Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYJMLWM)

• DOT Name: Regulator of cell cycle RGCC (RGCC)
• Synonyms: Response gene to complement 32 protein; RGC-32
• Gene Name: RGCC
• Related Disease:
  Rheumatoid arthritis
  Adenoma
  Alzheimer disease
  Arteriosclerosis
  Astrocytoma
  Atherosclerosis
  Atopic dermatitis
  Autoimmune disease
  Carcinoma
  Cervical cancer
  Cervical carcinoma
  Colon cancer
  Colon carcinoma
  Colonic neoplasm
  Dilated cardiomyopathy
  Dilated cardiomyopathy 1A
  Estrogen-receptor positive breast cancer
  Glioma
  Hepatocellular carcinoma
  leukaemia
  Leukemia
  Lung cancer
  Lung carcinoma
  Myocardial ischemia
  Neoplasm
  Nephropathy
  Nervous system inflammation
  Non-small-cell lung cancer
  Promyelocytic leukaemia
  Renal fibrosis
  Skin cancer
  Small-cell lung cancer
  Systemic sclerosis
  Thyroid cancer
  Thyroid gland carcinoma
  Thyroid tumor
  Diabetic retinopathy
  High blood pressure
  Multiple sclerosis
  Non-insulin dependent diabetes
  Retinopathy
  Small lymphocytic lymphoma
  Breast cancer
  Breast carcinoma
  Colorectal carcinoma
  Nasopharyngeal carcinoma
  Pancreatic cancer
  Retinoblastoma
• UniProt ID: RGCC_HUMAN
• Pfam ID: PF15151
• Sequence:
  MKPPAAQGSPAAAAAAAPALDSAAAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERM
  KRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDT
  KELEAFIADLDKTLASM
• Function: Modulates the activity of cell cycle-specific kinases. Enhances CDK1 activity. May contribute to the regulation of the cell cycle. May inhibit growth of glioma cells by promoting arrest of mitotic progression at the G2/M transition. Fibrogenic factor contributing to the pathogenesis of renal fibrosis through fibroblast activation.
• Tissue Specificity: Detected in brain, heart and liver (at protein level). Highly expressed in liver, skeletal muscle, kidney and pancreas. Detected at lower levels in heart, brain and placenta. Detected in aorta endothelial cells. Overexpressed in colon, breast, prostate, bladder, lung, and ovarian cancer tissues.
• KEGG Pathway: Regulation of actin cytoskeleton (hsa04810)
• Reactome Pathway: TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain (R-HSA-6804115)

Molecular Interaction Atlas (MIA) of This DOT

48 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Rheumatoid arthritis	DISTSB4J	Definitive	Biomarker	[1]
Adenoma	DIS78ZEV	Strong	Altered Expression	[2]
Alzheimer disease	DISF8S70	Strong	Biomarker	[3]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[4]
Astrocytoma	DISL3V18	Strong	Biomarker	[5]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[4]
Atopic dermatitis	DISTCP41	Strong	Altered Expression	[6]
Autoimmune disease	DISORMTM	Strong	Biomarker	[7]
Carcinoma	DISH9F1N	Strong	Biomarker	[8]
Cervical cancer	DISFSHPF	Strong	Biomarker	[9]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[9]
Colon cancer	DISVC52G	Strong	Altered Expression	[10]
Colon carcinoma	DISJYKUO	Strong	Altered Expression	[10]
Colonic neoplasm	DISSZ04P	Strong	Biomarker	[11]
Dilated cardiomyopathy	DISX608J	Strong	Biomarker	[12]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Altered Expression	[12]
Estrogen-receptor positive breast cancer	DIS1H502	Strong	Altered Expression	[13]
Glioma	DIS5RPEH	Strong	Biomarker	[9]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[9]
leukaemia	DISS7D1V	Strong	Altered Expression	[14]
Leukemia	DISNAKFL	Strong	Altered Expression	[14]
Lung cancer	DISCM4YA	Strong	Biomarker	[15]
Lung carcinoma	DISTR26C	Strong	Biomarker	[15]
Myocardial ischemia	DISFTVXF	Strong	Biomarker	[16]
Neoplasm	DISZKGEW	Strong	Altered Expression	[10]
Nephropathy	DISXWP4P	Strong	Biomarker	[17]
Nervous system inflammation	DISB3X5A	Strong	Biomarker	[18]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Genetic Variation	[19]
Promyelocytic leukaemia	DISYGG13	Strong	Biomarker	[20]
Renal fibrosis	DISMHI3I	Strong	Biomarker	[21]
Skin cancer	DISTM18U	Strong	Altered Expression	[22]
Small-cell lung cancer	DISK3LZD	Strong	Genetic Variation	[23]
Systemic sclerosis	DISF44L6	Strong	Biomarker	[24]
Thyroid cancer	DIS3VLDH	Strong	Biomarker	[25]
Thyroid gland carcinoma	DISMNGZ0	Strong	Biomarker	[25]
Thyroid tumor	DISLVKMD	Strong	Biomarker	[25]
Diabetic retinopathy	DISHGUJM	moderate	Altered Expression	[26]
High blood pressure	DISY2OHH	moderate	Altered Expression	[27]
Multiple sclerosis	DISB2WZI	moderate	Biomarker	[7]
Non-insulin dependent diabetes	DISK1O5Z	moderate	Altered Expression	[26]
Retinopathy	DISB4B0F	moderate	Biomarker	[26]
Small lymphocytic lymphoma	DIS30POX	moderate	Biomarker	[28]
Breast cancer	DIS7DPX1	Limited	Biomarker	[29]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[29]
Colorectal carcinoma	DIS5PYL0	Limited	Altered Expression	[30]
Nasopharyngeal carcinoma	DISAOTQ0	Limited	Biomarker	[31]
Pancreatic cancer	DISJC981	Limited	Biomarker	[32]
Retinoblastoma	DISVPNPB	Limited	Biomarker	[33]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Temozolomide	DMKECZD	Approved	Regulator of cell cycle RGCC (RGCC) affects the response to substance of Temozolomide.	[64]
DTI-015	DMXZRW0	Approved	Regulator of cell cycle RGCC (RGCC) affects the response to substance of DTI-015.	[64]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Regulator of cell cycle RGCC (RGCC).	[34]

34 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Regulator of cell cycle RGCC (RGCC).	[35]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Regulator of cell cycle RGCC (RGCC).	[36]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Regulator of cell cycle RGCC (RGCC).	[37]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Regulator of cell cycle RGCC (RGCC).	[38]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Regulator of cell cycle RGCC (RGCC).	[39]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Regulator of cell cycle RGCC (RGCC).	[40]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Regulator of cell cycle RGCC (RGCC).	[41]
Arsenic	DMTL2Y1	Approved	Arsenic affects the expression of Regulator of cell cycle RGCC (RGCC).	[42]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Regulator of cell cycle RGCC (RGCC).	[43]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Regulator of cell cycle RGCC (RGCC).	[44]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Regulator of cell cycle RGCC (RGCC).	[45]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Regulator of cell cycle RGCC (RGCC).	[46]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Regulator of cell cycle RGCC (RGCC).	[40]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Regulator of cell cycle RGCC (RGCC).	[47]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Regulator of cell cycle RGCC (RGCC).	[48]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Regulator of cell cycle RGCC (RGCC).	[45]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Regulator of cell cycle RGCC (RGCC).	[49]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Regulator of cell cycle RGCC (RGCC).	[50]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Regulator of cell cycle RGCC (RGCC).	[51]
Etoposide	DMNH3PG	Approved	Etoposide increases the expression of Regulator of cell cycle RGCC (RGCC).	[52]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Regulator of cell cycle RGCC (RGCC).	[53]
Indomethacin	DMSC4A7	Approved	Indomethacin increases the expression of Regulator of cell cycle RGCC (RGCC).	[54]
Pioglitazone	DMKJ485	Approved	Pioglitazone decreases the expression of Regulator of cell cycle RGCC (RGCC).	[55]
Ampicillin	DMHWE7P	Approved	Ampicillin increases the expression of Regulator of cell cycle RGCC (RGCC).	[43]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Regulator of cell cycle RGCC (RGCC).	[56]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the expression of Regulator of cell cycle RGCC (RGCC).	[57]
ANW-32821	DMMJOZD	Phase 2	ANW-32821 increases the expression of Regulator of cell cycle RGCC (RGCC).	[58]
Lithium	DMZ3OU6	Phase 2	Lithium increases the expression of Regulator of cell cycle RGCC (RGCC).	[59]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Regulator of cell cycle RGCC (RGCC).	[60]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Regulator of cell cycle RGCC (RGCC).	[61]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Regulator of cell cycle RGCC (RGCC).	[62]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Regulator of cell cycle RGCC (RGCC).	[63]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE increases the expression of Regulator of cell cycle RGCC (RGCC).	[43]
Resorcinol	DMM37C0	Investigative	Resorcinol increases the expression of Regulator of cell cycle RGCC (RGCC).	[51]

References

• [1] Systematic Analysis of Differential Expression Profile in Rheumatoid Arthritis Chondrocytes Using Next-Generation Sequencing and Bioinformatics Approaches.Int J Med Sci. 2018 Jul 13;15(11):1129-1142. doi: 10.7150/ijms.27056. eCollection 2018.
• [2] Epigenetic modifications induced by RGC-32 in colon cancer.Exp Mol Pathol. 2010 Feb;88(1):67-76. doi: 10.1016/j.yexmp.2009.10.010. Epub 2009 Oct 31.
• [3] Regulator of Cell Cycle (RGCC) Expression During the Progression of Alzheimer's Disease.Cell Transplant. 2017 Apr 13;26(4):693-702. doi: 10.3727/096368916X694184. Epub 2016 Nov 30.
• [4] RGC-32 (Response Gene to Complement 32) Deficiency Protects Endothelial Cells From Inflammation and Attenuates Atherosclerosis.Arterioscler Thromb Vasc Biol. 2018 Apr;38(4):e36-e47. doi: 10.1161/ATVBAHA.117.310656. Epub 2018 Feb 15.
• [5] Nuclear phosphorylated Y142 -catenin accumulates in astrocytomas and glioblastomas and regulates cell invasion.Cell Cycle. 2015;14(22):3644-55. doi: 10.1080/15384101.2015.1104443.
• [6] Distinct gene expression patterns of peripheral blood cells in hyper-IgE syndrome.Clin Exp Immunol. 2005 Jun;140(3):524-31. doi: 10.1111/j.1365-2249.2005.02805.x.
• [7] RGC-32 and diseases: the first 20years.Immunol Res. 2019 Jun;67(2-3):267-279. doi: 10.1007/s12026-019-09080-0.
• [8] Genetic alterations of the p16 gene in urothelial carcinoma in Taiwanese patients.BJU Int. 2000 Jan;85(1):143-9. doi: 10.1046/j.1464-410x.2000.00323.x.
• [9] LincRNA-p21 knockdown enhances radiosensitivity of hypoxic tumor cells by reducing autophagy through HIF-1/Akt/mTOR/P70S6K pathway.Exp Cell Res. 2017 Sep 15;358(2):188-198. doi: 10.1016/j.yexcr.2017.06.016. Epub 2017 Jul 8.
• [10] Response gene to complement 32 expression in macrophages augments paracrine stimulation-mediated colon cancer progression.Cell Death Dis. 2019 Oct 10;10(10):776. doi: 10.1038/s41419-019-2006-2.
• [11] Response gene to complement 32, a novel hypoxia-regulated angiogenic inhibitor.Circulation. 2009 Aug 18;120(7):617-27. doi: 10.1161/CIRCULATIONAHA.108.841502. Epub 2009 Aug 3.
• [12] Response Gene to Complement-32 Promotes the Imbalance of Treg/Th17 in Patients with Dilated Cardiomyopathy.Cell Physiol Biochem. 2017;43(4):1515-1525. doi: 10.1159/000481975. Epub 2017 Oct 16.
• [13] Kinesin family member-18A (KIF18A) is a predictive biomarker of poor benefit from endocrine therapy in early ER+breast cancer.Breast Cancer Res Treat. 2019 Jan;173(1):93-102. doi: 10.1007/s10549-018-4978-5. Epub 2018 Oct 10.
• [14] Genomic c-Myc quadruplex DNA selectively kills leukemia.Mol Cancer Ther. 2012 Jan;11(1):66-76. doi: 10.1158/1535-7163.MCT-11-0515. Epub 2011 Nov 14.
• [15] Knockdown of response gene to complement 32 (RGC32) induces apoptosis and inhibits cell growth, migration, and invasion in human lung cancer cells.Mol Cell Biochem. 2014 Sep;394(1-2):109-18. doi: 10.1007/s11010-014-2086-3. Epub 2014 May 16.
• [16] Cardioplegia prevents ischemia-induced transcriptional alterations of cytoprotective genes in rat hearts: a DNA microarray study.J Thorac Cardiovasc Surg. 2005 Oct;130(4):1151. doi: 10.1016/j.jtcvs.2005.06.027.
• [17] Renal proteomic analysis of RGC-32 knockout mice reveals the potential mechanism of RGC-32 in regulating cell cycle.Am J Transl Res. 2018 Mar 15;10(3):847-856. eCollection 2018.
• [18] RGC-32 regulates reactive astrocytosis and extracellular matrix deposition in experimental autoimmune encephalomyelitis.Immunol Res. 2018 Aug;66(4):445-461. doi: 10.1007/s12026-018-9011-x.
• [19] Therapeutic Challenge with a CDK 4/6 Inhibitor Induces an RB-Dependent SMAC-Mediated Apoptotic Response in Non-Small Cell Lung Cancer.Clin Cancer Res. 2018 Mar 15;24(6):1402-1414. doi: 10.1158/1078-0432.CCR-17-2074. Epub 2018 Jan 8.
• [20] Inhibition of angiogenesis by the BTB domain of promyelocytic leukemia zinc finger protein.Cancer Lett. 2010 Aug 1;294(1):49-56. doi: 10.1016/j.canlet.2010.01.021. Epub 2010 Mar 17.
• [21] Response gene to complement 32 is essential for fibroblast activation in renal fibrosis.J Biol Chem. 2011 Dec 2;286(48):41323-41330. doi: 10.1074/jbc.M111.259184. Epub 2011 Oct 11.
• [22] LTA4H regulates cell cycle and skin carcinogenesis.Carcinogenesis. 2017 Jul 1;38(7):728-737. doi: 10.1093/carcin/bgx049.
• [23] Molecular abnormalities in lung cancer.J Clin Oncol. 1998 Mar;16(3):1207-17. doi: 10.1200/JCO.1998.16.3.1207.
• [24] RGC32 Promotes Bleomycin-Induced Systemic Sclerosis in a Murine Disease Model by Modulating Classically Activated Macrophage Function.J Immunol. 2018 Apr 15;200(8):2777-2785. doi: 10.4049/jimmunol.1701542. Epub 2018 Mar 5.
• [25] CDC23 regulates cancer cell phenotype and is overexpressed in papillary thyroid cancer.Endocr Relat Cancer. 2011 Nov 28;18(6):731-42. doi: 10.1530/ERC-11-0181. Print 2011.
• [26] Loss of Response Gene to Complement 32 (RGC-32) in Diabetic Mouse Retina Is Involved in Retinopathy Development.Int J Mol Sci. 2018 Nov 17;19(11):3629. doi: 10.3390/ijms19113629.
• [27] Response Gene to Complement 32 Maintains Blood Pressure Homeostasis by Regulating -Adrenergic Receptor Expression.Circ Res. 2018 Oct 12;123(9):1080-1090. doi: 10.1161/CIRCRESAHA.118.313266.
• [28] MicroRNA and proliferation control in chronic lymphocytic leukemia: functional relationship between miR-221/222 cluster and p27.Blood. 2010 May 13;115(19):3949-59. doi: 10.1182/blood-2009-11-254656. Epub 2010 Mar 4.
• [29] Estrogen receptor dependent regulation of estrogen related receptor and its role in cell cycle in breast cancer.BMC Cancer. 2018 May 30;18(1):607. doi: 10.1186/s12885-018-4528-x.
• [30] MicroRNA-193a and taxol combination: A new strategy for treatment of colorectal cancer.J Cell Biochem. 2020 Feb;121(2):1388-1399. doi: 10.1002/jcb.29374. Epub 2019 Sep 12.
• [31] FEZF1-AS1 is a key regulator of cell cycle, epithelial-mesenchymal transition and Wnt/-catenin signaling in nasopharyngeal carcinoma cells.Biosci Rep. 2019 Jan 8;39(1):BSR20180906. doi: 10.1042/BSR20180906. Print 2019 Jan 31.
• [32] RGC-32 induces transition of pancreatic cancer to epithelial mesenchyme invivo.Pancreatology. 2018 Jul;18(5):572-576. doi: 10.1016/j.pan.2018.05.480. Epub 2018 May 18.
• [33] Retinoblastoma protein prevents enteric nervous system defects and intestinal pseudo-obstruction.J Clin Invest. 2013 Dec;123(12):5152-64. doi: 10.1172/JCI67653. Epub 2013 Nov 1.
• [34] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [35] Cyclosporine A--induced oxidative stress in human renal mesangial cells: a role for ERK 1/2 MAPK signaling. Toxicol Sci. 2012 Mar;126(1):101-13.
• [36] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [37] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [38] Functional cardiotoxicity assessment of cosmetic compounds using human-induced pluripotent stem cell-derived cardiomyocytes. Arch Toxicol. 2018 Jan;92(1):371-381.
• [39] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [40] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [41] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [42] Drinking-water arsenic exposure modulates gene expression in human lymphocytes from a U.S. population. Environ Health Perspect. 2008 Apr;116(4):524-31. doi: 10.1289/ehp.10861.
• [43] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [44] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [45] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [46] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [47] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [48] Progesterone regulation of implantation-related genes: new insights into the role of oestrogen. Cell Mol Life Sci. 2007 Apr;64(7-8):1009-32.
• [49] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [50] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [51] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [52] Cell death mechanisms of the anti-cancer drug etoposide on human cardiomyocytes isolated from pluripotent stem cells. Arch Toxicol. 2018 Apr;92(4):1507-1524.
• [53] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [54] Evaluation of developmental toxicity using undifferentiated human embryonic stem cells. J Appl Toxicol. 2015 Feb;35(2):205-18.
• [55] Peroxisome proliferator activated receptor gamma (PPAR-gama) ligand pioglitazone regulated gene networks in term human primary trophoblast cells. Reprod Toxicol. 2018 Oct;81:99-107.
• [56] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [57] Application of the adverse outcome pathway concept for investigating developmental neurotoxicity potential of Chinese herbal medicines by using human neural progenitor cells in vitro. Cell Biol Toxicol. 2023 Feb;39(1):319-343. doi: 10.1007/s10565-022-09730-4. Epub 2022 Jun 15.
• [58] Human Mincle Binds to Cholesterol Crystals and Triggers Innate Immune Responses. J Biol Chem. 2015 Oct 16;290(42):25322-32. doi: 10.1074/jbc.M115.645234. Epub 2015 Aug 20.
• [59] A genetic network model of cellular responses to lithium treatment and cocaine abuse in bipolar disorder. BMC Syst Biol. 2010 Nov 19;4:158. doi: 10.1186/1752-0509-4-158.
• [60] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [61] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [62] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [63] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [64] Tumor necrosis factor-alpha-induced protein 3 as a putative regulator of nuclear factor-kappaB-mediated resistance to O6-alkylating agents in human glioblastomas. J Clin Oncol. 2006 Jan 10;24(2):274-87. doi: 10.1200/JCO.2005.02.9405. Epub 2005 Dec 19.