Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPWU5IW)

• DOT Name: Sex hormone-binding globulin (SHBG)
• Synonyms: SHBG; Sex steroid-binding protein; SBP; Testis-specific androgen-binding protein; ABP; Testosterone-estradiol-binding globulin; TeBG; Testosterone-estrogen-binding globulin
• Gene Name: SHBG
• Related Disease:
  Prostate neoplasm
  Advanced cancer
  Alcohol dependence
  Alzheimer disease
  Arteriosclerosis
  Autoimmune disease
  Cervical cancer
  Colorectal carcinoma
  Coronary heart disease
  Endometrial cancer
  Endometrial carcinoma
  Erectile dysfunction
  Essential hypertension
  Fatty liver disease
  Hepatocellular carcinoma
  Hyperglycemia
  Hyperinsulinemia
  Hypertension, pregnancy-induced
  Hypothyroidism
  Major depressive disorder
  Male infertility
  Metabolic disorder
  Non-alcoholic fatty liver disease
  Ovarian cancer
  Ovarian neoplasm
  Peripheral arterial disease
  Prostate carcinoma
  Psoriasis
  Rheumatoid arthritis
  Type-1 diabetes
  Alcohol use disorder
  Breast neoplasm
  Gastric cancer
  Liver cirrhosis
  Stomach cancer
  Stroke
  Type-1/2 diabetes
  Diabetic kidney disease
  Adenocarcinoma
  Chronic kidney disease
  Coronary atherosclerosis
  Dilated cardiomyopathy
  Dilated cardiomyopathy 1A
  Hepatitis C virus infection
  Hyperthyroidism
  Orthostatic hypotension
  Prostate cancer
• UniProt ID: SHBG_HUMAN
• PDB ID: 1D2S; 1F5F; 1KDK; 1KDM; 1LHN; 1LHO; 1LHU; 1LHV; 1LHW; 6PYA; 6PYB; 6PYF; 6ULB
• Pfam ID: PF00054
• Sequence:
  MESRGPLATSRLLLLLLLLLLRHTRQGWALRPVLPTQSAHDPPAVHLSNGPGQEPIAVMT
  FDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGA
  GPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPAS
  NLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCDVESNPGIFLPPGTQAEFNLRDI
  PQPHAEPWAFSLDLGLKQAAGSGHLLALGTPENPSWLSLHLQDQKVVLSSGSGPGLDLPL
  VLGLPLQLKLSMSRVVLSQGSKMKALALPPLGLAPLLNLWAKPQGRLFLGALPGEDSSTS
  FCLNGLWAQGQRLDVDQALNRSHEIWTHSCPQSPGNGTDASH
• Function: Functions as an androgen transport protein, but may also be involved in receptor mediated processes. Each dimer binds one molecule of steroid. Specific for 5-alpha-dihydrotestosterone, testosterone, and 17-beta-estradiol. Regulates the plasma metabolic clearance rate of steroid hormones by controlling their plasma concentration.
• Tissue Specificity: Isoform 1 and isoform 2 are present in liver and testis.

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Prostate neoplasm	DISHDKGQ	Definitive	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Genetic Variation	[2]
Alcohol dependence	DIS4ZSCO	Strong	Biomarker	[3]
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[4]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[5]
Autoimmune disease	DISORMTM	Strong	Biomarker	[6]
Cervical cancer	DISFSHPF	Strong	Altered Expression	[7]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[8]
Coronary heart disease	DIS5OIP1	Strong	Biomarker	[9]
Endometrial cancer	DISW0LMR	Strong	Genetic Variation	[10]
Endometrial carcinoma	DISXR5CY	Strong	Genetic Variation	[10]
Erectile dysfunction	DISD8MTH	Strong	Genetic Variation	[11]
Essential hypertension	DIS7WI98	Strong	Biomarker	[12]
Fatty liver disease	DIS485QZ	Strong	Biomarker	[13]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[14]
Hyperglycemia	DIS0BZB5	Strong	Biomarker	[15]
Hyperinsulinemia	DISIDWT6	Strong	Altered Expression	[16]
Hypertension, pregnancy-induced	DISHNU25	Strong	Altered Expression	[17]
Hypothyroidism	DISR0H6D	Strong	Biomarker	[18]
Major depressive disorder	DIS4CL3X	Strong	Altered Expression	[19]
Male infertility	DISY3YZZ	Strong	Biomarker	[20]
Metabolic disorder	DIS71G5H	Strong	Biomarker	[21]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Biomarker	[22]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[23]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[23]
Peripheral arterial disease	DIS78WFB	Strong	Biomarker	[24]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[25]
Psoriasis	DIS59VMN	Strong	Genetic Variation	[26]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[27]
Type-1 diabetes	DIS7HLUB	Strong	Biomarker	[11]
Alcohol use disorder	DISMB65Y	moderate	Genetic Variation	[28]
Breast neoplasm	DISNGJLM	moderate	Biomarker	[29]
Gastric cancer	DISXGOUK	moderate	Biomarker	[30]
Liver cirrhosis	DIS4G1GX	moderate	Altered Expression	[21]
Stomach cancer	DISKIJSX	moderate	Biomarker	[30]
Stroke	DISX6UHX	moderate	Biomarker	[31]
Type-1/2 diabetes	DISIUHAP	moderate	Biomarker	[32]
Diabetic kidney disease	DISJMWEY	Disputed	Genetic Variation	[33]
Adenocarcinoma	DIS3IHTY	Limited	Altered Expression	[34]
Chronic kidney disease	DISW82R7	Limited	Biomarker	[35]
Coronary atherosclerosis	DISKNDYU	Limited	Biomarker	[9]
Dilated cardiomyopathy	DISX608J	Limited	Biomarker	[36]
Dilated cardiomyopathy 1A	DIS0RK9Z	Limited	Biomarker	[36]
Hepatitis C virus infection	DISQ0M8R	Limited	Biomarker	[37]
Hyperthyroidism	DISX87ZH	Limited	Biomarker	[38]
Orthostatic hypotension	DISBKQGT	Limited	Biomarker	[39]
Prostate cancer	DISF190Y	Limited	Biomarker	[25]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Ethanol	DMDRQZU	Approved	Sex hormone-binding globulin (SHBG) increases the Bone lesion ADR of Ethanol.	[56]

18 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Sex hormone-binding globulin (SHBG).	[40]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Sex hormone-binding globulin (SHBG).	[41]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Sex hormone-binding globulin (SHBG).	[42]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Sex hormone-binding globulin (SHBG).	[43]
Carbamazepine	DMZOLBI	Approved	Carbamazepine increases the expression of Sex hormone-binding globulin (SHBG).	[44]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol increases the expression of Sex hormone-binding globulin (SHBG).	[46]
Olanzapine	DMPFN6Y	Approved	Olanzapine decreases the expression of Sex hormone-binding globulin (SHBG).	[47]
Mitotane	DMU1GX0	Approved	Mitotane increases the expression of Sex hormone-binding globulin (SHBG).	[48]
Fructose	DM43AN2	Approved	Fructose decreases the expression of Sex hormone-binding globulin (SHBG).	[49]
Oxcarbazepine	DM5PU6O	Approved	Oxcarbazepine increases the expression of Sex hormone-binding globulin (SHBG).	[44]
Oxandrolone	DMU9MYJ	Approved	Oxandrolone decreases the expression of Sex hormone-binding globulin (SHBG).	[51]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Sex hormone-binding globulin (SHBG).	[52]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Sex hormone-binding globulin (SHBG).	[53]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Sex hormone-binding globulin (SHBG).	[54]
D-glucose	DMMG2TO	Investigative	D-glucose decreases the expression of Sex hormone-binding globulin (SHBG).	[49]
Hydroxyestradiol	DMJXQME	Investigative	Hydroxyestradiol increases the expression of Sex hormone-binding globulin (SHBG).	[55]
2-hydroxy-17beta-estradiol	DMM9Z0B	Investigative	2-hydroxy-17beta-estradiol increases the expression of Sex hormone-binding globulin (SHBG).	[55]
Sucrose	DMVWUCF	Investigative	Sucrose decreases the expression of Sex hormone-binding globulin (SHBG).	[49]

23 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Progesterone	DMUY35B	Approved	Progesterone affects the binding of Sex hormone-binding globulin (SHBG).	[45]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol affects the binding of Sex hormone-binding globulin (SHBG).	[45]
Estrone	DM5T6US	Approved	Estrone affects the binding of Sex hormone-binding globulin (SHBG).	[45]
Hesperetin	DMKER83	Approved	Hesperetin affects the binding of Sex hormone-binding globulin (SHBG).	[45]
Estriol	DMOEM2I	Approved	Estriol affects the binding of Sex hormone-binding globulin (SHBG).	[45]
Masoprocol	DMMVNZ0	Approved	Masoprocol affects the binding of Sex hormone-binding globulin (SHBG).	[45]
Levonorgestrel	DM1DP7T	Approved	Levonorgestrel affects the binding of Sex hormone-binding globulin (SHBG).	[50]
Dienestrol	DMBSXI0	Approved	Dienestrol affects the binding of Sex hormone-binding globulin (SHBG).	[45]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone affects the binding of Sex hormone-binding globulin (SHBG).	[45]
Afimoxifene	DMFORDT	Phase 2	Afimoxifene affects the binding of Sex hormone-binding globulin (SHBG).	[45]
Phenolphthalein	DM5SICT	Withdrawn from market	Phenolphthalein affects the binding of Sex hormone-binding globulin (SHBG).	[45]
Droloxifene	DM9JPUD	Discontinued in Phase 2	Droloxifene affects the binding of Sex hormone-binding globulin (SHBG).	[45]
Coumestrol	DM40TBU	Investigative	Coumestrol affects the binding of Sex hormone-binding globulin (SHBG).	[45]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate affects the binding of Sex hormone-binding globulin (SHBG).	[45]
Dibutyl phthalate	DMEDGKO	Investigative	Dibutyl phthalate affects the binding of Sex hormone-binding globulin (SHBG).	[45]
Chrysin	DM7V2LG	Investigative	Chrysin affects the binding of Sex hormone-binding globulin (SHBG).	[45]
Apigenin	DMI3491	Investigative	Apigenin affects the binding of Sex hormone-binding globulin (SHBG).	[45]
N-nonylphenol	DMH3OUX	Investigative	N-nonylphenol affects the binding of Sex hormone-binding globulin (SHBG).	[45]
Phloretin	DMYA50U	Investigative	Phloretin affects the binding of Sex hormone-binding globulin (SHBG).	[45]
(11-BETA)-11,21-DIHYDROXY-PREGN-4-ENE-3,20-DIONE	DMTPQ84	Investigative	(11-BETA)-11,21-DIHYDROXY-PREGN-4-ENE-3,20-DIONE affects the binding of Sex hormone-binding globulin (SHBG).	[45]
Flavanone	DMNWIYM	Investigative	Flavanone affects the binding of Sex hormone-binding globulin (SHBG).	[45]
CHALCONE	DM16QTM	Investigative	CHALCONE affects the binding of Sex hormone-binding globulin (SHBG).	[45]
7-hydroxy-2-phenylchroman-4-one	DM4UW65	Investigative	7-hydroxy-2-phenylchroman-4-one affects the binding of Sex hormone-binding globulin (SHBG).	[45]

References

• [1] SHBG is an important factor in stemness induction of cells by DHT in vitro and associated with poor clinical features of prostate carcinomas.PLoS One. 2013 Jul 30;8(7):e70558. doi: 10.1371/journal.pone.0070558. Print 2013.
• [2] Mediation analysis of the alcohol-postmenopausal breast cancer relationship by sex hormones in the EPIC cohort.Int J Cancer. 2020 Feb 1;146(3):759-768. doi: 10.1002/ijc.32324. Epub 2019 Apr 30.
• [3] Correlations between sex-related hormones, alcohol dependence and alcohol craving.Drug Alcohol Depend. 2019 Apr 1;197:183-190. doi: 10.1016/j.drugalcdep.2019.01.029. Epub 2019 Feb 27.
• [4] Antihypertensive medications and risk for incident dementia and Alzheimer's disease: a meta-analysis of individual participant data from prospective cohort studies.Lancet Neurol. 2020 Jan;19(1):61-70. doi: 10.1016/S1474-4422(19)30393-X. Epub 2019 Nov 6.
• [5] Prospective Study of Endogenous Hormones and Incidence of Venous Thromboembolism: The Atherosclerosis Risk in Communities Study.Thromb Haemost. 2018 Nov;118(11):1940-1950. doi: 10.1055/s-0038-1673613. Epub 2018 Oct 8.
• [6] Are the estrogenic hormonal effects of environmental toxins affecting small intestinal bacterial and microfilaria overgrowth?.Med Hypotheses. 2017 Nov;109:90-94. doi: 10.1016/j.mehy.2017.09.022. Epub 2017 Sep 28.
• [7] Expression of sex hormone-binding globulin exon 7 splicing variant mRNA in secondary spreading lesions of gynecological cancers.J Steroid Biochem Mol Biol. 1999 Feb;68(3-4):103-9. doi: 10.1016/s0960-0760(99)00025-4.
• [8] Circulating sex hormone levels and colorectal cancer risk in Japanese postmenopausal women: The JPHC nested case-control study.Int J Cancer. 2019 Sep 1;145(5):1238-1244. doi: 10.1002/ijc.32431. Epub 2019 Jun 11.
• [9] SBP above 180mmHg at moderate exercise workload increases coronary heart disease risk in healthy men during 28-year follow-up.J Hypertens. 2019 May;37(5):949-955. doi: 10.1097/HJH.0000000000001959.
• [10] CYP1A1, SULT1A1, and SULT1E1 polymorphisms are risk factors for endometrial cancer susceptibility.Cancer. 2008 May 1;112(9):1964-73. doi: 10.1002/cncr.23392.
• [11] Blood pressure, antihypertensive medication use, and risk of erectile dysfunction in men with type I diabetes.J Hypertens. 2019 May;37(5):1070-1076. doi: 10.1097/HJH.0000000000001988.
• [12] Effects of sodium nitrite on renal function and blood pressure in hypertensive vs. healthy study participants: a randomized, placebo-controlled, crossover study.J Hypertens. 2018 Mar;36(3):666-679. doi: 10.1097/HJH.0000000000001598.
• [13] Reproductive Endocrinology of Nonalcoholic Fatty Liver Disease.Endocr Rev. 2019 Apr 1;40(2):417-446. doi: 10.1210/er.2018-00158.
• [14] Sex hormone-binding globulin suppresses NAFLD-triggered hepatocarcinogenesis after menopause.Carcinogenesis. 2019 Aug 22;40(8):1031-1041. doi: 10.1093/carcin/bgz107.
• [15] Insulin resistance and sex hormone-binding globulin are independently correlated with low free testosterone levels in obese males.Andrologia. 2018 Sep;50(7):e13035. doi: 10.1111/and.13035. Epub 2018 May 9.
• [16] Valuable predictors of gestational diabetes mellitus in infertile Chinese women with polycystic ovary syndrome: a prospective cohort study.Gynecol Endocrinol. 2017 Jun;33(6):448-451. doi: 10.1080/09513590.2017.1290074. Epub 2017 Feb 28.
• [17] Feature of trajectory of blood pressure among pregnant women with gestational hypertension.J Hypertens. 2020 Jan;38(1):127-132. doi: 10.1097/HJH.0000000000002197.
• [18] Hypothyroidism is associated with higher testosterone levels in postmenopausal women with Hashimoto's thyroiditis.Endokrynol Pol. 2020;71(1):73-75. doi: 10.5603/EP.a2019.0055. Epub 2019 Nov 4.
• [19] Increased serum levels of leptin and insulin in both schizophrenia and major depressive disorder: A cross-disorder proteomics analysis.Eur Neuropsychopharmacol. 2019 Jul;29(7):835-846. doi: 10.1016/j.euroneuro.2019.05.010. Epub 2019 Jun 21.
• [20] The Utility of Sex Hormone-Binding Globulin in Hypogonadism and Infertile Males.J Urol. 2017 May;197(5):1326-1331. doi: 10.1016/j.juro.2017.01.018. Epub 2017 Jan 10.
• [21] Sex hormone levels by presence and severity of cirrhosis in women with chronic hepatitis C virus infection.J Viral Hepat. 2019 Feb;26(2):258-262. doi: 10.1111/jvh.13027. Epub 2018 Nov 14.
• [22] Serum SHBG Is Associated With the Development and Regression of Nonalcoholic Fatty Liver Disease: A Prospective Study.J Clin Endocrinol Metab. 2020 Mar 1;105(3):dgz244. doi: 10.1210/clinem/dgz244.
• [23] Appraising the role of previously reported risk factors in epithelial ovarian cancer risk: A Mendelian randomization analysis.PLoS Med. 2019 Aug 7;16(8):e1002893. doi: 10.1371/journal.pmed.1002893. eCollection 2019 Aug.
• [24] Cohort Study Examining the Association Between Blood Pressure and Cardiovascular Events in Patients With Peripheral Artery Disease.J Am Heart Assoc. 2019 Mar 19;8(6):e010748. doi: 10.1161/JAHA.118.010748.
• [25] Consumption of caffeinated beverages and serum concentrations of sex steroid hormones in US men.Cancer Causes Control. 2018 Jan;29(1):157-166. doi: 10.1007/s10552-017-0985-9. Epub 2017 Nov 24.
• [26] Clinical similarity of biosimilar ABP 501 to adalimumab in the treatment of patients with moderate to severe plaque psoriasis: A randomized, double-blind, multicenter, phase III study.J Am Acad Dermatol. 2017 Jun;76(6):1093-1102. doi: 10.1016/j.jaad.2016.12.014. Epub 2017 Mar 11.
• [27] An open-label extension study to demonstrate long-term safety and efficacy of ABP 501 in patients with rheumatoid arthritis.Arthritis Res Ther. 2019 Mar 29;21(1):84. doi: 10.1186/s13075-019-1857-3.
• [28] VSL#3 probiotic therapy does not reduce portal pressures in patients with decompensated cirrhosis.Liver Int. 2013 Nov;33(10):1470-7. doi: 10.1111/liv.12280. Epub 2013 Aug 23.
• [29] Identification of common variants in the SHBG gene affecting sex hormone-binding globulin levels and breast cancer risk in postmenopausal women.Cancer Epidemiol Biomarkers Prev. 2008 Dec;17(12):3490-8. doi: 10.1158/1055-9965.EPI-08-0734.
• [30] Sex hormone-binding globulin (SHBG) is a potential early diagnostic biomarker for gastric cancer.Cancer Med. 2018 Jan;7(1):64-74. doi: 10.1002/cam4.1254. Epub 2017 Nov 17.
• [31] Inter-arm difference of systolic blood pressure measured by automated double-cuff device is associated with arterial stiffness in patients with hypertension.Blood Press Monit. 2020 Feb;25(1):26-33. doi: 10.1097/MBP.0000000000000416.
• [32] Chronic kidney disease progression in patients with resistant hypertension subject to 2 therapeutic strategies: Intensification with loop diuretics vs aldosterone antagonists.Nefrologia (Engl Ed). 2020 Jan-Feb;40(1):65-73. doi: 10.1016/j.nefro.2019.04.012. Epub 2019 Aug 23.
• [33] Prognostic value of visit-to-visit systolic blood pressure variability related to diabetic kidney disease among patients with type 2 diabetes.J Hypertens. 2019 Jul;37(7):1411-1418. doi: 10.1097/HJH.0000000000002038.
• [34] Relatively high expression ratio of sex hormone-binding globulin exon VII splicing variant to wild-type mRNA in human uterine cervical cancers.Jpn J Cancer Res. 1998 Jan;89(1):47-52. doi: 10.1111/j.1349-7006.1998.tb00478.x.
• [35] Long-term blood pressure variability and development of chronic kidney disease in type 2 diabetes.J Hypertens. 2019 Apr;37(4):805-813. doi: 10.1097/HJH.0000000000001950.
• [36] Elevated serum Bisphenol A level in patients with dilated cardiomyopathy.Int J Environ Res Public Health. 2015 May 19;12(5):5329-37. doi: 10.3390/ijerph120505329.
• [37] Testosterone in Men With Chronic Hepatitis C Infection and After Hepatitis C Viral Clearance.Clin Infect Dis. 2019 Aug 1;69(4):571-576. doi: 10.1093/cid/ciy965.
• [38] Effects of selenium on short-term control of hyperthyroidism due to Graves' disease treated with methimazole: results of a randomized clinical trial.J Endocrinol Invest. 2017 Mar;40(3):281-287. doi: 10.1007/s40618-016-0559-9. Epub 2016 Oct 12.
• [39] Association of Orthostatic Hypotension Timing With Clinical Events in Adults With Diabetes and Hypertension: Results From the ACCORD Trial.Am J Hypertens. 2019 Jun 11;32(7):684-694. doi: 10.1093/ajh/hpz015.
• [40] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [41] Influence of estrogens on copper indicators: in vivo and in vitro studies. Biol Trace Elem Res. 2010 Jun;134(3):252-64.
• [42] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [43] Testosterone or 17{beta}-estradiol exposure reveals sex-specific effects on glucose and lipid metabolism in human myotubes. J Endocrinol. 2011 Aug;210(2):219-29. doi: 10.1530/JOE-10-0497. Epub 2011 Jun 1.
• [44] Reproductive effects of valproate, carbamazepine, and oxcarbazepine in men with epilepsy. Neurology. 2001 Jan 9;56(1):31-6. doi: 10.1212/wnl.56.1.31.
• [45] Human sex hormone-binding globulin binding affinities of 125 structurally diverse chemicals and comparison with their binding to androgen receptor, estrogen receptor, and -fetoprotein. Toxicol Sci. 2015 Feb;143(2):333-48. doi: 10.1093/toxsci/kfu231. Epub 2014 Oct 27.
• [46] Oral contraceptives moderately effect bone resorption markers and serum-soluble interleukin-6 receptor concentrations. Calcif Tissue Int. 2002 Jan;70(1):11-21. doi: 10.1007/s002230020035. Epub 2001 Dec 21.
• [47] Hormonal markers of metabolic dysregulation in patients with severe mental disorders after olanzapine treatment under real-life conditions. J Clin Psychopharmacol. 2009 Apr;29(2):109-16. doi: 10.1097/JCP.0b013e31819b95fc.
• [48] Mitotane has an estrogenic effect on sex hormone-binding globulin and corticosteroid-binding globulin in humans. J Clin Endocrinol Metab. 2006 Jun;91(6):2165-70. doi: 10.1210/jc.2005-2157. Epub 2006 Mar 21.
• [49] Monosaccharide-induced lipogenesis regulates the human hepatic sex hormone-binding globulin gene. J Clin Invest. 2007 Dec;117(12):3979-87. doi: 10.1172/JCI32249.
• [50] Serum distribution of the major metabolites of norgestimate in relation to its pharmacological properties. Contraception. 2003 Feb;67(2):93-9. doi: 10.1016/s0010-7824(02)00473-0.
• [51] Low sex hormone-binding globulin and testosterone levels in association with erectile dysfunction among human immunodeficiency virus-infected men receiving testosterone and oxandrolone. J Sex Med. 2008 Jan;5(1):241-7. doi: 10.1111/j.1743-6109.2007.00634.x. Epub 2007 Oct 24.
• [52] The molecular basis of genistein-induced mitotic arrest and exit of self-renewal in embryonal carcinoma and primary cancer cell lines. BMC Med Genomics. 2008 Oct 10;1:49.
• [53] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [54] Bisphenol A Exposure Changes the Transcriptomic and Proteomic Dynamics of Human Retinoblastoma Y79 Cells. Genes (Basel). 2021 Feb 11;12(2):264. doi: 10.3390/genes12020264.
• [55] The ability of hydroxylated estrogens (2-OH-E2 and 4-OH-E2) to increase of SHBG gene, protein expression and intracellular levels in MCF-7 cells line. Endocr Regul. 2011 Jul;45(3):125-30. doi: 10.4149/endo_2011_03_125.
• [56] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.