General Information of Drug Off-Target (DOT) (ID: OTEDLG8E)

DOT Name Actin, aortic smooth muscle (ACTA2)
Synonyms EC 3.6.4.-; Alpha-actin-2; Cell growth-inhibiting gene 46 protein
Gene Name ACTA2
Related Disease
Familial thoracic aortic aneurysm and aortic dissection ( )
Multisystemic smooth muscle dysfunction syndrome ( )
Abdominal aortic aneurysm ( )
Aortic aneurysm ( )
Aortic aneurysm, familial thoracic 6 ( )
Aortic disorder ( )
Arterial disorder ( )
Atrial septal defect ( )
Breast cancer ( )
Breast carcinoma ( )
Breast neoplasm ( )
Cardiomyopathy ( )
Cerebrovascular disease ( )
Colon cancer ( )
Colonic neoplasm ( )
Coronary atherosclerosis ( )
Coronary heart disease ( )
Dilated cardiomyopathy 1A ( )
Endometriosis ( )
Hypertrophic cardiomyopathy ( )
Liver cirrhosis ( )
Moyamoya disease ( )
Moyamoya disease 5 ( )
Myocardial infarction ( )
Nasopharyngeal carcinoma ( )
Nephropathy ( )
Patent ductus arteriosus ( )
Stroke ( )
Systemic sclerosis ( )
Vascular disease ( )
Advanced cancer ( )
Connective tissue disorder ( )
Pulmonary fibrosis ( )
Small lymphocytic lymphoma ( )
Ankylosing spondylitis ( )
Crohn disease ( )
Fetal growth restriction ( )
Focal segmental glomerulosclerosis ( )
Ischemia ( )
Lung cancer ( )
Lung carcinoma ( )
Psoriasis ( )
Sclerosing cholangitis ( )
Ulcerative colitis ( )
UniProt ID
ACTA_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
3.6.4.-
Pfam ID
PF00022
Sequence
MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK
MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL
DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK
SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS
KQEYDEAGPSIVHRKCF
Function Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.
KEGG Pathway
Vascular smooth muscle contraction (hsa04270 )
Apelin sig.ling pathway (hsa04371 )
Motor proteins (hsa04814 )
Relaxin sig.ling pathway (hsa04926 )
Reactome Pathway
NOTCH4 Intracellular Domain Regulates Transcription (R-HSA-9013695 )
Smooth Muscle Contraction (R-HSA-445355 )

Molecular Interaction Atlas (MIA) of This DOT

44 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Familial thoracic aortic aneurysm and aortic dissection DIS069FB Definitive Autosomal dominant [1]
Multisystemic smooth muscle dysfunction syndrome DISV2K69 Definitive Autosomal dominant [2]
Abdominal aortic aneurysm DISD06OF Strong Altered Expression [3]
Aortic aneurysm DISQ5KRA Strong Genetic Variation [4]
Aortic aneurysm, familial thoracic 6 DISNTSXF Strong Autosomal dominant [5]
Aortic disorder DISKXISV Strong Genetic Variation [6]
Arterial disorder DISLG4XS Strong Biomarker [7]
Atrial septal defect DISJT76B Strong Genetic Variation [8]
Breast cancer DIS7DPX1 Strong Biomarker [9]
Breast carcinoma DIS2UE88 Strong Biomarker [9]
Breast neoplasm DISNGJLM Strong Biomarker [9]
Cardiomyopathy DISUPZRG Strong Genetic Variation [10]
Cerebrovascular disease DISAB237 Strong Biomarker [11]
Colon cancer DISVC52G Strong Biomarker [12]
Colonic neoplasm DISSZ04P Strong Biomarker [12]
Coronary atherosclerosis DISKNDYU Strong Genetic Variation [13]
Coronary heart disease DIS5OIP1 Strong Genetic Variation [13]
Dilated cardiomyopathy 1A DIS0RK9Z Strong Genetic Variation [14]
Endometriosis DISX1AG8 Strong Altered Expression [15]
Hypertrophic cardiomyopathy DISQG2AI Strong Genetic Variation [16]
Liver cirrhosis DIS4G1GX Strong Biomarker [17]
Moyamoya disease DISO62CA Strong Genetic Variation [18]
Moyamoya disease 5 DISKH1VI Strong Autosomal dominant [19]
Myocardial infarction DIS655KI Strong Genetic Variation [20]
Nasopharyngeal carcinoma DISAOTQ0 Strong Genetic Variation [21]
Nephropathy DISXWP4P Strong Biomarker [22]
Patent ductus arteriosus DIS9P8YS Strong Genetic Variation [2]
Stroke DISX6UHX Strong Genetic Variation [13]
Systemic sclerosis DISF44L6 Strong Biomarker [23]
Vascular disease DISVS67S Strong Biomarker [24]
Advanced cancer DISAT1Z9 moderate Altered Expression [25]
Connective tissue disorder DISKXBS3 Moderate Autosomal dominant [26]
Pulmonary fibrosis DISQKVLA moderate Biomarker [27]
Small lymphocytic lymphoma DIS30POX Disputed Genetic Variation [28]
Ankylosing spondylitis DISRC6IR Limited Genetic Variation [29]
Crohn disease DIS2C5Q8 Limited Genetic Variation [29]
Fetal growth restriction DIS5WEJ5 Limited Biomarker [30]
Focal segmental glomerulosclerosis DISJNHH0 Limited Biomarker [31]
Ischemia DIS5XOOY Limited Biomarker [32]
Lung cancer DISCM4YA Limited Genetic Variation [33]
Lung carcinoma DISTR26C Limited Genetic Variation [33]
Psoriasis DIS59VMN Limited Genetic Variation [29]
Sclerosing cholangitis DIS7GZNB Limited Genetic Variation [29]
Ulcerative colitis DIS8K27O Limited Genetic Variation [29]
------------------------------------------------------------------------------------
⏷ Show the Full List of 44 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Sulforaphane DMQY3L0 Investigative Actin, aortic smooth muscle (ACTA2) affects the binding of Sulforaphane. [103]
------------------------------------------------------------------------------------
81 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Actin, aortic smooth muscle (ACTA2). [34]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Actin, aortic smooth muscle (ACTA2). [35]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Actin, aortic smooth muscle (ACTA2). [36]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Actin, aortic smooth muscle (ACTA2). [37]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Actin, aortic smooth muscle (ACTA2). [38]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Actin, aortic smooth muscle (ACTA2). [39]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Actin, aortic smooth muscle (ACTA2). [40]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Actin, aortic smooth muscle (ACTA2). [41]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Actin, aortic smooth muscle (ACTA2). [42]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Actin, aortic smooth muscle (ACTA2). [43]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Actin, aortic smooth muscle (ACTA2). [44]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Actin, aortic smooth muscle (ACTA2). [45]
Testosterone DM7HUNW Approved Testosterone increases the expression of Actin, aortic smooth muscle (ACTA2). [44]
Triclosan DMZUR4N Approved Triclosan affects the expression of Actin, aortic smooth muscle (ACTA2). [46]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Actin, aortic smooth muscle (ACTA2). [47]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Actin, aortic smooth muscle (ACTA2). [48]
Marinol DM70IK5 Approved Marinol decreases the expression of Actin, aortic smooth muscle (ACTA2). [49]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Actin, aortic smooth muscle (ACTA2). [50]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of Actin, aortic smooth muscle (ACTA2). [51]
Progesterone DMUY35B Approved Progesterone decreases the expression of Actin, aortic smooth muscle (ACTA2). [52]
Panobinostat DM58WKG Approved Panobinostat decreases the expression of Actin, aortic smooth muscle (ACTA2). [53]
Folic acid DMEMBJC Approved Folic acid increases the expression of Actin, aortic smooth muscle (ACTA2). [54]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of Actin, aortic smooth muscle (ACTA2). [55]
Niclosamide DMJAGXQ Approved Niclosamide decreases the expression of Actin, aortic smooth muscle (ACTA2). [56]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol decreases the expression of Actin, aortic smooth muscle (ACTA2). [57]
Paclitaxel DMLB81S Approved Paclitaxel increases the expression of Actin, aortic smooth muscle (ACTA2). [58]
Dasatinib DMJV2EK Approved Dasatinib increases the expression of Actin, aortic smooth muscle (ACTA2). [59]
Lucanthone DMZLBUO Approved Lucanthone increases the expression of Actin, aortic smooth muscle (ACTA2). [60]
Acocantherin DM7JT24 Approved Acocantherin affects the expression of Actin, aortic smooth muscle (ACTA2). [61]
Sodium phenylbutyrate DMXLBCQ Approved Sodium phenylbutyrate increases the expression of Actin, aortic smooth muscle (ACTA2). [53]
Dinoprostone DMTYOPD Approved Dinoprostone increases the expression of Actin, aortic smooth muscle (ACTA2). [62]
Lovastatin DM9OZWQ Approved Lovastatin decreases the expression of Actin, aortic smooth muscle (ACTA2). [63]
Artesunate DMR27C8 Approved Artesunate decreases the expression of Actin, aortic smooth muscle (ACTA2). [64]
Bleomycin DMNER5S Approved Bleomycin increases the expression of Actin, aortic smooth muscle (ACTA2). [65]
Ketamine DMT5HA4 Approved Ketamine increases the expression of Actin, aortic smooth muscle (ACTA2). [66]
Aldosterone DM9S2JW Approved Aldosterone increases the expression of Actin, aortic smooth muscle (ACTA2). [67]
Lamivudine DMI347A Approved Lamivudine decreases the expression of Actin, aortic smooth muscle (ACTA2). [68]
Arformoterol DMYM974 Approved Arformoterol decreases the expression of Actin, aortic smooth muscle (ACTA2). [69]
Pirfenidone DM6VZFQ Approved Pirfenidone decreases the expression of Actin, aortic smooth muscle (ACTA2). [23]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Actin, aortic smooth muscle (ACTA2). [71]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Actin, aortic smooth muscle (ACTA2). [72]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of Actin, aortic smooth muscle (ACTA2). [73]
HMPL-004 DM29XGY Phase 3 HMPL-004 decreases the expression of Actin, aortic smooth muscle (ACTA2). [74]
Glycyrrhizin DM8M2N3 Phase 3 Glycyrrhizin decreases the expression of Actin, aortic smooth muscle (ACTA2). [75]
Genistein DM0JETC Phase 2/3 Genistein decreases the expression of Actin, aortic smooth muscle (ACTA2). [76]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone increases the expression of Actin, aortic smooth muscle (ACTA2). [77]
Tocopherol DMBIJZ6 Phase 2 Tocopherol decreases the expression of Actin, aortic smooth muscle (ACTA2). [78]
PEITC DMOMN31 Phase 2 PEITC increases the expression of Actin, aortic smooth muscle (ACTA2). [79]
BAICALEIN DM4C7E6 Phase 2 BAICALEIN decreases the expression of Actin, aortic smooth muscle (ACTA2). [80]
ACYLINE DM9GRTK Phase 2 ACYLINE decreases the expression of Actin, aortic smooth muscle (ACTA2). [81]
MK-2206 DMT1OZ6 Phase 2 MK-2206 decreases the expression of Actin, aortic smooth muscle (ACTA2). [82]
LTB4 DME26RS Phase 2 LTB4 increases the expression of Actin, aortic smooth muscle (ACTA2). [62]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Actin, aortic smooth muscle (ACTA2). [83]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Actin, aortic smooth muscle (ACTA2). [84]
Arecoline DMFJZK3 Phase 1 Arecoline increases the expression of Actin, aortic smooth muscle (ACTA2). [85]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Actin, aortic smooth muscle (ACTA2). [86]
Tetramethylpyrazine DMC0WNB Discontinued in Phase 2 Tetramethylpyrazine decreases the expression of Actin, aortic smooth muscle (ACTA2). [87]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN decreases the expression of Actin, aortic smooth muscle (ACTA2). [88]
UNC0379 DMD1E4J Preclinical UNC0379 increases the expression of Actin, aortic smooth muscle (ACTA2). [89]
SB 203580 DMAET6F Terminated SB 203580 decreases the expression of Actin, aortic smooth muscle (ACTA2). [90]
Acteoside DM0YHKB Terminated Acteoside decreases the expression of Actin, aortic smooth muscle (ACTA2). [75]
WIN-55212-2 DMACBIW Terminated WIN-55212-2 decreases the expression of Actin, aortic smooth muscle (ACTA2). [91]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Actin, aortic smooth muscle (ACTA2). [72]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Actin, aortic smooth muscle (ACTA2). [55]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A increases the expression of Actin, aortic smooth muscle (ACTA2). [90]
Paraquat DMR8O3X Investigative Paraquat increases the expression of Actin, aortic smooth muscle (ACTA2). [93]
Nickel chloride DMI12Y8 Investigative Nickel chloride increases the expression of Actin, aortic smooth muscle (ACTA2). [94]
D-glucose DMMG2TO Investigative D-glucose increases the expression of Actin, aortic smooth muscle (ACTA2). [95]
Forskolin DM6ITNG Investigative Forskolin decreases the expression of Actin, aortic smooth muscle (ACTA2). [69]
U0126 DM31OGF Investigative U0126 decreases the expression of Actin, aortic smooth muscle (ACTA2). [90]
Oleic acid DM54O1Z Investigative Oleic acid increases the expression of Actin, aortic smooth muscle (ACTA2). [96]
NAPQI DM8F5LR Investigative NAPQI increases the expression of Actin, aortic smooth muscle (ACTA2). [97]
27-hydroxycholesterol DM2L6OZ Investigative 27-hydroxycholesterol increases the expression of Actin, aortic smooth muscle (ACTA2). [98]
I-BET151 DMYRUH2 Investigative I-BET151 decreases the expression of Actin, aortic smooth muscle (ACTA2). [84]
Isoarnebin 4 DM0B7NO Investigative Isoarnebin 4 decreases the expression of Actin, aortic smooth muscle (ACTA2). [99]
PFI-1 DMVFK3J Investigative PFI-1 decreases the expression of Actin, aortic smooth muscle (ACTA2). [84]
MANGOSTIN DMYQGDV Investigative MANGOSTIN decreases the expression of Actin, aortic smooth muscle (ACTA2). [82]
20-HETE DM5BAJ9 Investigative 20-HETE increases the expression of Actin, aortic smooth muscle (ACTA2). [100]
Deoxythymidine DMR90HY Investigative Deoxythymidine increases the expression of Actin, aortic smooth muscle (ACTA2). [58]
LY2109761 DMAWTG3 Investigative LY2109761 increases the expression of Actin, aortic smooth muscle (ACTA2). [101]
J-009747 DMQSB6N Investigative J-009747 increases the expression of Actin, aortic smooth muscle (ACTA2). [102]
------------------------------------------------------------------------------------
⏷ Show the Full List of 81 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of Actin, aortic smooth muscle (ACTA2). [92]
------------------------------------------------------------------------------------

References

1 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
2 Clinical history and management recommendations of the smooth muscle dysfunction syndrome due to ACTA2 arginine 179 alterations. Genet Med. 2018 Oct;20(10):1206-1215. doi: 10.1038/gim.2017.245. Epub 2018 Jan 4.
3 Identification of key microRNAs and genes associated with abdominal aortic aneurysm based on the gene expression profile.Exp Physiol. 2020 Jan;105(1):160-173. doi: 10.1113/EP087705. Epub 2019 Dec 16.
4 Novel variants in the ACTA2 and MYH11 genes in a Cypriot family with thoracic aortic aneurysms: a case report.BMC Med Genet. 2018 Dec 7;19(1):208. doi: 10.1186/s12881-018-0728-0.
5 Clinical Remission of Delta-Aminolevulinic Acid Dehydratase Deficiency Through Suppression of Erythroid Heme Synthesis. Hepatology. 2019 Jul;70(1):434-436. doi: 10.1002/hep.30543. Epub 2019 Jun 6.
6 Altered Smooth Muscle Cell Force Generation as a Driver of Thoracic Aortic Aneurysms and Dissections.Arterioscler Thromb Vasc Biol. 2017 Jan;37(1):26-34. doi: 10.1161/ATVBAHA.116.303229. Epub 2016 Nov 22.
7 Recent developments and new frontiers in childhood arterial ischemic stroke.Int J Stroke. 2019 Jan;14(1):32-43. doi: 10.1177/1747493018790064. Epub 2018 Aug 6.
8 Congenital heart defects are rarely caused by mutations in cardiac and smooth muscle actin genes.Biomed Res Int. 2015;2015:127807. doi: 10.1155/2015/127807. Epub 2015 Mar 10.
9 Combined deletion of Pten and p53 in mammary epithelium accelerates triple-negative breast cancer with dependency on eEF2K.EMBO Mol Med. 2014 Dec;6(12):1542-60. doi: 10.15252/emmm.201404402.
10 A Novel Alpha Cardiac Actin (ACTC1) Mutation Mapping to a Domain in Close Contact with Myosin Heavy Chain Leads to a Variety of Congenital Heart Defects, Arrhythmia and Possibly Midline Defects.PLoS One. 2015 Jun 10;10(6):e0127903. doi: 10.1371/journal.pone.0127903. eCollection 2015.
11 ACTA2 Cerebral Arteriopathy: Not Just a Puff of Smoke.Cerebrovasc Dis. 2018;46(3-4):161-171. doi: 10.1159/000493863. Epub 2018 Oct 9.
12 Global gene expression analysis of rat colon cancers induced by a food-borne carcinogen, 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine.Carcinogenesis. 2004 Aug;25(8):1495-505. doi: 10.1093/carcin/bgh155. Epub 2004 Apr 1.
13 ACTA2 mutation and postpartum hemorrhage: a case report.BMC Med Genet. 2017 Dec 4;18(1):143. doi: 10.1186/s12881-017-0505-5.
14 Actin mutations in hypertrophic and dilated cardiomyopathy cause inefficient protein folding and perturbed filament formation.FEBS J. 2005 Apr;272(8):2037-49. doi: 10.1111/j.1742-4658.2005.04630.x.
15 The estrogen-regulated lncRNA H19/miR-216a-5p axis alters stromal cell invasion and migration via ACTA2 in endometriosis.Mol Hum Reprod. 2019 Sep 1;25(9):550-561. doi: 10.1093/molehr/gaz040.
16 Functional characterization of the human -cardiac actin mutations Y166C and M305L involved in hypertrophic cardiomyopathy.Cell Mol Life Sci. 2012 Oct;69(20):3457-79. doi: 10.1007/s00018-012-1030-5. Epub 2012 May 29.
17 MicroRNA-942 mediates hepatic stellate cell activation by regulating BAMBI expression in human liver fibrosis.Arch Toxicol. 2018 Sep;92(9):2935-2946. doi: 10.1007/s00204-018-2278-9. Epub 2018 Aug 10.
18 "Twig-like" cerebral vessels are not pathognomonic for ACTA A2 mutations: A case report.Interv Neuroradiol. 2018 Aug;24(4):463-468. doi: 10.1177/1591019918765239. Epub 2018 Mar 28.
19 Expanding ACTA2 genotypes with corresponding phenotypes overlapping with smooth muscle dysfunction syndrome. Am J Med Genet A. 2022 Aug;188(8):2389-2396. doi: 10.1002/ajmg.a.62775. Epub 2022 May 14.
20 Acute aortic dissections with pregnancy in women with ACTA2 mutations.Am J Med Genet A. 2014 Jan;164A(1):106-12. doi: 10.1002/ajmg.a.36208. Epub 2013 Nov 15.
21 A genome-wide association study of nasopharyngeal carcinoma identifies three new susceptibility loci.Nat Genet. 2010 Jul;42(7):599-603. doi: 10.1038/ng.601. Epub 2010 May 30.
22 Wen-pi-tang-Hab-Wu-ling-san reduces ureteral obstructive renal fibrosis by the reduction of oxidative stress, inflammation, and TGF-beta/Smad2/3 signaling.Food Chem Toxicol. 2010 Feb;48(2):522-9. doi: 10.1016/j.fct.2009.11.006. Epub 2009 Nov 11.
23 Targeting the myofibroblast genetic switch: inhibitors of myocardin-related transcription factor/serum response factor-regulated gene transcription prevent fibrosis in a murine model of skin injury. J Pharmacol Exp Ther. 2014 Jun;349(3):480-6. doi: 10.1124/jpet.114.213520. Epub 2014 Apr 4.
24 European reference network for rare vascular diseases (VASCERN) consensus statement for the screening and management of patients with pathogenic ACTA2 variants.Orphanet J Rare Dis. 2019 Nov 21;14(1):264. doi: 10.1186/s13023-019-1186-2.
25 A Novel Allosteric Inhibitor of Phosphoglycerate Mutase 1 Suppresses Growth and Metastasis of Non-Small-Cell Lung Cancer.Cell Metab. 2019 Dec 3;30(6):1107-1119.e8. doi: 10.1016/j.cmet.2019.09.014. Epub 2019 Oct 10.
26 The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
27 TMEM100 mediates inflammatory cytokines secretion in hepatic stellate cells and its mechanism research.Toxicol Lett. 2019 Dec 15;317:82-91. doi: 10.1016/j.toxlet.2018.12.010. Epub 2019 Jan 11.
28 A genome-wide association study identifies multiple susceptibility loci for chronic lymphocytic leukemia.Nat Genet. 2014 Jan;46(1):56-60. doi: 10.1038/ng.2843. Epub 2013 Dec 1.
29 Analysis of five chronic inflammatory diseases identifies 27 new associations and highlights disease-specific patterns at shared loci.Nat Genet. 2016 May;48(5):510-8. doi: 10.1038/ng.3528. Epub 2016 Mar 14.
30 Placental Stem Villus Arterial Remodeling Associated with Reduced Hydrogen Sulfide Synthesis Contributes to Human Fetal Growth Restriction.Am J Pathol. 2017 Apr;187(4):908-920. doi: 10.1016/j.ajpath.2016.12.002. Epub 2017 Feb 1.
31 Beneficial effect of all-trans retinoic acid (ATRA) on glomerulosclerosis rats via the down-regulation of the expression of alpha-smooth muscle actin: a comparative study between ATRA and benazepril.Exp Mol Pathol. 2010 Aug;89(1):51-7. doi: 10.1016/j.yexmp.2010.05.003. Epub 2010 May 21.
32 Reactive oxygen species/oxidative stress contributes to progression of kidney fibrosis following transient ischemic injury in mice.Am J Physiol Renal Physiol. 2009 Aug;297(2):F461-70. doi: 10.1152/ajprenal.90735.2008. Epub 2009 May 20.
33 Deciphering the impact of common genetic variation on lung cancer risk: a genome-wide association study.Cancer Res. 2009 Aug 15;69(16):6633-41. doi: 10.1158/0008-5472.CAN-09-0680. Epub 2009 Aug 4.
34 Effects of lithium and valproic acid on gene expression and phenotypic markers in an NT2 neurosphere model of neural development. PLoS One. 2013;8(3):e58822.
35 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
36 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
37 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
38 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
39 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
40 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
41 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
42 Quercetin suppresses pancreatic ductal adenocarcinoma progression via inhibition of SHH and TGF-/Smad signaling pathways. Cell Biol Toxicol. 2021 Jun;37(3):479-496. doi: 10.1007/s10565-020-09562-0. Epub 2020 Oct 17.
43 Arsenic trioxide inhibits the differentiation of fibroblasts to myofibroblasts through nuclear factor erythroid 2-like 2 (NFE2L2) protein and the Smad2/3 pathway. J Cell Physiol. 2019 Mar;234(3):2606-2617. doi: 10.1002/jcp.27073. Epub 2018 Oct 14.
44 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
45 Proteomic analysis revealed association of aberrant ROS signaling with suberoylanilide hydroxamic acid-induced autophagy in Jurkat T-leukemia cells. Autophagy. 2010 Aug;6(6):711-24. doi: 10.4161/auto.6.6.12397. Epub 2010 Aug 17.
46 Primary Human Hepatocyte Spheroids as Tools to Study the Hepatotoxic Potential of Non-Pharmaceutical Chemicals. Int J Mol Sci. 2021 Oct 12;22(20):11005. doi: 10.3390/ijms222011005.
47 Editor's Highlight: Modeling Compound-Induced Fibrogenesis In Vitro Using Three-Dimensional Bioprinted Human Liver Tissues. Toxicol Sci. 2016 Dec;154(2):354-367. doi: 10.1093/toxsci/kfw169. Epub 2016 Sep 7.
48 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
49 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
50 Zoledronate dysregulates fatty acid metabolism in renal tubular epithelial cells to induce nephrotoxicity. Arch Toxicol. 2018 Jan;92(1):469-485.
51 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
52 Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
53 Comparison of the antifibrotic effects of the pan-histone deacetylase-inhibitor panobinostat versus the IPF-drug pirfenidone in fibroblasts from patients with idiopathic pulmonary fibrosis. PLoS One. 2018 Nov 27;13(11):e0207915. doi: 10.1371/journal.pone.0207915. eCollection 2018.
54 Higher Concentrations of Folic Acid Cause Oxidative Stress, Acute Cytotoxicity, and Long-Term Fibrogenic Changes in Kidney Epithelial Cells. Chem Res Toxicol. 2022 Nov 21;35(11):2168-2179. doi: 10.1021/acs.chemrestox.2c00258. Epub 2022 Nov 10.
55 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
56 The anthelmintic drug niclosamide induces GSK--mediated -catenin degradation to potentiate gemcitabine activity, reduce immune evasion ability and suppress pancreatic cancer progression. Cell Death Dis. 2022 Feb 3;13(2):112. doi: 10.1038/s41419-022-04573-7.
57 Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
58 Association of cell cycle arrest with anticancer drug-induced epithelial-mesenchymal transition in alveolar epithelial cells. Toxicology. 2019 Aug 1;424:152231. doi: 10.1016/j.tox.2019.06.002. Epub 2019 Jun 4.
59 Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
60 Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
61 Proteomics analysis of the proliferative effect of low-dose ouabain on human endothelial cells. Biol Pharm Bull. 2007 Feb;30(2):247-53. doi: 10.1248/bpb.30.247.
62 Aryl hydrocarbon receptor-ligand axis mediates pulmonary fibroblast migration and differentiation through increased arachidonic acid metabolism. Toxicology. 2016 Aug 31;370:116-126.
63 Inhibitory effects of clinical reagents having anti-oxidative activity on transforming growth factor-1-induced expression of -smooth muscle actin in human fetal lung fibroblasts. J Toxicol Sci. 2011;36(6):733-40. doi: 10.2131/jts.36.733.
64 Artesunate alleviates liver fibrosis by regulating ferroptosis signaling pathway. Biomed Pharmacother. 2019 Jan;109:2043-2053. doi: 10.1016/j.biopha.2018.11.030. Epub 2018 Nov 26.
65 Pulmonary fibrosis model using micro-CT analyzable human PSC-derived alveolar organoids containing alveolar macrophage-like cells. Cell Biol Toxicol. 2022 Aug;38(4):557-575. doi: 10.1007/s10565-022-09698-1. Epub 2022 Mar 10.
66 Ketamine-induced bladder fibrosis involves epithelial-to-mesenchymal transition mediated by transforming growth factor-1. Am J Physiol Renal Physiol. 2017 Oct 1;313(4):F961-F972. doi: 10.1152/ajprenal.00686.2016. Epub 2017 Mar 22.
67 Aldosterone induces epithelial-mesenchymal transition via ROS of mitochondrial origin. Am J Physiol Renal Physiol. 2007 Sep;293(3):F723-31. doi: 10.1152/ajprenal.00480.2006. Epub 2007 Jun 27.
68 Decreasing fibrogenesis: an immunohistochemical study of paired liver biopsies following lamivudine therapy for chronic hepatitis B. J Hepatol. 2001 Dec;35(6):749-55. doi: 10.1016/s0168-8278(01)00218-5.
69 The 2-subtype of adrenoceptors mediates inhibition of pro-fibrotic events in human lung fibroblasts. Naunyn Schmiedebergs Arch Pharmacol. 2011 Aug;384(2):133-45. doi: 10.1007/s00210-011-0655-5. Epub 2011 May 21.
70 Targeting the myofibroblast genetic switch: inhibitors of myocardin-related transcription factor/serum response factor-regulated gene transcription prevent fibrosis in a murine model of skin injury. J Pharmacol Exp Ther. 2014 Jun;349(3):480-6. doi: 10.1124/jpet.114.213520. Epub 2014 Apr 4.
71 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
72 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
73 Resveratrol inhibits fibrogenesis and induces apoptosis in keloid fibroblasts. Wound Repair Regen. 2013 Jul-Aug;21(4):616-23. doi: 10.1111/wrr.12062.
74 Natural product andrographolide alleviated APAP-induced liver fibrosis by activating Nrf2 antioxidant pathway. Toxicology. 2018 Mar 1;396-397:1-12.
75 Verbascoside inhibits the epithelial-mesenchymal transition of prostate cancer cells through high-mobility group box 1/receptor for advanced glycation end-products/TGF- pathway. Environ Toxicol. 2021 Jun;36(6):1080-1089. doi: 10.1002/tox.23107. Epub 2021 Feb 1.
76 Quantitative proteomics and transcriptomics addressing the estrogen receptor subtype-mediated effects in T47D breast cancer cells exposed to the phytoestrogen genistein. Mol Cell Proteomics. 2011 Jan;10(1):M110.002170.
77 Amiodarone induces cell proliferation and myofibroblast differentiation via ERK1/2 and p38 MAPK signaling in fibroblasts. Biomed Pharmacother. 2019 Jul;115:108889. doi: 10.1016/j.biopha.2019.108889. Epub 2019 May 6.
78 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
79 Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
80 Baicalein represses TGF-1-induced fibroblast differentiation through the inhibition of miR-21. Toxicol Appl Pharmacol. 2018 Nov 1;358:35-42. doi: 10.1016/j.taap.2018.09.007. Epub 2018 Sep 7.
81 Intraprostatic androgens and androgen-regulated gene expression persist after testosterone suppression: therapeutic implications for castration-resistant prostate cancer. Cancer Res. 2007 May 15;67(10):5033-41.
82 -Mangostin alleviates liver fibrosis through Sirtuin 3-superoxide-high mobility group box 1 signaling axis. Toxicol Appl Pharmacol. 2019 Jan 15;363:142-153. doi: 10.1016/j.taap.2018.11.011. Epub 2018 Nov 29.
83 Alternation of extracellular matrix remodeling and apoptosis by activation of the aryl hydrocarbon receptor pathway in human periodontal ligament cells. J Cell Biochem. 2012 Oct;113(10):3093-103. doi: 10.1002/jcb.24186.
84 BRD4 is a novel therapeutic target for liver fibrosis. Proc Natl Acad Sci U S A. 2015 Dec 22;112(51):15713-8. doi: 10.1073/pnas.1522163112. Epub 2015 Dec 7.
85 Arecoline induces epithelial mesenchymal transition in HK2 cells by upregulating the ERK-mediated signaling pathway. Environ Toxicol. 2020 Sep;35(9):1007-1014. doi: 10.1002/tox.22937. Epub 2020 May 22.
86 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
87 Nrf2 knockdown attenuates the ameliorative effects of ligustrazine on hepatic fibrosis by targeting hepatic stellate cell transdifferentiation. Toxicology. 2016 Jul 15;365:35-47. doi: 10.1016/j.tox.2016.07.018. Epub 2016 Jul 28.
88 Chemical stresses fail to mimic the unfolded protein response resulting from luminal load with unfolded polypeptides. J Biol Chem. 2018 Apr 13;293(15):5600-5612.
89 Epigenetic siRNA and chemical screens identify SETD8 inhibition as a therapeutic strategy for p53 activation in high-risk neuroblastoma. Cancer Cell. 2017 Jan 9;31(1):50-63.
90 Synergistic action of the nephrotoxic mycotoxins ochratoxin A and citrinin at nanomolar concentrations in human proximal tubule-derived cells. Toxicol Lett. 2018 Jul;291:149-157. doi: 10.1016/j.toxlet.2018.04.014. Epub 2018 Apr 17.
91 Treatment with Cannabinoids as a Promising Approach for Impairing Fibroblast Activation and Prostate Cancer Progression. Int J Mol Sci. 2020 Jan 25;21(3):787. doi: 10.3390/ijms21030787.
92 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
93 Long noncoding RNA HOTAIR functions as ceRNA to regulate MMP2 in paraquat induced lung epithelial-mesenchymal transition. Toxicology. 2021 Sep;461:152891. doi: 10.1016/j.tox.2021.152891. Epub 2021 Aug 6.
94 Reversal of Sp1 transactivation and TGF1/SMAD1 signaling by H(2)S prevent nickel-induced fibroblast activation. Toxicol Appl Pharmacol. 2018 Oct 1;356:25-35. doi: 10.1016/j.taap.2018.07.029. Epub 2018 Jul 26.
95 Aberrant Wnt/Beta-Catenin Pathway Activation in Dialysate-Induced Peritoneal Fibrosis. Front Pharmacol. 2017 Oct 30;8:774. doi: 10.3389/fphar.2017.00774. eCollection 2017.
96 Sorafenib reduces steatosis-induced fibrogenesis in a human 3D co-culture model of non-alcoholic fatty liver disease. Environ Toxicol. 2021 Feb;36(2):168-176. doi: 10.1002/tox.23021. Epub 2020 Sep 12.
97 Long-term acetaminophen treatment induced liver fibrosis in mice and the involvement of Egr-1. Toxicology. 2017 May 1;382:47-58. doi: 10.1016/j.tox.2017.03.008. Epub 2017 Mar 9.
98 The 14-3-3/GSK-3/-catenin complex regulates EndMT induced by 27-hydroxycholesterol in HUVECs and promotes the migration of breast cancer cells. Cell Biol Toxicol. 2021 Aug;37(4):515-529. doi: 10.1007/s10565-020-09564-y. Epub 2020 Nov 1.
99 Functional and mechanistic investigation of Shikonin in scarring. Chem Biol Interact. 2015 Feb 25;228:18-27. doi: 10.1016/j.cbi.2014.12.037. Epub 2015 Jan 12.
100 20-Hydroxytetraenoic acid induces hepatic fibrosis via the TGF-1/Smad3 signaling pathway. Toxicol Lett. 2023 Jan 15;373:1-12. doi: 10.1016/j.toxlet.2022.11.001. Epub 2022 Nov 9.
101 In vitro and ex vivo anti-fibrotic effects of LY2109761, a small molecule inhibitor against TGF-. Toxicol Appl Pharmacol. 2018 Sep 15;355:127-137. doi: 10.1016/j.taap.2018.07.001. Epub 2018 Jul 3.
102 Reactive carbonyl compounds impair wound healing by vimentin collapse and loss of the primary cilium. Food Chem Toxicol. 2017 Oct;108(Pt A):128-138. doi: 10.1016/j.fct.2017.07.055. Epub 2017 Jul 29.
103 Identification of potential protein targets of isothiocyanates by proteomics. Chem Res Toxicol. 2011 Oct 17;24(10):1735-43. doi: 10.1021/tx2002806. Epub 2011 Aug 26.