proapoptotic protein BIM as a novel prognostic marker in mantle cell lymphoma.Hum Pathol. 2019 Nov;93:54-64. doi: 10.1016/j.humpath.2019.08.008. Epub 2019 Aug 16.
• [19] PRRC2A and BCL2L11 gene variants influence risk of non-Hodgkin lymphoma: results from the InterLymph consortium.Blood. 2012 Nov 29;120(23):4645-8. doi: 10.1182/blood-2012-05-427989. Epub 2012 Oct 9.
• [20] Sweet Killing in Obesity and Diabetes: The Metabolic Role of the BH3-only Protein BIM.J Mol Biol. 2018 Sep 14;430(18 Pt B):3041-3050. doi: 10.1016/j.jmb.2018.07.022. Epub 2018 Jul 21.
• [21] Up-regulation of microRNA-340 promotes osteosarcoma cell apoptosis while suppressing proliferation, migration, and invasion by inactivating the CTNNB1-mediated Notch signaling pathway.Biosci Rep. 2018 Aug 31;38(4):BSR20171615. doi: 10.1042/BSR20171615. Print 2018 Aug 31.
• [22] CBP-mediated FOXO-1 acetylation inhibits pancreatic tumor growth by targeting SirT.Mol Cancer Ther. 2014 Mar;13(3):687-98. doi: 10.1158/1535-7163.MCT-13-0863. Epub 2014 Jan 13.
• [23] CD4+ T cells from patients with primary sclerosing cholangitis exhibit reduced apoptosis and down-regulation of proapoptotic Bim in peripheral blood.J Leukoc Biol. 2017 Feb;101(2):589-597. doi: 10.1189/jlb.5A1015-469R. Epub 2016 Sep 14.
• [24] Correction: miR-9-5p, miR-124-3p, and miR-132-3p regulate BCL2L11 in tuberous sclerosis complex angiomyolipoma.Lab Invest. 2019 Mar;99(3):443-444. doi: 10.1038/s41374-018-0131-7.
• [25] The microRNA-423-3p-Bim Axis Promotes Cancer Progression and Activates Oncogenic Autophagy in Gastric Cancer.Mol Ther. 2017 Apr 5;25(4):1027-1037. doi: 10.1016/j.ymthe.2017.01.013. Epub 2017 Feb 21.
• [26] Clinical Implications of the BIM Deletion Polymorphism in Advanced Lung Adenocarcinoma Treated With Gefitinib.Clin Lung Cancer. 2018 Jul;19(4):e431-e438. doi: 10.1016/j.cllc.2018.02.007. Epub 2018 Feb 19.
• [27] The novel somatostatin receptor 2/dopamine type 2 receptor chimeric compound BIM-23A758 decreases the viability of human GOT1 midgut carcinoid cells.Neuroendocrinology. 2013;98(2):128-36. doi: 10.1159/000353784. Epub 2013 Jul 31.
• [28] BRAF Inhibitors Amplify the Proapoptotic Activity of MEK Inhibitors by Inducing ER Stress in NRAS-Mutant Melanoma.Clin Cancer Res. 2017 Oct 15;23(20):6203-6214. doi: 10.1158/1078-0432.CCR-17-0098. Epub 2017 Jul 19.
• [29] Concise Review: Cheating Death for a Better Transplant.Stem Cells. 2018 Nov;36(11):1646-1654. doi: 10.1002/stem.2901. Epub 2018 Oct 1.
• [30] Histone deacetylase inhibitor potentiates chemotherapy-induced apoptosis through Bim upregulation in Burkitt's lymphoma cells.J Cancer Res Clin Oncol. 2012 Feb;138(2):317-25. doi: 10.1007/s00432-011-1093-y. Epub 2011 Dec 1.
• [31] Genipin Enhances the Therapeutic Effects of Oxaliplatin by Upregulating BIM in Colorectal Cancer.Mol Cancer Ther. 2019 Apr;18(4):751-761. doi: 10.1158/1535-7163.MCT-18-0196. Epub 2019 Feb 20.
• [32] BIM deletion polymorphism accounts for lack of favorable outcome in Japanese females with follicular lymphoma.Leuk Lymphoma. 2019 May;60(5):1283-1288. doi: 10.1080/10428194.2018.1529310. Epub 2018 Nov 27.
• [33] Identification of new susceptibility loci for type 2 diabetes and shared etiological pathways with coronary heart disease.Nat Genet. 2017 Oct;49(10):1450-1457. doi: 10.1038/ng.3943. Epub 2017 Sep 4.
• [34] Bim is the key mediator of glucocorticoid-induced apoptosis and of its potentiation by rapamycin in human myeloma cells.Biochim Biophys Acta. 2010 Feb;1803(2):311-22. doi: 10.1016/j.bbamcr.2009.11.004. Epub 2009 Nov 13.
• [35] Genome-wide association analysis in primary sclerosing cholangitis identifies two non-HLA susceptibility loci.Nat Genet. 2011 Jan;43(1):17-9. doi: 10.1038/ng.728. Epub 2010 Dec 12.
• [36] The ratio of Bcl-2/Bim as a predictor of cisplatin response provides a rational combination of ABT-263 with cisplatin or radiation in small cell lung cancer.Cancer Biomark. 2019;24(1):51-59. doi: 10.3233/CBM-181692.
• [37] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [38] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [39] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [40] Selenium sensitizes MCF-7 breast cancer cells to doxorubicin-induced apoptosis through modulation of phospho-Akt and its downstream substrates. Mol Cancer Ther. 2007 Mar;6(3):1031-8. doi: 10.1158/1535-7163.MCT-06-0643. Epub 2007 Mar 5.
• [41] FOXO3a reactivation mediates the synergistic cytotoxic effects of rapamycin and cisplatin in oral squamous cell carcinoma cells. Toxicol Appl Pharmacol. 2011 Feb 15;251(1):8-15. doi: 10.1016/j.taap.2010.11.007. Epub 2010 Nov 16.
• [42] Molecular mechanism of action of bisphenol and bisphenol A mediated by oestrogen receptor alpha in growth and apoptosis of breast cancer cells. Br J Pharmacol. 2013 May;169(1):167-78.
• [43] Quercetin induced cell apoptosis and altered gene expression in AGS human gastric cancer cells. Environ Toxicol. 2018 Nov;33(11):1168-1181. doi: 10.1002/tox.22623. Epub 2018 Aug 27.
• [44] Apoptosis induced by temozolomide and nimustine in glioblastoma cells is supported by JNK/c-Jun-mediated induction of the BH3-only protein BIM. Oncotarget. 2015 Oct 20;6(32):33755-68. doi: 10.18632/oncotarget.5274.
• [45] Arsenic trioxide induces different gene expression profiles of genes related to growth and apoptosis in glioma cells dependent on the p53 status. Mol Biol Rep. 2008 Sep;35(3):421-9.
• [46] Does melatonin induce apoptosis in MCF-7 human breast cancer cells in vitro?. J Pineal Res. 2002 Mar;32(2):90-6. doi: 10.1034/j.1600-079x.2002.1821.x.
• [47] Suberoylanilide hydroxamic acid (Zolinza/vorinostat) sensitizes TRAIL-resistant breast cancer cells orthotopically implanted in BALB/c nude mice. Mol Cancer Ther. 2009 Jun;8(6):1596-605. doi: 10.1158/1535-7163.MCT-08-1004. Epub 2009 Jun 9.
• [48] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [49] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [50] Epigenetic down-regulation of BIM expression is associated with reduced optimal responses to imatinib treatment in chronic myeloid leukaemia. Eur J Cancer. 2009 Jul;45(10):1877-89. doi: 10.1016/j.ejca.2009.04.005. Epub 2009 May 4.
• [51] Rebamipide suppresses 5-fluorouracil-induced cell death via the activation of Akt/mTOR pathway and regulates the expression of Bcl-2 family proteins. Toxicol In Vitro. 2018 Feb;46:284-293. doi: 10.1016/j.tiv.2017.10.019. Epub 2017 Oct 17.
• [52] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [53] Gene expression profile of human lymphoid CEM cells sensitive and resistant to glucocorticoid-evoked apoptosis. Genomics. 2003 Jun;81(6):543-55.
• [54] Effects of folate deficiency on gene expression in the apoptosis and cancer pathways in colon cancer cells. Carcinogenesis. 2006 May;27(5):916-24. doi: 10.1093/carcin/bgi312. Epub 2005 Dec 16.
• [55] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [56] PS-341 (bortezomib) induces lysosomal cathepsin B release and a caspase-2-dependent mitochondrial permeabilization and apoptosis in human pancreatic cancer cells. J Biol Chem. 2006 Apr 28;281(17):11923-32. doi: 10.1074/jbc.M508533200. Epub 2006 Jan 30.
• [57] Aspirin induces apoptosis in human leukemia cells independently of NF-kappaB and MAPKs through alteration of the Mcl-1/Noxa balance. Apoptosis. 2010 Feb;15(2):219-29. doi: 10.1007/s10495-009-0424-9.
• [58] Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
• [59] Investigation of the mechanisms by which EB1089 abrogates apoptosis induced by 9-cis retinoic acid in pancreatic cancer cells. Pancreas. 2006 Jan;32(1):93-100.
• [60] An insight into the hepatocellular death induced by amphetamines, individually and in combination: the involvement of necrosis and apoptosis. Arch Toxicol. 2013 Dec;87(12):2165-85. doi: 10.1007/s00204-013-1082-9. Epub 2013 Jul 3.
• [61] Apoptosis induced by the kinase inhibitor BAY 43-9006 in human leukemia cells involves down-regulation of Mcl-1 through inhibition of translation. J Biol Chem. 2005 Oct 21;280(42):35217-27. doi: 10.1074/jbc.M506551200. Epub 2005 Aug 18.
• [62] Docetaxel-induced apoptosis of human melanoma is mediated by activation of c-Jun NH2-terminal kinase and inhibited by the mitogen-activated protein kinase extracellular signal-regulated kinase 1/2 pathway. Clin Cancer Res. 2007 Feb 15;13(4):1308-14. doi: 10.1158/1078-0432.CCR-06-2216.
• [63] Isoproterenol effects evaluated in heart slices of human and rat in comparison to rat heart in vivo. Toxicol Appl Pharmacol. 2014 Jan 15;274(2):302-12.
• [64] Statins induce apoptosis in ovarian cancer cells through activation of JNK and enhancement of Bim expression. Cancer Chemother Pharmacol. 2009 May;63(6):997-1005. doi: 10.1007/s00280-008-0830-7. Epub 2008 Sep 3.
• [65] Chronic high-dose morphine treatment promotes SH-SY5Y cell apoptosis via c-Jun N-terminal kinase-mediated activation of mitochondria-dependent pathway. FEBS J. 2009 Apr;276(7):2022-36. doi: 10.1111/j.1742-4658.2009.06938.x.
• [66] Antitumor action of the MET tyrosine kinase inhibitor crizotinib (PF-02341066) in gastric cancer positive for MET amplification. Mol Cancer Ther. 2012 Jul;11(7):1557-64. doi: 10.1158/1535-7163.MCT-11-0934. Epub 2012 Jun 22.
• [67] Histone deacetylase inhibitors FK228, N-(2-aminophenyl)-4-[N-(pyridin-3-yl-methoxycarbonyl)amino- methyl]benzamide and m-carboxycinnamic acid bis-hydroxamide augment radiation-induced cell death in gastrointestinal adenocarcinoma cells. Int J Cancer. 2004 Jun 10;110(2):301-8. doi: 10.1002/ijc.20117.
• [68] Efavirenz and 8-hydroxyefavirenz induce cell death via a JNK- and BimEL-dependent mechanism in primary human hepatocytes. Toxicol Appl Pharmacol. 2011 Dec 1;257(2):227-34. doi: 10.1016/j.taap.2011.09.008. Epub 2011 Sep 19.
• [69] Concurrent acetylation of FoxO1/3a and p53 due to sirtuins inhibition elicit Bim/PUMA mediated mitochondrial dysfunction and apoptosis in berberine-treated HepG2 cells. Toxicol Appl Pharmacol. 2016 Jan 15;291:70-83. doi: 10.1016/j.taap.2015.12.006. Epub 2015 Dec 19.
• [70] BET protein antagonist JQ1 is synergistically lethal with FLT3 tyrosine kinase inhibitor (TKI) and overcomes resistance to FLT3-TKI in AML cells expressing FLT-ITD. Mol Cancer Ther. 2014 Oct;13(10):2315-27. doi: 10.1158/1535-7163.MCT-14-0258. Epub 2014 Jul 22.
• [71] Combination small molecule MEK and PI3K inhibition enhances uveal melanoma cell death in a mutant GNAQ- and GNA11-dependent manner. Clin Cancer Res. 2012 Aug 15;18(16):4345-55. doi: 10.1158/1078-0432.CCR-11-3227. Epub 2012 Jun 25.
• [72] Targeting PFKL with penfluridol inhibits glycolysis and suppresses esophageal cancer tumorigenesis in an AMPK/FOXO3a/BIM-dependent manner. Acta Pharm Sin B. 2022 Mar;12(3):1271-1287. doi: 10.1016/j.apsb.2021.09.007. Epub 2021 Sep 11.
• [73] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [74] Involvement of Bcl-2 family members, phosphatidylinositol 3'-kinase/AKT and mitochondrial p53 in curcumin (diferulolylmethane)-induced apoptosis in prostate cancer. Int J Oncol. 2007 Apr;30(4):905-18.
• [75] Discovery of a clinical stage multi-kinase inhibitor sodium (E)-2-{2-methoxy-5-[(2',4',6'-trimethoxystyrylsulfonyl)methyl]phenylamino}acetate (ON 01910.Na): synthesis, structure-activity relationship, and biological activity. J Med Chem. 2011 Sep 22;54(18):6254-76. doi: 10.1021/jm200570p. Epub 2011 Aug 17.
• [76] The Nedd8-activating enzyme inhibitor MLN4924 thwarts microenvironment-driven NF-B activation and induces apoptosis in chronic lymphocytic leukemia B cells. Clin Cancer Res. 2014 Mar 15;20(6):1576-89. doi: 10.1158/1078-0432.CCR-13-0987.
• [77] An in vitro study on anti-carcinogenic effect of remdesivir in human ovarian cancer cells via generation of reactive oxygen species. Hum Exp Toxicol. 2022 Jan-Dec;41:9603271221089257. doi: 10.1177/09603271221089257.
• [78] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [79] Interactions between bortezomib and romidepsin and belinostat in chronic lymphocytic leukemia cells. Clin Cancer Res. 2008 Jan 15;14(2):549-58. doi: 10.1158/1078-0432.CCR-07-1934.
• [80] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [81] FGFR3 translocations in bladder cancer: differential sensitivity to HSP90 inhibition based on drug metabolism. Mol Cancer Res. 2014 Jul;12(7):1042-54. doi: 10.1158/1541-7786.MCR-14-0004. Epub 2014 Apr 30.
• [82] Combination PI3K/MEK inhibition promotes tumor apoptosis and regression in PIK3CA wild-type, KRAS mutant colorectal cancer. Cancer Lett. 2014 Jun 1;347(2):204-11. doi: 10.1016/j.canlet.2014.02.018. Epub 2014 Feb 24.
• [83] Intermittent administration of MEK inhibitor GDC-0973 plus PI3K inhibitor GDC-0941 triggers robust apoptosis and tumor growth inhibition. Cancer Res. 2012 Jan 1;72(1):210-9. doi: 10.1158/0008-5472.CAN-11-1515. Epub 2011 Nov 14.
• [84] Synergistic induction of cell death in haematological malignancies by combined phosphoinositide-3-kinase and BET bromodomain inhibition. Br J Haematol. 2015 Jul;170(2):275-8. doi: 10.1111/bjh.13283. Epub 2015 Jan 12.
• [85] Dual mTOR inhibitor MLN0128 suppresses Merkel cell carcinoma (MCC) xenograft tumor growth. Oncotarget. 2016 Feb 9;7(6):6576-92. doi: 10.18632/oncotarget.5878.
• [86] -(-)Gossypol promotes the apoptosis of bladder cancer cells in vitro. Pharmacol Res. 2008 Nov-Dec;58(5-6):323-31. doi: 10.1016/j.phrs.2008.09.005. Epub 2008 Sep 16.
• [87] Duvelisib treatment is associated with altered expression of apoptotic regulators that helps in sensitization of chronic lymphocytic leukemia cells to venetoclax (ABT-199). Leukemia. 2017 Sep;31(9):1872-1881. doi: 10.1038/leu.2016.382. Epub 2016 Dec 26.
• [88] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [89] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [90] Superior efficacy of cotreatment with BET protein inhibitor and BCL2 or MCL1 inhibitor against AML blast progenitor cells. Blood Cancer J. 2019 Jan 15;9(2):4. doi: 10.1038/s41408-018-0165-5.
• [91] Resveratrol induces growth arrest and apoptosis through activation of FOXO transcription factors in prostate cancer cells. PLoS One. 2010 Dec 14;5(12):e15288. doi: 10.1371/journal.pone.0015288.
• [92] Use of human neuroblastoma SH-SY5Y cells to evaluate glyphosate-induced effects on oxidative stress, neuronal development and cell death signaling pathways. Environ Int. 2020 Feb;135:105414. doi: 10.1016/j.envint.2019.105414. Epub 2019 Dec 23.
• [93] VS-5584 as a PI3K/mTOR inhibitor enhances apoptotic effects of subtoxic dose arsenic trioxide via inhibition of NF-B activity in B cell precursor-acute lymphoblastic leukemia. Biomed Pharmacother. 2018 Jun;102:428-437. doi: 10.1016/j.biopha.2018.03.009. Epub 2018 Mar 23.
• [94] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [95] Inhibition of histone demethylase KDM4 by ML324 induces apoptosis through the unfolded protein response and Bim upregulation in hepatocellular carcinoma cells. Chem Biol Interact. 2022 Feb 1;353:109806. doi: 10.1016/j.cbi.2022.109806. Epub 2022 Jan 7.
• [96] Tissue transglutaminase 2 inhibition promotes cell death and chemosensitivity in glioblastomas. Mol Cancer Ther. 2005 Sep;4(9):1293-302.
• [97] Expression and DNA methylation changes in human breast epithelial cells after bisphenol A exposure. Int J Oncol. 2012 Jul;41(1):369-77.
• [98] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [99] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [100] Persistence of epigenomic effects after recovery from repeated treatment with two nephrocarcinogens. Front Genet. 2018 Dec 3;9:558.
• [101] Differential effect of methyl-, butyl- and propylparaben and 17-estradiol on selected cell cycle and apoptosis gene and protein expression in MCF-7 breast cancer cells and MCF-10A non-malignant cells. J Appl Toxicol. 2014 Sep;34(9):1041-50. doi: 10.1002/jat.2978. Epub 2014 Jan 30.
• [102] Identification of genes associated with paraquat-induced toxicity in SH-SY5Y cells by PCR array focused on apoptotic pathways. J Toxicol Environ Health A. 2008;71(22):1457-67. doi: 10.1080/15287390802329364.
• [103] Whole genome mRNA transcriptomics analysis reveals different modes of action of the diarrheic shellfish poisons okadaic acid and dinophysis toxin-1 versus azaspiracid-1 in Caco-2 cells. Toxicol In Vitro. 2018 Feb;46:102-112.
• [104] Complementary cell-based high-throughput screens identify novel modulators of the unfolded protein response. J Biomol Screen. 2011 Sep;16(8):825-35. doi: 10.1177/1087057111414893. Epub 2011 Aug 15.
• [105] Norcantharidin induce apoptosis in human nasopharyngeal carcinoma through caspase and mitochondrial pathway. Environ Toxicol. 2018 Mar;33(3):343-350. doi: 10.1002/tox.22521. Epub 2017 Nov 29.
• [106] Glutathione S-transferase M1 inhibits dexamethasone-induced apoptosis in association with the suppression of Bim through dual mechanisms in a lymphoblastic leukemia cell line. Cancer Sci. 2010 Mar;101(3):767-73. doi: 10.1111/j.1349-7006.2009.01432.x. Epub 2010 Jan 7.
• [107] In vitro antiproliferative activity of 2,3-dihydroxy-9,10-anthraquinone induced apoptosis against COLO320 cells through cytochrome c release caspase mediated pathway with PI3K/AKT and COX-2 inhibition. Chem Biol Interact. 2016 Apr 5;249:23-35.
• [108] BIM induction of apoptosis triggered by EGFR-sensitive and resistance cell lines of non-small-cell lung cancer. Med Oncol. 2011 Jun;28(2):572-7. doi: 10.1007/s12032-010-9470-y. Epub 2010 Mar 17.
• [109] Epigenetic down-regulation of BIM expression is associated with reduced optimal responses to imatinib treatment in chronic myeloid leukaemia. Eur J Cancer. 2009 Jul;45(10):1877-89. doi: 10.1016/j.ejca.2009.04.005. Epub 2009 May 4.
• [110] Resveratrol induces apoptosis via a Bak-mediated intrinsic pathway in human lung adenocarcinoma cells. Cell Signal. 2012 May;24(5):1037-46. doi: 10.1016/j.cellsig.2011.12.025. Epub 2012 Jan 5.