Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT72QLZB)

• DOT Name: Plasminogen activator inhibitor 2 (SERPINB2)
• Synonyms: PAI-2; Monocyte Arg-serpin; Placental plasminogen activator inhibitor; Serpin B2; Urokinase inhibitor
• Gene Name: SERPINB2
• Related Disease:
  Matthew-Wood syndrome
  Adenocarcinoma
  Asthma
  Carcinoma
  Cardiovascular disease
  Colon cancer
  Colon carcinoma
  Congenital contractural arachnodactyly
  Coronary heart disease
  Depression
  Endometriosis
  Endometrium neoplasm
  Epithelial ovarian cancer
  Esophageal squamous cell carcinoma
  Fetal growth restriction
  Gastric cancer
  Head and neck cancer
  Head and neck carcinoma
  Head-neck squamous cell carcinoma
  Hepatocellular carcinoma
  High blood pressure
  Keloid
  Lung adenocarcinoma
  Multiple sclerosis
  Non-alcoholic fatty liver disease
  Non-alcoholic steatohepatitis
  Non-small-cell lung cancer
  Obesity
  Ovarian cancer
  Peptic ulcer
  Polycystic ovarian syndrome
  Squamous cell carcinoma
  Systemic lupus erythematosus
  Thrombophilia
  Breast neoplasm
  Non-insulin dependent diabetes
  Osteoarthritis
  Anxiety
  Anxiety disorder
  Colorectal carcinoma
  Coronary atherosclerosis
  Gastric neoplasm
  Glioma
  Hereditary diffuse gastric adenocarcinoma
  Pancreatic cancer
  Prostate cancer
  Prostate carcinoma
  Rheumatoid arthritis
  Stomach cancer
• UniProt ID: PAI2_HUMAN
• PDB ID: 1BY7; 1JRR; 2ARQ; 2ARR
• Pfam ID: PF00079
• Sequence:
  MEDLCVANTLFALNLFKHLAKASPTQNLFLSPWSISSTMAMVYMGSRGSTEDQMAKVLQF
  NEVGANAVTPMTPENFTSCGFMQQIQKGSYPDAILQAQAADKIHSSFRSLSSAINASTGN
  YLLESVNKLFGEKSASFREEYIRLCQKYYSSEPQAVDFLECAEEARKKINSWVKTQTKGK
  IPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQRTPVQMMYLREK
  LNIGYIEDLKAQILELPYAGDVSMFLLLPDEIADVSTGLELLESEITYDKLNKWTSKDKM
  AEDEVEVYIPQFKLEEHYELRSILRSMGMEDAFNKGRANFSGMSERNDLFLSEVFHQAMV
  DVNEEGTEAAAGTGGVMTGRTGHGGPQFVADHPFLFLIMHKITNCILFFGRFSSP
• Function: Inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1.
• KEGG Pathway: Complement and coagulation cascades (hsa04610)
• Reactome Pathway:
  Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation (R-HSA-8950505)
  Dissolution of Fibrin Clot (R-HSA-75205)

Molecular Interaction Atlas (MIA) of This DOT

49 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Matthew-Wood syndrome	DISA7HR7	Definitive	Altered Expression	[1]
Adenocarcinoma	DIS3IHTY	Strong	Biomarker	[2]
Asthma	DISW9QNS	Strong	Altered Expression	[3]
Carcinoma	DISH9F1N	Strong	Altered Expression	[4]
Cardiovascular disease	DIS2IQDX	Strong	Genetic Variation	[5]
Colon cancer	DISVC52G	Strong	Biomarker	[6]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[6]
Congenital contractural arachnodactyly	DISOM1K7	Strong	Biomarker	[7]
Coronary heart disease	DIS5OIP1	Strong	Genetic Variation	[8]
Depression	DIS3XJ69	Strong	Biomarker	[9]
Endometriosis	DISX1AG8	Strong	Biomarker	[10]
Endometrium neoplasm	DIS6OS2L	Strong	Biomarker	[11]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[12]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[13]
Fetal growth restriction	DIS5WEJ5	Strong	Altered Expression	[14]
Gastric cancer	DISXGOUK	Strong	Biomarker	[15]
Head and neck cancer	DISBPSQZ	Strong	Biomarker	[16]
Head and neck carcinoma	DISOU1DS	Strong	Biomarker	[16]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[17]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[18]
High blood pressure	DISY2OHH	Strong	Biomarker	[19]
Keloid	DISV09JY	Strong	Altered Expression	[20]
Lung adenocarcinoma	DISD51WR	Strong	Altered Expression	[21]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[22]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Biomarker	[23]
Non-alcoholic steatohepatitis	DIST4788	Strong	Biomarker	[23]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[24]
Obesity	DIS47Y1K	Strong	Biomarker	[25]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[26]
Peptic ulcer	DISL8XZI	Strong	Genetic Variation	[27]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Genetic Variation	[28]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[29]
Systemic lupus erythematosus	DISI1SZ7	Strong	Genetic Variation	[30]
Thrombophilia	DISQR7U7	Strong	Altered Expression	[31]
Breast neoplasm	DISNGJLM	moderate	Biomarker	[32]
Non-insulin dependent diabetes	DISK1O5Z	moderate	Biomarker	[33]
Osteoarthritis	DIS05URM	moderate	Biomarker	[34]
Anxiety	DISIJDBA	Limited	Biomarker	[9]
Anxiety disorder	DISBI2BT	Limited	Biomarker	[9]
Colorectal carcinoma	DIS5PYL0	Limited	Biomarker	[35]
Coronary atherosclerosis	DISKNDYU	Limited	Genetic Variation	[8]
Gastric neoplasm	DISOKN4Y	Limited	Biomarker	[36]
Glioma	DIS5RPEH	Limited	Altered Expression	[37]
Hereditary diffuse gastric adenocarcinoma	DISUIBYS	Limited	Biomarker	[36]
Pancreatic cancer	DISJC981	Limited	Biomarker	[38]
Prostate cancer	DISF190Y	Limited	Altered Expression	[39]
Prostate carcinoma	DISMJPLE	Limited	Altered Expression	[39]
Rheumatoid arthritis	DISTSB4J	Limited	Altered Expression	[40]
Stomach cancer	DISKIJSX	Limited	Biomarker	[15]

This DOT Affected the Drug Response of 5 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Paclitaxel	DMLB81S	Approved	Plasminogen activator inhibitor 2 (SERPINB2) affects the response to substance of Paclitaxel.	[77]
Mitomycin	DMH0ZJE	Approved	Plasminogen activator inhibitor 2 (SERPINB2) affects the response to substance of Mitomycin.	[77]
Topotecan	DMP6G8T	Approved	Plasminogen activator inhibitor 2 (SERPINB2) affects the response to substance of Topotecan.	[77]
Vinblastine	DM5TVS3	Approved	Plasminogen activator inhibitor 2 (SERPINB2) affects the response to substance of Vinblastine.	[77]
Thalidomide	DM70BU5	Approved	Plasminogen activator inhibitor 2 (SERPINB2) increases the response to substance of Thalidomide.	[78]

40 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[41]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[42]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[43]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[44]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[45]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[46]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[47]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[48]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide affects the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[49]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[50]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[36]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[52]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[53]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[54]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[46]
Folic acid	DMEMBJC	Approved	Folic acid affects the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[55]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[56]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[57]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[42]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[58]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[59]
Malathion	DMXZ84M	Approved	Malathion increases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[60]
Melphalan	DMOLNHF	Approved	Melphalan increases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[61]
Alitretinoin	DMME8LH	Approved	Alitretinoin decreases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[42]
Lucanthone	DMZLBUO	Approved	Lucanthone increases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[62]
Vitamin C	DMXJ7O8	Approved	Vitamin C decreases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[63]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene decreases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[64]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[65]
Curcumin	DMQPH29	Phase 3	Curcumin increases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[66]
Fenretinide	DMRD5SP	Phase 3	Fenretinide decreases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[67]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[68]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[69]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[70]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[71]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[72]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[73]
CH-223191	DMMJZYC	Investigative	CH-223191 decreases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[74]
Arachidonic acid	DMUOQZD	Investigative	Arachidonic acid increases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[75]
all-trans-4-oxo-retinoic acid	DMM2R1N	Investigative	all-trans-4-oxo-retinoic acid decreases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[42]
Alpha-naphthoflavone	DMELOIQ	Investigative	Alpha-naphthoflavone decreases the expression of Plasminogen activator inhibitor 2 (SERPINB2).	[76]

References

• [1] NO(? /RUNX3/kynurenine metabolic signaling enhances disease aggressiveness in pancreatic cancer.Int J Cancer. 2020 Jun 1;146(11):3160-3169. doi: 10.1002/ijc.32733. Epub 2019 Nov 19.
• [2] The urokinase plasminogen activation system in gastroesophageal cancer: A systematic review and meta-analysis.Oncotarget. 2017 Apr 4;8(14):23099-23109. doi: 10.18632/oncotarget.15485.
• [3] Multitissue Transcriptomics Delineates the Diversity of Airway T Cell Functions in Asthma.Am J Respir Cell Mol Biol. 2018 Feb;58(2):261-270. doi: 10.1165/rcmb.2017-0162OC.
• [4] Differential mRNA expression of urokinase-type plasminogen activator, plasminogen activator receptor and plasminogen activator inhibitor type-2 in normal human endometria and endometrial carcinomas.Gynecol Oncol. 2000 Nov;79(2):244-50. doi: 10.1006/gyno.2000.5959.
• [5] Influences on plasminogen activator inhibitor-2 polymorphism-associated recurrent cardiovascular disease risk in patients with high HDL cholesterol and inflammation.Atherosclerosis. 2016 Jul;250:1-8. doi: 10.1016/j.atherosclerosis.2016.04.017. Epub 2016 Apr 21.
• [6] Localization of urokinase-type plasminogen activator, plasminogen activator inhibitor-1, 2 and plasminogen in colon cancer.Jpn J Cancer Res. 1995 Jan;86(1):48-56. doi: 10.1111/j.1349-7006.1995.tb02987.x.
• [7] The microRNA-15a-PAI-2 axis in cholangiocarcinoma-associated fibroblasts promotes migration of cancer cells.Mol Cancer. 2018 Jan 18;17(1):10. doi: 10.1186/s12943-018-0760-x.
• [8] Variant of PAI-2 gene is associated with coronary artery disease and recurrent coronary event risk in Chinese Han population.Lipids Health Dis. 2015 Nov 16;14:148. doi: 10.1186/s12944-015-0150-y.
• [9] Evaluation of the PAI-A Anxiety and Depression Scales: Evidence of Construct Validity.J Pers Assess. 2018 May-Jun;100(3):313-320. doi: 10.1080/00223891.2017.1347569. Epub 2017 Jul 31.
• [10] Evaluation of PAI-1 in endometriosis using a homologous immunocompetent mouse model.Biol Reprod. 2018 Aug 1;99(2):326-335. doi: 10.1093/biolre/ioy057.
• [11] Plasminogen activator inhibitor type 2: potential prognostic factor for endometrial carcinomas.Neoplasma. 2001;48(6):462-7.
• [12] Is there a role for urokinase-type plasminogen activator inhibitors as maintenance therapy in patients with ovarian cancer?.Eur J Surg Oncol. 2017 Feb;43(2):252-257. doi: 10.1016/j.ejso.2016.06.002. Epub 2016 Jun 20.
• [13] Cellular distribution and clinical value of urokinase-type plasminogen activator, its receptor, and plasminogen activator inhibitor-2 in esophageal squamous cell carcinoma.Am J Pathol. 2000 Feb;156(2):567-75. doi: 10.1016/S0002-9440(10)64761-X.
• [14] Decreased expression of PAI-2 mRNA and protein in pregnancies complicated with intrauterine fetal growth retardation.Thromb Haemost. 1996 Nov;76(5):761-7.
• [15] CagY-Dependent Regulation of Type IV Secretion in Helicobacter pylori Is Associated with Alterations in Integrin Binding.mBio. 2018 May 15;9(3):e00717-18. doi: 10.1128/mBio.00717-18.
• [16] Plasminogen activator inhibitor-1 as regulator of tumor-initiating cell properties in head and neck cancers.Head Neck. 2016 Apr;38 Suppl 1:E895-904. doi: 10.1002/hed.24124. Epub 2015 Jul 16.
• [17] SERPINB2 down-regulation contributes to chemoresistance in head and neck cancer.Mol Carcinog. 2014 Oct;53(10):777-86. doi: 10.1002/mc.22033. Epub 2013 May 9.
• [18] Plasminogen activator inhibitor 2 (PAI2) inhibits invasive potential of hepatocellular carcinoma cells in vitro via uPA- and RB/E2F1-related mechanisms.Hepatol Int. 2019 Mar;13(2):180-189. doi: 10.1007/s12072-018-9920-8. Epub 2019 Jan 1.
• [19] Plasminogen activator inhibitor-1 activity and the 4G/5G polymorphism are prospectively associated with blood pressure and hypertension status.J Hypertens. 2019 Dec;37(12):2361-2370. doi: 10.1097/HJH.0000000000002204.
• [20] Association of plasminogen activator inhibitor-1 and vitamin D receptor expression with the risk of keloid disease in a Chinese population.Kaohsiung J Med Sci. 2017 Jan;33(1):24-29. doi: 10.1016/j.kjms.2016.10.013. Epub 2016 Dec 9.
• [21] Low expression of SerpinB2 is associated with reduced survival in lung adenocarcinomas.Oncotarget. 2017 Oct 3;8(53):90706-90718. doi: 10.18632/oncotarget.21456. eCollection 2017 Oct 31.
• [22] The role of TPA I/D and PAI-1 4G/5G polymorphisms in multiple sclerosis.Dis Markers. 2014;2014:362708. doi: 10.1155/2014/362708. Epub 2014 Apr 16.
• [23] Liver transcriptional profile of atherosclerosis-related genes in human nonalcoholic fatty liver disease.Atherosclerosis. 2011 Oct;218(2):378-85. doi: 10.1016/j.atherosclerosis.2011.05.014. Epub 2011 May 18.
• [24] Down-regulation of SerpinB2 is associated with gefitinib resistance in non-small cell lung cancer and enhances invadopodia-like structure protrusions.Sci Rep. 2016 Aug 25;6:32258. doi: 10.1038/srep32258.
• [25] Recent advances in molecular genetics of cardiovascular disorders. Implications for atherosclerosis and diseases of cellular lipid metabolism.Pathol Oncol Res. 1998;4(2):152-60.
• [26] Multiple roles of the candidate oncogene ZNF217 in ovarian epithelial neoplastic progression.Int J Cancer. 2007 May 1;120(9):1863-73. doi: 10.1002/ijc.22300.
• [27] Bacterial Energetic Requirements for Helicobacter pylori Cag Type IV Secretion System-Dependent Alterations in Gastric Epithelial Cells.Infect Immun. 2020 Jan 22;88(2):e00790-19. doi: 10.1128/IAI.00790-19. Print 2020 Jan 22.
• [28] Role of Plasminogen Activator Inhibitor Type 1 in Pathologies of Female Reproductive Diseases.Int J Mol Sci. 2017 Jul 29;18(8):1651. doi: 10.3390/ijms18081651.
• [29] Maspin - the most commonly-expressed gene of the 18q21.3 serpin cluster in lung cancer - is strongly expressed in preneoplastic bronchial lesions.Oncogene. 2003 Nov 27;22(54):8677-87. doi: 10.1038/sj.onc.1207127.
• [30] The -675 4G/5G PAI-1 polymorphism confers genetic susceptibility to systemic lupus erythematosus, its clinical manifestations, and comorbidities in Mexican-Mestizo population.Autoimmunity. 2020 Mar;53(2):71-77. doi: 10.1080/08916934.2019.1700957. Epub 2019 Dec 12.
• [31] SerpinB2 deficiency in mice reduces bleeding times via dysregulated platelet activation.Platelets. 2019;30(5):658-663. doi: 10.1080/09537104.2018.1535702. Epub 2018 Nov 2.
• [32] microRNA-200c/141 upregulates SerpinB2 to promote breast cancer cell metastasis and reduce patient survival.Oncotarget. 2017 May 16;8(20):32769-32782. doi: 10.18632/oncotarget.15680.
• [33] A Noncanonical Role for Plasminogen Activator Inhibitor Type 1 in Obesity-Induced Diabetes.Am J Pathol. 2019 Jul;189(7):1413-1422. doi: 10.1016/j.ajpath.2019.04.004. Epub 2019 May 2.
• [34] Cationic poly-l-lysine-encapsulated melanin nanoparticles as efficient photoacoustic agents targeting to glycosaminoglycans for the early diagnosis of articular cartilage degeneration in osteoarthritis.Nanoscale. 2018 Jul 19;10(28):13471-13484. doi: 10.1039/c8nr03791d.
• [35] Chromosomal localization of the human urokinase plasminogen activator receptor and plasminogen activator inhibitor type-2 genes: implications in colorectal cancer.J Gastroenterol Hepatol. 1994 Jul-Aug;9(4):340-3. doi: 10.1111/j.1440-1746.1994.tb01252.x.
• [36] Chemical genomic screening for methylation-silenced genes in gastric cancer cell lines using 5-aza-2'-deoxycytidine treatment and oligonucleotide microarray. Cancer Sci. 2006 Jan;97(1):64-71.
• [37] Modulation of tissue-type plasminogen activator expression by platelet activating factor in human glioma cells.J Neurooncol. 2002 Sep;59(3):193-8. doi: 10.1023/a:1019966918589.
• [38] SerpinB2 regulates stromal remodelling and local invasion in pancreatic cancer.Oncogene. 2017 Jul 27;36(30):4288-4298. doi: 10.1038/onc.2017.63. Epub 2017 Mar 27.
• [39] Adenovirus-mediated PEDF expression inhibits prostate cancer cell growth and results in augmented expression of PAI-2.Cancer Biol Ther. 2007 Mar;6(3):419-25. doi: 10.4161/cbt.6.3.3757. Epub 2007 Mar 28.
• [40] Gingival crevicular fluid tissue/blood vessel-type plasminogen activator and plasminogen activator inhibitor-2 levels in patients with rheumatoid arthritis: effects of nonsurgical periodontal therapy.J Periodontal Res. 2017 Jun;52(3):574-581. doi: 10.1111/jre.12425. Epub 2016 Oct 26.
• [41] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [42] Retinoic acid and its 4-oxo metabolites are functionally active in human skin cells in vitro. J Invest Dermatol. 2005 Jul;125(1):143-53.
• [43] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [44] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [45] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [46] ERE-independent ERalpha target genes differentially expressed in human breast tumors. Mol Cell Endocrinol. 2005 Dec 21;245(1-2):53-9. doi: 10.1016/j.mce.2005.10.003. Epub 2005 Nov 17.
• [47] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [48] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [49] [Effects of As2O3 on tissue factor, plasminogen activator inhibitor-1 and -2 expression in NB4, HL-60 and THP-1 cells]. Sichuan Da Xue Xue Bao Yi Xue Ban. 2003 Oct;34(4):645-9.
• [50] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [51] Chemical genomic screening for methylation-silenced genes in gastric cancer cell lines using 5-aza-2'-deoxycytidine treatment and oligonucleotide microarray. Cancer Sci. 2006 Jan;97(1):64-71.
• [52] JunD is involved in the antiproliferative effect of Delta9-tetrahydrocannabinol on human breast cancer cells. Oncogene. 2008 Aug 28;27(37):5033-44.
• [53] Progesterone regulation of implantation-related genes: new insights into the role of oestrogen. Cell Mol Life Sci. 2007 Apr;64(7-8):1009-32.
• [54] Cellular response to 5-fluorouracil (5-FU) in 5-FU-resistant colon cancer cell lines during treatment and recovery. Mol Cancer. 2006 May 18;5:20. doi: 10.1186/1476-4598-5-20.
• [55] Effects of folate deficiency on gene expression in the apoptosis and cancer pathways in colon cancer cells. Carcinogenesis. 2006 May;27(5):916-24. doi: 10.1093/carcin/bgi312. Epub 2005 Dec 16.
• [56] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [57] Cannabidiol enhances cytotoxicity of anti-cancer drugs in human head and neck squamous cell carcinoma. Sci Rep. 2020 Nov 26;10(1):20622. doi: 10.1038/s41598-020-77674-y.
• [58] Effects of aspirin on metastasis-associated gene expression detected by cDNA microarray. Acta Pharmacol Sin. 2004 Oct;25(10):1327-33.
• [59] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [60] Exposure to Insecticides Modifies Gene Expression and DNA Methylation in Hematopoietic Tissues In Vitro. Int J Mol Sci. 2023 Mar 26;24(7):6259. doi: 10.3390/ijms24076259.
• [61] Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
• [62] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [63] Antiproliferative effect of ascorbic acid is associated with the inhibition of genes necessary to cell cycle progression. PLoS One. 2009;4(2):e4409.
• [64] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [65] Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
• [66] Gene expression profiling identifies activating transcription factor 3 as a novel contributor to the proapoptotic effect of curcumin. Mol Cancer Ther. 2005 Feb;4(2):233-41.
• [67] Regulation of lipocalin-2 gene by the cancer chemopreventive retinoid 4-HPR. Int J Cancer. 2006 Oct 1;119(7):1599-606.
• [68] TCDD-inducible plasminogen activator inhibitor type 2 (PAI-2) in human hepatocytes, HepG2 and monocytic U937 cells. Carcinogenesis. 1996 Mar;17(3):443-9. doi: 10.1093/carcin/17.3.443.
• [69] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [70] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [71] The genome-wide expression profile of Scrophularia ningpoensis-treated thapsigargin-stimulated U-87MG cells. Neurotoxicology. 2009 May;30(3):368-76.
• [72] Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.
• [73] Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
• [74] The Ah receptor regulates growth factor expression in head and neck squamous cell carcinoma cell lines. Mol Carcinog. 2014 Oct;53(10):765-76.
• [75] Roles of cytosolic phospholipase A2 and Src kinase in the early action of 2,3,7,8-tetrachlorodibenzo-p-dioxin through a nongenomic pathway in MCF10A cells. Mol Pharmacol. 2008 Jul;74(1):255-63.
• [76] Inflammatory pathway genes belong to major targets of persistent organic pollutants in adipose cells. Environ Health Perspect. 2012 Apr;120(4):508-14.
• [77] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
• [78] Genetic factors underlying the risk of thalidomide-related neuropathy in patients with multiple myeloma. J Clin Oncol. 2011 Mar 1;29(7):797-804. doi: 10.1200/JCO.2010.28.0792. Epub 2011 Jan 18.