Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZ8BTTM)

• DOT Name: Peptidyl-prolyl cis-trans isomerase G (PPIG)
• Synonyms: PPIase G; Peptidyl-prolyl isomerase G; EC 5.2.1.8; CASP10; Clk-associating RS-cyclophilin; CARS-Cyp; CARS-cyclophilin; SR-cyclophilin; SR-cyp; SRcyp; Cyclophilin G; Rotamase G
• Gene Name: PPIG
• Related Disease:
  Liver cirrhosis
  Rheumatoid arthritis
  Alzheimer disease
  Arteriosclerosis
  Atherosclerosis
  Autoimmune hepatitis
  Bladder cancer
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Cardiac failure
  Cerebral infarction
  Colorectal carcinoma
  Congestive heart failure
  Endometriosis
  Esophageal squamous cell carcinoma
  Gallbladder cancer
  Gallbladder carcinoma
  Hepatitis C virus infection
  Hepatocellular carcinoma
  High blood pressure
  Hypothyroidism
  Malignant neoplasm
  Myocardial infarction
  Neoplasm
  Non-insulin dependent diabetes
  Non-small-cell lung cancer
  Obesity
  Oral cancer
  Oral lichen planus
  Parkinson disease
  Prostate cancer
  Prostate carcinoma
  Tardive dyskinesia
  Type-1/2 diabetes
  Urinary bladder cancer
  Urinary bladder neoplasm
  Uterine fibroids
  Non-alcoholic fatty liver disease
  Osteoarthritis
  Acute myelogenous leukaemia
  Adenocarcinoma
  Asthma
  Bone osteosarcoma
  Cardiovascular disease
  Coronary heart disease
  Osteosarcoma
• UniProt ID: PPIG_HUMAN
• PDB ID: 2GW2; 2WFI; 2WFJ; 5YZG
• EC Number: 5.2.1.8
• Pfam ID: PF00160
• Sequence:
  MGIKVQRPRCFFDIAINNQPAGRVVFELFSDVCPKTCENFRCLCTGEKGTGKSTQKPLHY
  KSCLFHRVVKDFMVQGGDFSEGNGRGGESIYGGFFEDESFAVKHNKEFLLSMANRGKDTN
  GSQFFITTKPTPHLDGHHVVFGQVISGQEVVREIENQKTDAASKPFAEVRILSCGELIPK
  SKVKKEEKKRHKSSSSSSSSSSDSDSSSDSQSSSDSSDSESATEEKSKKRKKKHRKNSRK
  HKKEKKKRKKSKKSASSESEAENLEAQPQSTVRPEEIPPIPENRFLMRKSPPKADEKERK
  NRERERERECNPPNSQPASYQRRLLVTRSGRKIKGRGPRRYRTPSRSRSRDRFRRSETPP
  HWRQEMQRAQRMRVSSGERWIKGDKSELNEIKENQRSPVRVKERKITDHRNVSESPNRKN
  EKEKKVKDHKSNSKERDIRRNSEKDDKYKNKVKKRAKSKSRSKSKEKSKSKERDSKHNRN
  EEKRMRSRSKGRDHENVKEKEKQSDSKGKDQERSRSKEKSKQLESKSNEHDHSKSKEKDR
  RAQSRSRECDITKGKHSYNSRTRERSRSRDRSRRVRSRTHDRDRSRSKEYHRYREQEYRR
  RGRSRSRERRTPPGRSRSKDRRRRRRDSRSSEREESQSRNKDKYRNQESKSSHRKENSES
  EKRMYSKSRDHNSSNNSREKKADRDQSPFSKIKQSSQDNELKSSMLKNKEDEKIRSSVEK
  ENQKSKGQENDHVHEKNKKFDHESSPGTDEDKSG
• Function: PPIase that catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and may therefore assist protein folding. May be implicated in the folding, transport, and assembly of proteins. May play an important role in the regulation of pre-mRNA splicing.
• Tissue Specificity: Ubiquitous.
• Reactome Pathway:
  SARS-CoV-1 activates/modulates innate immune responses (R-HSA-9692916)
  mRNA Splicing - Major Pathway (R-HSA-72163)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Liver cirrhosis	DIS4G1GX	Definitive	Genetic Variation	[1]
Rheumatoid arthritis	DISTSB4J	Definitive	Genetic Variation	[2]
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[3]
Arteriosclerosis	DISK5QGC	Strong	Genetic Variation	[4]
Atherosclerosis	DISMN9J3	Strong	Genetic Variation	[4]
Autoimmune hepatitis	DISOX03Q	Strong	Biomarker	[5]
Bladder cancer	DISUHNM0	Strong	Genetic Variation	[6]
Breast cancer	DIS7DPX1	Strong	Genetic Variation	[7]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[7]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[8]
Cardiac failure	DISDC067	Strong	Biomarker	[9]
Cerebral infarction	DISR1WNP	Strong	Genetic Variation	[10]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[11]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[9]
Endometriosis	DISX1AG8	Strong	Biomarker	[12]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Genetic Variation	[13]
Gallbladder cancer	DISXJUAF	Strong	Biomarker	[14]
Gallbladder carcinoma	DISD6ACL	Strong	Biomarker	[14]
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[15]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[16]
High blood pressure	DISY2OHH	Strong	Altered Expression	[17]
Hypothyroidism	DISR0H6D	Strong	Altered Expression	[18]
Malignant neoplasm	DISS6SNG	Strong	Biomarker	[19]
Myocardial infarction	DIS655KI	Strong	Genetic Variation	[20]
Neoplasm	DISZKGEW	Strong	Altered Expression	[21]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Genetic Variation	[22]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[23]
Obesity	DIS47Y1K	Strong	Biomarker	[24]
Oral cancer	DISLD42D	Strong	Genetic Variation	[25]
Oral lichen planus	DISVEAJA	Strong	Biomarker	[26]
Parkinson disease	DISQVHKL	Strong	Genetic Variation	[27]
Prostate cancer	DISF190Y	Strong	Genetic Variation	[28]
Prostate carcinoma	DISMJPLE	Strong	Genetic Variation	[28]
Tardive dyskinesia	DISKA5RC	Strong	Genetic Variation	[29]
Type-1/2 diabetes	DISIUHAP	Strong	Altered Expression	[30]
Urinary bladder cancer	DISDV4T7	Strong	Genetic Variation	[6]
Urinary bladder neoplasm	DIS7HACE	Strong	Genetic Variation	[6]
Uterine fibroids	DISBZRMJ	Strong	Altered Expression	[31]
Non-alcoholic fatty liver disease	DISDG1NL	moderate	Genetic Variation	[32]
Osteoarthritis	DIS05URM	moderate	Altered Expression	[33]
Acute myelogenous leukaemia	DISCSPTN	Limited	Genetic Variation	[34]
Adenocarcinoma	DIS3IHTY	Limited	Genetic Variation	[35]
Asthma	DISW9QNS	Limited	Biomarker	[36]
Bone osteosarcoma	DIST1004	Limited	Altered Expression	[37]
Cardiovascular disease	DIS2IQDX	Limited	Genetic Variation	[38]
Coronary heart disease	DIS5OIP1	Limited	Biomarker	[39]
Osteosarcoma	DISLQ7E2	Limited	Altered Expression	[37]

17 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Peptidyl-prolyl cis-trans isomerase G (PPIG).	[40]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Peptidyl-prolyl cis-trans isomerase G (PPIG).	[41]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Peptidyl-prolyl cis-trans isomerase G (PPIG).	[42]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Peptidyl-prolyl cis-trans isomerase G (PPIG).	[43]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Peptidyl-prolyl cis-trans isomerase G (PPIG).	[44]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Peptidyl-prolyl cis-trans isomerase G (PPIG).	[45]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Peptidyl-prolyl cis-trans isomerase G (PPIG).	[46]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Peptidyl-prolyl cis-trans isomerase G (PPIG).	[47]
Aspirin	DM672AH	Approved	Aspirin increases the expression of Peptidyl-prolyl cis-trans isomerase G (PPIG).	[48]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Peptidyl-prolyl cis-trans isomerase G (PPIG).	[49]
Cidofovir	DMA13GD	Approved	Cidofovir decreases the expression of Peptidyl-prolyl cis-trans isomerase G (PPIG).	[44]
Ifosfamide	DMCT3I8	Approved	Ifosfamide decreases the expression of Peptidyl-prolyl cis-trans isomerase G (PPIG).	[44]
Clodronate	DM9Y6X7	Approved	Clodronate decreases the expression of Peptidyl-prolyl cis-trans isomerase G (PPIG).	[44]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Peptidyl-prolyl cis-trans isomerase G (PPIG).	[47]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Peptidyl-prolyl cis-trans isomerase G (PPIG).	[52]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Peptidyl-prolyl cis-trans isomerase G (PPIG).	[54]
N-(3-METHYLBUT-2-EN-1-YL)-9H-PURIN-6-AMINE	DM2D4KY	Investigative	N-(3-METHYLBUT-2-EN-1-YL)-9H-PURIN-6-AMINE increases the expression of Peptidyl-prolyl cis-trans isomerase G (PPIG).	[55]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Peptidyl-prolyl cis-trans isomerase G (PPIG).	[50]
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of Peptidyl-prolyl cis-trans isomerase G (PPIG).	[51]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Peptidyl-prolyl cis-trans isomerase G (PPIG).	[53]
Coumarin	DM0N8ZM	Investigative	Coumarin affects the phosphorylation of Peptidyl-prolyl cis-trans isomerase G (PPIG).	[53]

References

• [1] Genetic polymorphisms of ADH2, ADH3, CYP4502E1 Dra-I and Pst-I, and ALDH2 in Spanish men: lack of association with alcoholism and alcoholic liver disease.J Hepatol. 2004 Nov;41(5):744-50. doi: 10.1016/j.jhep.2003.06.003.
• [2] Disease-Drug Interaction of Sarilumab and Simvastatin in Patients with Rheumatoid Arthritis.Clin Pharmacokinet. 2017 Jun;56(6):607-615. doi: 10.1007/s40262-016-0462-8.
• [3] Epigenetic drug discovery for Alzheimer's disease.Expert Opin Drug Discov. 2014 Sep;9(9):1059-86. doi: 10.1517/17460441.2014.930124. Epub 2014 Jul 3.
• [4] CYP A-204C polymorphism is associated with subclinical atherosclerosis in postmenopausal women.Menopause. 2008 Nov-Dec;15(6):1163-8. doi: 10.1097/gme.0b013e31817727c3.
• [5] Autoantibodies against CYP-2C19: A Novel Serum Marker in Pediatric De Novo Autoimmune Hepatitis?.Biomed Res Int. 2017;2017:3563278. doi: 10.1155/2017/3563278. Epub 2017 Nov 27.
• [6] Variations in CYP isoforms and bladder cancer: a superfamily paradigm.Urol Oncol. 2014 Jan;32(1):28.e33-40. doi: 10.1016/j.urolonc.2012.10.005. Epub 2013 Feb 19.
• [7] Association of CYP gene polymorphisms with breast cancer risk and prognostic factors in the Jordanian population.BMC Med Genet. 2019 Sep 2;20(1):148. doi: 10.1186/s12881-019-0884-x.
• [8] Integrated omics-based pathway analyses uncover CYP epoxygenase-associated networks as theranostic targets for metastatic triple negative breast cancer.J Exp Clin Cancer Res. 2019 May 9;38(1):187. doi: 10.1186/s13046-019-1187-y.
• [9] Modulation of cardiac and hepatic cytochrome P450 enzymes during heart failure.Curr Drug Metab. 2008 Feb;9(2):122-8. doi: 10.2174/138920008783571792.
• [10] Association of platelet response to cilostazol with clinical outcome and CYP genotype in patients with cerebral infarction.Thromb Res. 2018 Dec;172:14-20. doi: 10.1016/j.thromres.2018.10.003. Epub 2018 Oct 10.
• [11] Genetic variations in the xenobiotic-metabolizing enzymes CYP1A1, CYP1A2, CYP2C9, CYP2C19 and susceptibility to colorectal cancer among Turkish people.Genet Test Mol Biomarkers. 2014 Apr;18(4):223-8. doi: 10.1089/gtmb.2013.0358. Epub 2014 Feb 14.
• [12] Is cytochrome P450 3A4 regulated by menstrual cycle hormones in control endometrium and endometriosis?.Mol Cell Biochem. 2017 Mar;427(1-2):81-89. doi: 10.1007/s11010-016-2899-3. Epub 2016 Dec 19.
• [13] Interaction between alcohol consumption and CYP 2C19 gene polymorphism in relation to oesophageal squamous cell carcinoma.PLoS One. 2012;7(9):e43412. doi: 10.1371/journal.pone.0043412. Epub 2012 Sep 11.
• [14] A multigenic approach to evaluate genetic variants of PLCE1, LXRs, MMPs, TIMP, and CYP genes in gallbladder cancer predisposition.Tumour Biol. 2014 Sep;35(9):8597-606. doi: 10.1007/s13277-014-2094-7. Epub 2014 May 27.
• [15] Decreased tacrolimus plasma concentrations during HCV therapy: a drug-drug interaction or is there an alternative explanation?.Int J Antimicrob Agents. 2017 Mar;49(3):379-382. doi: 10.1016/j.ijantimicag.2016.12.004. Epub 2017 Feb 6.
• [16] The down-regulation of the CYP2C19 gene is associated with aggressive tumor potential and the poorer recurrence-free survival of hepatocellular carcinoma.Oncotarget. 2018 Apr 24;9(31):22058-22068. doi: 10.18632/oncotarget.25178. eCollection 2018 Apr 24.
• [17] Cytochrome P450 1B1 Is Critical for Neointimal Growth in Wire-Injured Carotid Artery of Male Mice.J Am Heart Assoc. 2018 Sep 18;7(18):e010065. doi: 10.1161/JAHA.118.010065.
• [18] Thyroid hormones induce doxorubicin chemosensitivity through enzymes involved in chemotherapy metabolism in lymphoma T cells.Oncotarget. 2019 Apr 30;10(32):3051-3065. doi: 10.18632/oncotarget.26890. eCollection 2019 Apr 30.
• [19] Enrollment on clinical trials does not improve survival for children with acute myeloid leukemia: A population-based study.Cancer. 2018 Oct 15;124(20):4098-4106. doi: 10.1002/cncr.31728. Epub 2018 Oct 6.
• [20] Haplotype-based case-control study of CYP4A11 gene and myocardial infarction.Hereditas. 2012 Jun;149(3):91-8. doi: 10.1111/j.1601-5223.2012.02247.x. Epub 2012 Jul 4.
• [21] Dihydromyricetin affect the pharmacokinetics of triptolide in rats.Xenobiotica. 2020 Mar;50(3):332-338. doi: 10.1080/00498254.2019.1616851. Epub 2019 May 27.
• [22] Caffeine Impact on Metabolic Syndrome Components Is Modulated by a CYP1A2 Variant.Ann Nutr Metab. 2016;68(1):1-11. doi: 10.1159/000441481. Epub 2015 Nov 21.
• [23] Profiling gene expression of whole cytochrome P450 superfamily in human bronchial and peripheral lung tissues: Differential expression in non-small cell lung cancers.Biochimie. 2010 Mar;92(3):292-306. doi: 10.1016/j.biochi.2009.12.007. Epub 2009 Dec 23.
• [24] Lipidomic profiling of high-fat diet-induced obesity in mice: Importance of cytochrome P450-derived fatty acid epoxides.Obesity (Silver Spring). 2017 Jan;25(1):132-140. doi: 10.1002/oby.21692. Epub 2016 Nov 28.
• [25] Role of cytochrome P-450 genetic polymorphisms in oral carcinogenesis.J Oral Pathol Med. 2012 Jan;41(1):1-8. doi: 10.1111/j.1600-0714.2011.01067.x. Epub 2011 Jul 28.
• [26] Polymorphic drug metabolizing CYP-enzymes--a pathogenic factor in oral lichen planus?.J Oral Pathol Med. 2009 Jan;38(1):63-71. doi: 10.1111/j.1600-0714.2008.00702.x.
• [27] Lack of relation between genetic polymorphism of cytochrome P-450IID6 and sporadic idiopathic Parkinson's disease.Clin Neuropharmacol. 1996 Jun;19(3):213-21. doi: 10.1097/00002826-199619030-00003.
• [28] CYP 1A1 polymorphism and organochlorine pesticides levels in the etiology of prostate cancer.Chemosphere. 2010 Sep;81(4):464-8. doi: 10.1016/j.chemosphere.2010.07.067.
• [29] Polymorphic variations in GSTM1, GSTT1, PgP, CYP2D6, CYP3A5, and dopamine D2 and D3 receptors and their association with tardive dyskinesia in severe mental illness.J Clin Psychopharmacol. 2005 Oct;25(5):448-56. doi: 10.1097/01.jcp.0000177546.34799.af.
• [30] Effects of Honokiol on CYP450 Activity and Transporter mRNA Expression in Type 2 Diabetic Rats.Int J Mol Sci. 2018 Mar 12;19(3):815. doi: 10.3390/ijms19030815.
• [31] Uterine leiomyomas express a molecular pattern that lowers retinoic acid exposure.Fertil Steril. 2007 Jun;87(6):1388-98. doi: 10.1016/j.fertnstert.2006.11.093. Epub 2007 Feb 2.
• [32] A targeted analysis reveals relevant shifts in the methylation and transcription of genes responsible for bile acid homeostasis and drug metabolism in non-alcoholic fatty liver disease. BMC Genomics. 2016 Jun 14;17:462.
• [33] Effect of silibinin on CFLAR-JNK pathway in oleic acid-treated HepG2 cells.Biomed Pharmacother. 2018 Dec;108:716-723. doi: 10.1016/j.biopha.2018.09.089. Epub 2018 Sep 21.
• [34] Association of cytochrome P450, glutathione S-transferase and N-acetyl transferase 2 gene polymorphisms with incidence of acute myeloid leukemia.Eur J Cancer Prev. 2008 Apr;17(2):125-32. doi: 10.1097/CEJ.0b013e3282b6fd68.
• [35] GST M1 and CYP1A1 gene polymorphism and daily fruit consumption in Turkish patients with non-small cell lung carcinomas.In Vivo. 2003 Nov-Dec;17(6):625-32.
• [36] Fine particulate matter from urban ambient and wildfire sources from California's San Joaquin Valley initiate differential inflammatory, oxidative stress, and xenobiotic responses in human bronchial epithelial cells.Toxicol In Vitro. 2011 Dec;25(8):1895-905. doi: 10.1016/j.tiv.2011.06.001. Epub 2011 Jun 15.
• [37] CYP genes in osteosarcoma: Their role in tumorigenesis, pulmonary metastatic microenvironment and treatment response.Oncotarget. 2017 Jun 13;8(24):38530-38540. doi: 10.18632/oncotarget.15869.
• [38] Impact of a variable number tandem repeat in the CYP2C9 promoter on warfarin sensitivity and responsiveness in Jordanians with cardiovascular disease.Pharmgenomics Pers Med. 2019 Mar 21;12:15-22. doi: 10.2147/PGPM.S189838. eCollection 2019.
• [39] Cytochrome P450 genes in coronary artery diseases: Codon usage analysis reveals genomic GC adaptation.Gene. 2016 Sep 15;590(1):35-43. doi: 10.1016/j.gene.2016.06.011. Epub 2016 Jun 5.
• [40] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [41] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [42] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [43] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [44] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [45] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [46] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [47] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [48] Expression profile analysis of human peripheral blood mononuclear cells in response to aspirin. Arch Immunol Ther Exp (Warsz). 2005 Mar-Apr;53(2):151-8.
• [49] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [50] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [51] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [52] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [53] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [54] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [55] Immediate up-regulation of the calcium-binding protein S100P and its involvement in the cytokinin-induced differentiation of human myeloid leukemia cells. Biochim Biophys Acta. 2005 Sep 10;1745(2):156-65.