Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTZCRWOR)

• DOT Name: Tissue factor pathway inhibitor 2 (TFPI2)
• Synonyms: TFPI-2; Placental protein 5; PP5
• Gene Name: TFPI2
• Related Disease:
  leukaemia
  Leukemia
  Matthew-Wood syndrome
  Acute myelogenous leukaemia
  Adult glioblastoma
  Advanced cancer
  Alzheimer disease
  Arteriosclerosis
  Atherosclerosis
  Bladder cancer
  Brain neoplasm
  Breast cancer
  Breast neoplasm
  Carcinoma
  Carcinoma of esophagus
  Cervical cancer
  Cervical carcinoma
  Choriocarcinoma
  Colon cancer
  Colon carcinoma
  Colorectal carcinoma
  Colorectal neoplasm
  Epithelial ovarian cancer
  Gastric cancer
  Glioblastoma multiforme
  Glioma
  Hepatocellular carcinoma
  Lung cancer
  Lung carcinoma
  Malignant glioma
  Melanoma
  Nasopharyngeal carcinoma
  Non-small-cell lung cancer
  Osteoarthritis
  Ovarian cancer
  Ovarian neoplasm
  Pancreatic cancer
  Pancreatic tumour
  Rheumatoid arthritis
  Stomach cancer
  Urinary bladder cancer
  Urinary bladder neoplasm
  Amyotrophic lateral sclerosis
  Fibrosarcoma
  Triple negative breast cancer
  Metastatic malignant neoplasm
  Breast carcinoma
  Pancreatic ductal carcinoma
• UniProt ID: TFPI2_HUMAN
• PDB ID: 1ZR0
• Pfam ID: PF00014
• Sequence:
  MDPARPLGLSILLLFLTEAALGDAAQEPTGNNAEICLLPLDYGPCRALLLRYYYDRYTQS
  CRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSM
  TCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRY
  RTCDAFTYTGCGGNDNNFVSREDCKRACAKALKKKKKMPKLRFASRIRKIRKKQF
• Function: May play a role in the regulation of plasmin-mediated matrix remodeling. Inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. Has no effect on thrombin.
• Tissue Specificity: Umbilical vein endothelial cells, liver, placenta, heart, pancreas, and maternal serum at advanced pregnancy.

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
leukaemia	DISS7D1V	Definitive	Biomarker	[1]
Leukemia	DISNAKFL	Definitive	Biomarker	[1]
Matthew-Wood syndrome	DISA7HR7	Definitive	Biomarker	[2]
Acute myelogenous leukaemia	DISCSPTN	Strong	Altered Expression	[3]
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[4]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[5]
Alzheimer disease	DISF8S70	Strong	Altered Expression	[6]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[7]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[7]
Bladder cancer	DISUHNM0	Strong	Biomarker	[8]
Brain neoplasm	DISY3EKS	Strong	Biomarker	[9]
Breast cancer	DIS7DPX1	Strong	Biomarker	[5]
Breast neoplasm	DISNGJLM	Strong	Posttranslational Modification	[10]
Carcinoma	DISH9F1N	Strong	Posttranslational Modification	[11]
Carcinoma of esophagus	DISS6G4D	Strong	Altered Expression	[12]
Cervical cancer	DISFSHPF	Strong	Posttranslational Modification	[13]
Cervical carcinoma	DIST4S00	Strong	Posttranslational Modification	[13]
Choriocarcinoma	DISDBVNL	Strong	Altered Expression	[14]
Colon cancer	DISVC52G	Strong	Biomarker	[15]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[15]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[16]
Colorectal neoplasm	DISR1UCN	Strong	Biomarker	[17]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[18]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[19]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[20]
Glioma	DIS5RPEH	Strong	Biomarker	[21]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[22]
Lung cancer	DISCM4YA	Strong	Altered Expression	[23]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[23]
Malignant glioma	DISFXKOV	Strong	Altered Expression	[21]
Melanoma	DIS1RRCY	Strong	Biomarker	[24]
Nasopharyngeal carcinoma	DISAOTQ0	Strong	Biomarker	[25]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Posttranslational Modification	[23]
Osteoarthritis	DIS05URM	Strong	Biomarker	[26]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[18]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[18]
Pancreatic cancer	DISJC981	Strong	Biomarker	[2]
Pancreatic tumour	DIS3U0LK	Strong	Biomarker	[27]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[28]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[19]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[8]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[8]
Amyotrophic lateral sclerosis	DISF7HVM	moderate	Altered Expression	[29]
Fibrosarcoma	DISWX7MU	moderate	Genetic Variation	[30]
Triple negative breast cancer	DISAMG6N	moderate	Biomarker	[31]
Metastatic malignant neoplasm	DIS86UK6	Disputed	Altered Expression	[32]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[5]
Pancreatic ductal carcinoma	DIS26F9Q	Limited	Altered Expression	[33]

This DOT Affected the Drug Response of 6 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Etoposide	DMNH3PG	Approved	Tissue factor pathway inhibitor 2 (TFPI2) affects the response to substance of Etoposide.	[67]
Paclitaxel	DMLB81S	Approved	Tissue factor pathway inhibitor 2 (TFPI2) affects the response to substance of Paclitaxel.	[67]
DTI-015	DMXZRW0	Approved	Tissue factor pathway inhibitor 2 (TFPI2) affects the response to substance of DTI-015.	[68]
Mitomycin	DMH0ZJE	Approved	Tissue factor pathway inhibitor 2 (TFPI2) affects the response to substance of Mitomycin.	[67]
Topotecan	DMP6G8T	Approved	Tissue factor pathway inhibitor 2 (TFPI2) affects the response to substance of Topotecan.	[67]
Vinblastine	DM5TVS3	Approved	Tissue factor pathway inhibitor 2 (TFPI2) affects the response to substance of Vinblastine.	[67]

34 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[34]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[35]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[36]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[37]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[38]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate affects the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[39]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[40]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[41]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[42]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[43]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[44]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[45]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[46]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[47]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[48]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[17]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[50]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[51]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[52]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[53]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[45]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[54]
Nicotine	DMWX5CO	Approved	Nicotine decreases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[55]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[56]
Malathion	DMXZ84M	Approved	Malathion increases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[57]
Melphalan	DMOLNHF	Approved	Melphalan increases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[58]
Lucanthone	DMZLBUO	Approved	Lucanthone increases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[59]
Prednisolone	DMQ8FR2	Approved	Prednisolone decreases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[28]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[61]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[45]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[62]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[63]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[64]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Tissue factor pathway inhibitor 2 (TFPI2).	[66]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Tissue factor pathway inhibitor 2 (TFPI2).	[65]

References

• [1] Ref-1/APE1 as a Transcriptional Regulator and Novel Therapeutic Target in Pediatric T-cell Leukemia.Mol Cancer Ther. 2017 Jul;16(7):1401-1411. doi: 10.1158/1535-7163.MCT-17-0099. Epub 2017 Apr 26.
• [2] Blocking HIF signaling via novel inhibitors of CA9 and APE1/Ref-1 dramatically affects pancreatic cancer cell survival.Sci Rep. 2018 Sep 13;8(1):13759. doi: 10.1038/s41598-018-32034-9.
• [3] Promoter of TFPI-2 is hypermethylated in Chinese pediatric acute myeloid leukemia.J Pediatr Hematol Oncol. 2012 Jan;34(1):43-6. doi: 10.1097/MPH.0b013e3182277276.
• [4] Long noncoding RNA AC003092.1 promotes temozolomide chemosensitivity through miR-195/TFPI-2 signaling modulation in glioblastoma.Cell Death Dis. 2018 Nov 15;9(12):1139. doi: 10.1038/s41419-018-1183-8.
• [5] TFPI-2 suppresses breast cancer cell proliferation and invasion through regulation of ERK signaling and interaction with actinin-4 and myosin-9.Sci Rep. 2018 Sep 26;8(1):14402. doi: 10.1038/s41598-018-32698-3.
• [6] MicroRNA-616 induces androgen-independent growth of prostate cancer cells by suppressing expression of tissue factor pathway inhibitor TFPI-2.Cancer Res. 2011 Jan 15;71(2):583-92. doi: 10.1158/0008-5472.CAN-10-2587. Epub 2011 Jan 11.
• [7] Tissue Factor Pathway Inhibitor-2 Gene Polymorphisms Associate With Coronary Atherosclerosis in Chinese Population.Medicine (Baltimore). 2015 Oct;94(42):e1675. doi: 10.1097/MD.0000000000001675.
• [8] Antitumor Activity and Mechanistic Characterization of APE1/Ref-1 Inhibitors in Bladder Cancer.Mol Cancer Ther. 2019 Nov;18(11):1947-1960. doi: 10.1158/1535-7163.MCT-18-1166. Epub 2019 Aug 14.
• [9] Recombinant adeno-associated virus (rAAV) expressing TFPI-2 inhibits invasion, angiogenesis and tumor growth in a human glioblastoma cell line.Int J Cancer. 2005 Jul 20;115(6):998-1005. doi: 10.1002/ijc.20965.
• [10] Tissue factor pathway inhibitor-2 was repressed by CpG hypermethylation through inhibition of KLF6 binding in highly invasive breast cancer cells.BMC Mol Biol. 2007 Dec 3;8:110. doi: 10.1186/1471-2199-8-110.
• [11] Methylation of the TFPI2 gene is frequently detected in advanced gastric carcinoma.Anticancer Res. 2010 Oct;30(10):4131-3.
• [12] Methylation of TFPI-2 is an early event of esophageal carcinogenesis.Epigenomics. 2012 Apr;4(2):135-46. doi: 10.2217/epi.12.11.
• [13] Hypermethylation of TFPI2 correlates with cervical cancer incidence in the Uygur and Han populations of Xinjiang, China.Int J Clin Exp Pathol. 2015 Feb 1;8(2):1844-54. eCollection 2015.
• [14] Transcriptional silencing of the TFPI-2 gene by promoter hypermethylation in choriocarcinoma cells.Biol Chem. 2003 Jul;384(7):1029-34. doi: 10.1515/BC.2003.115.
• [15] Hypermethylation of ITGA4, TFPI2 and VIMENTIN promoters is increased in inflamed colon tissue: putative risk markers for colitis-associated cancer.J Cancer Res Clin Oncol. 2015 Dec;141(12):2097-107. doi: 10.1007/s00432-015-1972-8. Epub 2015 Apr 23.
• [16] Mono-ADP-ribosylation of H3R117 traps 5mC hydroxylase TET1 to impair demethylation of tumor suppressor gene TFPI2.Oncogene. 2019 May;38(18):3488-3503. doi: 10.1038/s41388-018-0671-8. Epub 2019 Jan 16.
• [17] Methylation of TFPI2 in stool DNA: a potential novel biomarker for the detection of colorectal cancer. Cancer Res. 2009 Jun 1;69(11):4691-9. doi: 10.1158/0008-5472.CAN-08-0142. Epub 2009 May 12.
• [18] Alterations in the expression of the apurinic/apyrimidinic endonuclease-1/redox factor-1 (APE1/Ref-1) in human ovarian cancer and indentification of the therapeutic potential of APE1/Ref-1 inhibitor.Int J Oncol. 2009 Nov;35(5):1069-79.
• [19] Function and diagnostic value of Anosmin-1 in gastric cancer progression.Int J Cancer. 2016 Feb 1;138(3):721-30. doi: 10.1002/ijc.29803. Epub 2015 Sep 1.
• [20] Long non-coding RNA AGAP2-AS1 exerts oncogenic properties in glioblastoma by epigenetically silencing TFPI2 through EZH2 and LSD1.Aging (Albany NY). 2019 Jun 11;11(11):3811-3823. doi: 10.18632/aging.102018.
• [21] Knockdown of TFPI-2 promotes migration and invasion of glioma cells.Neurosci Lett. 2011 Jun 15;497(1):49-54. doi: 10.1016/j.neulet.2011.04.027. Epub 2011 Apr 20.
• [22] Involvement of MAFB and MAFF in Retinoid-Mediated Suppression of Hepatocellular Carcinoma Invasion.Int J Mol Sci. 2018 May 13;19(5):1450. doi: 10.3390/ijms19051450.
• [23] Methylation-induced downregulation of TFPI-2 causes TMPRSS4 overexpression and contributes to oncogenesis in a subset of non-small-cell lung carcinoma.Cancer Sci. 2015 Jan;106(1):34-42. doi: 10.1111/cas.12569. Epub 2014 Dec 8.
• [24] Methylated tissue factor pathway inhibitor 2 (TFPI2) DNA in serum is a biomarker of metastatic melanoma.J Invest Dermatol. 2013 May;133(5):1278-85. doi: 10.1038/jid.2012.493. Epub 2013 Feb 14.
• [25] F-127-PEI co-delivering docetaxel and TFPI-2 plasmid for nasopharyngeal cancer therapy.Mater Sci Eng C Mater Biol Appl. 2016 Apr 1;61:269-77. doi: 10.1016/j.msec.2015.12.049. Epub 2015 Dec 24.
• [26] Detection of differentially expressed genes in synovial fibroblasts by restriction fragment differential display.Rheumatology (Oxford). 2004 Nov;43(11):1346-52. doi: 10.1093/rheumatology/keh347. Epub 2004 Aug 3.
• [27] Diagnostic utility of aberrant methylation of tissue factor pathway inhibitor 2 in pure pancreatic juice for pancreatic carcinoma.Cancer Sci. 2006 Nov;97(11):1267-73. doi: 10.1111/j.1349-7006.2006.00308.x. Epub 2006 Sep 5.
• [28] Gene expression profiling of rheumatoid arthritis synovial cells treated with antirheumatic drugs. J Biomol Screen. 2007 Apr;12(3):328-40. doi: 10.1177/1087057107299261. Epub 2007 Mar 22.
• [29] Drosophila Ref1/ALYREF regulates transcription and toxicity associated with ALS/FTD disease etiologies.Acta Neuropathol Commun. 2019 Apr 29;7(1):65. doi: 10.1186/s40478-019-0710-x.
• [30] Human tissue factor pathway inhibitor-2 induces caspase-mediated apoptosis in a human fibrosarcoma cell line.Apoptosis. 2008 May;13(5):702-15. doi: 10.1007/s10495-008-0207-8.
• [31] Therapeutic positioning of secretory acetylated APE1/Ref-1 requirement for suppression of tumor growth in triple-negative breast cancer in vivo.Sci Rep. 2018 Jun 7;8(1):8701. doi: 10.1038/s41598-018-27025-9.
• [32] Promoter hypermethylation and silencing of tissue factor pathway inhibitor-2 in oral squamous cell carcinoma.J Transl Med. 2014 Sep 2;12:237. doi: 10.1186/s12967-014-0237-7.
• [33] APE1/Ref-1 knockdown in pancreatic ductal adenocarcinoma - characterizing gene expression changes and identifying novel pathways using single-cell RNA sequencing.Mol Oncol. 2017 Dec;11(12):1711-1732. doi: 10.1002/1878-0261.12138. Epub 2017 Oct 19.
• [34] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [35] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [36] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [37] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [38] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [39] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [40] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [41] Analysis of estrogen agonism and antagonism of tamoxifen, raloxifene, and ICI182780 in endometrial cancer cells: a putative role for the epidermal growth factor receptor ligand amphiregulin. J Soc Gynecol Investig. 2005 Oct;12(7):e55-67.
• [42] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [43] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [44] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [45] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [46] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [47] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [48] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [49] Methylation of TFPI2 in stool DNA: a potential novel biomarker for the detection of colorectal cancer. Cancer Res. 2009 Jun 1;69(11):4691-9. doi: 10.1158/0008-5472.CAN-08-0142. Epub 2009 May 12.
• [50] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [51] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [52] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [53] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [54] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [55] Nicotine modulates the expression of a diverse set of genes in the neuronal SH-SY5Y cell line. J Biol Chem. 2003 May 2;278(18):15633-40.
• [56] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [57] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [58] Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
• [59] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [60] Gene expression profiling of rheumatoid arthritis synovial cells treated with antirheumatic drugs. J Biomol Screen. 2007 Apr;12(3):328-40. doi: 10.1177/1087057107299261. Epub 2007 Mar 22.
• [61] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [62] Gene expression profiling in Ishikawa cells: a fingerprint for estrogen active compounds. Toxicol Appl Pharmacol. 2009 Apr 1;236(1):85-96.
• [63] Gene expression changes associated with altered growth and differentiation in benzo[a]pyrene or arsenic exposed normal human epidermal keratinocytes. J Appl Toxicol. 2008 May;28(4):491-508.
• [64] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [65] Genome-wide alteration in DNA hydroxymethylation in the sperm from bisphenol A-exposed men. PLoS One. 2017 Jun 5;12(6):e0178535. doi: 10.1371/journal.pone.0178535. eCollection 2017.
• [66] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [67] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
• [68] Tumor necrosis factor-alpha-induced protein 3 as a putative regulator of nuclear factor-kappaB-mediated resistance to O6-alkylating agents in human glioblastomas. J Clin Oncol. 2006 Jan 10;24(2):274-87. doi: 10.1200/JCO.2005.02.9405. Epub 2005 Dec 19.