Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEDLG8E)

• DOT Name: Actin, aortic smooth muscle (ACTA2)
• Synonyms: EC 3.6.4.-; Alpha-actin-2; Cell growth-inhibiting gene 46 protein
• Gene Name: ACTA2
• Related Disease:
  Familial thoracic aortic aneurysm and aortic dissection
  Multisystemic smooth muscle dysfunction syndrome
  Abdominal aortic aneurysm
  Aortic aneurysm
  Aortic aneurysm, familial thoracic 6
  Aortic disorder
  Arterial disorder
  Atrial septal defect
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Cardiomyopathy
  Cerebrovascular disease
  Colon cancer
  Colonic neoplasm
  Coronary atherosclerosis
  Coronary heart disease
  Dilated cardiomyopathy 1A
  Endometriosis
  Hypertrophic cardiomyopathy
  Liver cirrhosis
  Moyamoya disease
  Moyamoya disease 5
  Myocardial infarction
  Nasopharyngeal carcinoma
  Nephropathy
  Patent ductus arteriosus
  Stroke
  Systemic sclerosis
  Vascular disease
  Advanced cancer
  Connective tissue disorder
  Pulmonary fibrosis
  Small lymphocytic lymphoma
  Ankylosing spondylitis
  Crohn disease
  Fetal growth restriction
  Focal segmental glomerulosclerosis
  Ischemia
  Lung cancer
  Lung carcinoma
  Psoriasis
  Sclerosing cholangitis
  Ulcerative colitis
• UniProt ID: ACTA_HUMAN
• EC Number: 3.6.4.-
• Pfam ID: PF00022
• Sequence:
  MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
  QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK
  MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL
  DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK
  SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
  LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS
  KQEYDEAGPSIVHRKCF
• Function: Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.
• KEGG Pathway:
  Vascular smooth muscle contraction (hsa04270)
  Apelin sig.ling pathway (hsa04371)
  Motor proteins (hsa04814)
  Relaxin sig.ling pathway (hsa04926)
• Reactome Pathway:
  NOTCH4 Intracellular Domain Regulates Transcription (R-HSA-9013695)
  Smooth Muscle Contraction (R-HSA-445355)

Molecular Interaction Atlas (MIA) of This DOT

44 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Familial thoracic aortic aneurysm and aortic dissection	DIS069FB	Definitive	Autosomal dominant	[1]
Multisystemic smooth muscle dysfunction syndrome	DISV2K69	Definitive	Autosomal dominant	[2]
Abdominal aortic aneurysm	DISD06OF	Strong	Altered Expression	[3]
Aortic aneurysm	DISQ5KRA	Strong	Genetic Variation	[4]
Aortic aneurysm, familial thoracic 6	DISNTSXF	Strong	Autosomal dominant	[5]
Aortic disorder	DISKXISV	Strong	Genetic Variation	[6]
Arterial disorder	DISLG4XS	Strong	Biomarker	[7]
Atrial septal defect	DISJT76B	Strong	Genetic Variation	[8]
Breast cancer	DIS7DPX1	Strong	Biomarker	[9]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[9]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[9]
Cardiomyopathy	DISUPZRG	Strong	Genetic Variation	[10]
Cerebrovascular disease	DISAB237	Strong	Biomarker	[11]
Colon cancer	DISVC52G	Strong	Biomarker	[12]
Colonic neoplasm	DISSZ04P	Strong	Biomarker	[12]
Coronary atherosclerosis	DISKNDYU	Strong	Genetic Variation	[13]
Coronary heart disease	DIS5OIP1	Strong	Genetic Variation	[13]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Genetic Variation	[14]
Endometriosis	DISX1AG8	Strong	Altered Expression	[15]
Hypertrophic cardiomyopathy	DISQG2AI	Strong	Genetic Variation	[16]
Liver cirrhosis	DIS4G1GX	Strong	Biomarker	[17]
Moyamoya disease	DISO62CA	Strong	Genetic Variation	[18]
Moyamoya disease 5	DISKH1VI	Strong	Autosomal dominant	[19]
Myocardial infarction	DIS655KI	Strong	Genetic Variation	[20]
Nasopharyngeal carcinoma	DISAOTQ0	Strong	Genetic Variation	[21]
Nephropathy	DISXWP4P	Strong	Biomarker	[22]
Patent ductus arteriosus	DIS9P8YS	Strong	Genetic Variation	[2]
Stroke	DISX6UHX	Strong	Genetic Variation	[13]
Systemic sclerosis	DISF44L6	Strong	Biomarker	[23]
Vascular disease	DISVS67S	Strong	Biomarker	[24]
Advanced cancer	DISAT1Z9	moderate	Altered Expression	[25]
Connective tissue disorder	DISKXBS3	Moderate	Autosomal dominant	[26]
Pulmonary fibrosis	DISQKVLA	moderate	Biomarker	[27]
Small lymphocytic lymphoma	DIS30POX	Disputed	Genetic Variation	[28]
Ankylosing spondylitis	DISRC6IR	Limited	Genetic Variation	[29]
Crohn disease	DIS2C5Q8	Limited	Genetic Variation	[29]
Fetal growth restriction	DIS5WEJ5	Limited	Biomarker	[30]
Focal segmental glomerulosclerosis	DISJNHH0	Limited	Biomarker	[31]
Ischemia	DIS5XOOY	Limited	Biomarker	[32]
Lung cancer	DISCM4YA	Limited	Genetic Variation	[33]
Lung carcinoma	DISTR26C	Limited	Genetic Variation	[33]
Psoriasis	DIS59VMN	Limited	Genetic Variation	[29]
Sclerosing cholangitis	DIS7GZNB	Limited	Genetic Variation	[29]
Ulcerative colitis	DIS8K27O	Limited	Genetic Variation	[29]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Sulforaphane	DMQY3L0	Investigative	Actin, aortic smooth muscle (ACTA2) affects the binding of Sulforaphane.	[103]

81 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Actin, aortic smooth muscle (ACTA2).	[34]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Actin, aortic smooth muscle (ACTA2).	[35]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Actin, aortic smooth muscle (ACTA2).	[36]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Actin, aortic smooth muscle (ACTA2).	[37]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Actin, aortic smooth muscle (ACTA2).	[38]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Actin, aortic smooth muscle (ACTA2).	[39]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Actin, aortic smooth muscle (ACTA2).	[40]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Actin, aortic smooth muscle (ACTA2).	[41]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Actin, aortic smooth muscle (ACTA2).	[42]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Actin, aortic smooth muscle (ACTA2).	[43]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Actin, aortic smooth muscle (ACTA2).	[44]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Actin, aortic smooth muscle (ACTA2).	[45]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Actin, aortic smooth muscle (ACTA2).	[44]
Triclosan	DMZUR4N	Approved	Triclosan affects the expression of Actin, aortic smooth muscle (ACTA2).	[46]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Actin, aortic smooth muscle (ACTA2).	[47]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Actin, aortic smooth muscle (ACTA2).	[48]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Actin, aortic smooth muscle (ACTA2).	[49]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Actin, aortic smooth muscle (ACTA2).	[50]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Actin, aortic smooth muscle (ACTA2).	[51]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Actin, aortic smooth muscle (ACTA2).	[52]
Panobinostat	DM58WKG	Approved	Panobinostat decreases the expression of Actin, aortic smooth muscle (ACTA2).	[53]
Folic acid	DMEMBJC	Approved	Folic acid increases the expression of Actin, aortic smooth muscle (ACTA2).	[54]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Actin, aortic smooth muscle (ACTA2).	[55]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Actin, aortic smooth muscle (ACTA2).	[56]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol decreases the expression of Actin, aortic smooth muscle (ACTA2).	[57]
Paclitaxel	DMLB81S	Approved	Paclitaxel increases the expression of Actin, aortic smooth muscle (ACTA2).	[58]
Dasatinib	DMJV2EK	Approved	Dasatinib increases the expression of Actin, aortic smooth muscle (ACTA2).	[59]
Lucanthone	DMZLBUO	Approved	Lucanthone increases the expression of Actin, aortic smooth muscle (ACTA2).	[60]
Acocantherin	DM7JT24	Approved	Acocantherin affects the expression of Actin, aortic smooth muscle (ACTA2).	[61]
Sodium phenylbutyrate	DMXLBCQ	Approved	Sodium phenylbutyrate increases the expression of Actin, aortic smooth muscle (ACTA2).	[53]
Dinoprostone	DMTYOPD	Approved	Dinoprostone increases the expression of Actin, aortic smooth muscle (ACTA2).	[62]
Lovastatin	DM9OZWQ	Approved	Lovastatin decreases the expression of Actin, aortic smooth muscle (ACTA2).	[63]
Artesunate	DMR27C8	Approved	Artesunate decreases the expression of Actin, aortic smooth muscle (ACTA2).	[64]
Bleomycin	DMNER5S	Approved	Bleomycin increases the expression of Actin, aortic smooth muscle (ACTA2).	[65]
Ketamine	DMT5HA4	Approved	Ketamine increases the expression of Actin, aortic smooth muscle (ACTA2).	[66]
Aldosterone	DM9S2JW	Approved	Aldosterone increases the expression of Actin, aortic smooth muscle (ACTA2).	[67]
Lamivudine	DMI347A	Approved	Lamivudine decreases the expression of Actin, aortic smooth muscle (ACTA2).	[68]
Arformoterol	DMYM974	Approved	Arformoterol decreases the expression of Actin, aortic smooth muscle (ACTA2).	[69]
Pirfenidone	DM6VZFQ	Approved	Pirfenidone decreases the expression of Actin, aortic smooth muscle (ACTA2).	[23]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Actin, aortic smooth muscle (ACTA2).	[71]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Actin, aortic smooth muscle (ACTA2).	[72]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Actin, aortic smooth muscle (ACTA2).	[73]
HMPL-004	DM29XGY	Phase 3	HMPL-004 decreases the expression of Actin, aortic smooth muscle (ACTA2).	[74]
Glycyrrhizin	DM8M2N3	Phase 3	Glycyrrhizin decreases the expression of Actin, aortic smooth muscle (ACTA2).	[75]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Actin, aortic smooth muscle (ACTA2).	[76]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Actin, aortic smooth muscle (ACTA2).	[77]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Actin, aortic smooth muscle (ACTA2).	[78]
PEITC	DMOMN31	Phase 2	PEITC increases the expression of Actin, aortic smooth muscle (ACTA2).	[79]
BAICALEIN	DM4C7E6	Phase 2	BAICALEIN decreases the expression of Actin, aortic smooth muscle (ACTA2).	[80]
ACYLINE	DM9GRTK	Phase 2	ACYLINE decreases the expression of Actin, aortic smooth muscle (ACTA2).	[81]
MK-2206	DMT1OZ6	Phase 2	MK-2206 decreases the expression of Actin, aortic smooth muscle (ACTA2).	[82]
LTB4	DME26RS	Phase 2	LTB4 increases the expression of Actin, aortic smooth muscle (ACTA2).	[62]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Actin, aortic smooth muscle (ACTA2).	[83]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Actin, aortic smooth muscle (ACTA2).	[84]
Arecoline	DMFJZK3	Phase 1	Arecoline increases the expression of Actin, aortic smooth muscle (ACTA2).	[85]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Actin, aortic smooth muscle (ACTA2).	[86]
Tetramethylpyrazine	DMC0WNB	Discontinued in Phase 2	Tetramethylpyrazine decreases the expression of Actin, aortic smooth muscle (ACTA2).	[87]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Actin, aortic smooth muscle (ACTA2).	[88]
UNC0379	DMD1E4J	Preclinical	UNC0379 increases the expression of Actin, aortic smooth muscle (ACTA2).	[89]
SB 203580	DMAET6F	Terminated	SB 203580 decreases the expression of Actin, aortic smooth muscle (ACTA2).	[90]
Acteoside	DM0YHKB	Terminated	Acteoside decreases the expression of Actin, aortic smooth muscle (ACTA2).	[75]
WIN-55212-2	DMACBIW	Terminated	WIN-55212-2 decreases the expression of Actin, aortic smooth muscle (ACTA2).	[91]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Actin, aortic smooth muscle (ACTA2).	[72]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Actin, aortic smooth muscle (ACTA2).	[55]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of Actin, aortic smooth muscle (ACTA2).	[90]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Actin, aortic smooth muscle (ACTA2).	[93]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Actin, aortic smooth muscle (ACTA2).	[94]
D-glucose	DMMG2TO	Investigative	D-glucose increases the expression of Actin, aortic smooth muscle (ACTA2).	[95]
Forskolin	DM6ITNG	Investigative	Forskolin decreases the expression of Actin, aortic smooth muscle (ACTA2).	[69]
U0126	DM31OGF	Investigative	U0126 decreases the expression of Actin, aortic smooth muscle (ACTA2).	[90]
Oleic acid	DM54O1Z	Investigative	Oleic acid increases the expression of Actin, aortic smooth muscle (ACTA2).	[96]
NAPQI	DM8F5LR	Investigative	NAPQI increases the expression of Actin, aortic smooth muscle (ACTA2).	[97]
27-hydroxycholesterol	DM2L6OZ	Investigative	27-hydroxycholesterol increases the expression of Actin, aortic smooth muscle (ACTA2).	[98]
I-BET151	DMYRUH2	Investigative	I-BET151 decreases the expression of Actin, aortic smooth muscle (ACTA2).	[84]
Isoarnebin 4	DM0B7NO	Investigative	Isoarnebin 4 decreases the expression of Actin, aortic smooth muscle (ACTA2).	[99]
PFI-1	DMVFK3J	Investigative	PFI-1 decreases the expression of Actin, aortic smooth muscle (ACTA2).	[84]
MANGOSTIN	DMYQGDV	Investigative	MANGOSTIN decreases the expression of Actin, aortic smooth muscle (ACTA2).	[82]
20-HETE	DM5BAJ9	Investigative	20-HETE increases the expression of Actin, aortic smooth muscle (ACTA2).	[100]
Deoxythymidine	DMR90HY	Investigative	Deoxythymidine increases the expression of Actin, aortic smooth muscle (ACTA2).	[58]
LY2109761	DMAWTG3	Investigative	LY2109761 increases the expression of Actin, aortic smooth muscle (ACTA2).	[101]
J-009747	DMQSB6N	Investigative	J-009747 increases the expression of Actin, aortic smooth muscle (ACTA2).	[102]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Actin, aortic smooth muscle (ACTA2).	[92]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Clinical history and management recommendations of the smooth muscle dysfunction syndrome due to ACTA2 arginine 179 alterations. Genet Med. 2018 Oct;20(10):1206-1215. doi: 10.1038/gim.2017.245. Epub 2018 Jan 4.
• [3] Identification of key microRNAs and genes associated with abdominal aortic aneurysm based on the gene expression profile.Exp Physiol. 2020 Jan;105(1):160-173. doi: 10.1113/EP087705. Epub 2019 Dec 16.
• [4] Novel variants in the ACTA2 and MYH11 genes in a Cypriot family with thoracic aortic aneurysms: a case report.BMC Med Genet. 2018 Dec 7;19(1):208. doi: 10.1186/s12881-018-0728-0.
• [5] Clinical Remission of Delta-Aminolevulinic Acid Dehydratase Deficiency Through Suppression of Erythroid Heme Synthesis. Hepatology. 2019 Jul;70(1):434-436. doi: 10.1002/hep.30543. Epub 2019 Jun 6.
• [6] Altered Smooth Muscle Cell Force Generation as a Driver of Thoracic Aortic Aneurysms and Dissections.Arterioscler Thromb Vasc Biol. 2017 Jan;37(1):26-34. doi: 10.1161/ATVBAHA.116.303229. Epub 2016 Nov 22.
• [7] Recent developments and new frontiers in childhood arterial ischemic stroke.Int J Stroke. 2019 Jan;14(1):32-43. doi: 10.1177/1747493018790064. Epub 2018 Aug 6.
• [8] Congenital heart defects are rarely caused by mutations in cardiac and smooth muscle actin genes.Biomed Res Int. 2015;2015:127807. doi: 10.1155/2015/127807. Epub 2015 Mar 10.
• [9] Combined deletion of Pten and p53 in mammary epithelium accelerates triple-negative breast cancer with dependency on eEF2K.EMBO Mol Med. 2014 Dec;6(12):1542-60. doi: 10.15252/emmm.201404402.
• [10] A Novel Alpha Cardiac Actin (ACTC1) Mutation Mapping to a Domain in Close Contact with Myosin Heavy Chain Leads to a Variety of Congenital Heart Defects, Arrhythmia and Possibly Midline Defects.PLoS One. 2015 Jun 10;10(6):e0127903. doi: 10.1371/journal.pone.0127903. eCollection 2015.
• [11] ACTA2 Cerebral Arteriopathy: Not Just a Puff of Smoke.Cerebrovasc Dis. 2018;46(3-4):161-171. doi: 10.1159/000493863. Epub 2018 Oct 9.
• [12] Global gene expression analysis of rat colon cancers induced by a food-borne carcinogen, 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine.Carcinogenesis. 2004 Aug;25(8):1495-505. doi: 10.1093/carcin/bgh155. Epub 2004 Apr 1.
• [13] ACTA2 mutation and postpartum hemorrhage: a case report.BMC Med Genet. 2017 Dec 4;18(1):143. doi: 10.1186/s12881-017-0505-5.
• [14] Actin mutations in hypertrophic and dilated cardiomyopathy cause inefficient protein folding and perturbed filament formation.FEBS J. 2005 Apr;272(8):2037-49. doi: 10.1111/j.1742-4658.2005.04630.x.
• [15] The estrogen-regulated lncRNA H19/miR-216a-5p axis alters stromal cell invasion and migration via ACTA2 in endometriosis.Mol Hum Reprod. 2019 Sep 1;25(9):550-561. doi: 10.1093/molehr/gaz040.
• [16] Functional characterization of the human -cardiac actin mutations Y166C and M305L involved in hypertrophic cardiomyopathy.Cell Mol Life Sci. 2012 Oct;69(20):3457-79. doi: 10.1007/s00018-012-1030-5. Epub 2012 May 29.
• [17] MicroRNA-942 mediates hepatic stellate cell activation by regulating BAMBI expression in human liver fibrosis.Arch Toxicol. 2018 Sep;92(9):2935-2946. doi: 10.1007/s00204-018-2278-9. Epub 2018 Aug 10.
• [18] "Twig-like" cerebral vessels are not pathognomonic for ACTA A2 mutations: A case report.Interv Neuroradiol. 2018 Aug;24(4):463-468. doi: 10.1177/1591019918765239. Epub 2018 Mar 28.
• [19] Expanding ACTA2 genotypes with corresponding phenotypes overlapping with smooth muscle dysfunction syndrome. Am J Med Genet A. 2022 Aug;188(8):2389-2396. doi: 10.1002/ajmg.a.62775. Epub 2022 May 14.
• [20] Acute aortic dissections with pregnancy in women with ACTA2 mutations.Am J Med Genet A. 2014 Jan;164A(1):106-12. doi: 10.1002/ajmg.a.36208. Epub 2013 Nov 15.
• [21] A genome-wide association study of nasopharyngeal carcinoma identifies three new susceptibility loci.Nat Genet. 2010 Jul;42(7):599-603. doi: 10.1038/ng.601. Epub 2010 May 30.
• [22] Wen-pi-tang-Hab-Wu-ling-san reduces ureteral obstructive renal fibrosis by the reduction of oxidative stress, inflammation, and TGF-beta/Smad2/3 signaling.Food Chem Toxicol. 2010 Feb;48(2):522-9. doi: 10.1016/j.fct.2009.11.006. Epub 2009 Nov 11.
• [23] Targeting the myofibroblast genetic switch: inhibitors of myocardin-related transcription factor/serum response factor-regulated gene transcription prevent fibrosis in a murine model of skin injury. J Pharmacol Exp Ther. 2014 Jun;349(3):480-6. doi: 10.1124/jpet.114.213520. Epub 2014 Apr 4.
• [24] European reference network for rare vascular diseases (VASCERN) consensus statement for the screening and management of patients with pathogenic ACTA2 variants.Orphanet J Rare Dis. 2019 Nov 21;14(1):264. doi: 10.1186/s13023-019-1186-2.
• [25] A Novel Allosteric Inhibitor of Phosphoglycerate Mutase 1 Suppresses Growth and Metastasis of Non-Small-Cell Lung Cancer.Cell Metab. 2019 Dec 3;30(6):1107-1119.e8. doi: 10.1016/j.cmet.2019.09.014. Epub 2019 Oct 10.
• [26] The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
• [27] TMEM100 mediates inflammatory cytokines secretion in hepatic stellate cells and its mechanism research.Toxicol Lett. 2019 Dec 15;317:82-91. doi: 10.1016/j.toxlet.2018.12.010. Epub 2019 Jan 11.
• [28] A genome-wide association study identifies multiple susceptibility loci for chronic lymphocytic leukemia.Nat Genet. 2014 Jan;46(1):56-60. doi: 10.1038/ng.2843. Epub 2013 Dec 1.
• [29] Analysis of five chronic inflammatory diseases identifies 27 new associations and highlights disease-specific patterns at shared loci.Nat Genet. 2016 May;48(5):510-8. doi: 10.1038/ng.3528. Epub 2016 Mar 14.
• [30] Placental Stem Villus Arterial Remodeling Associated with Reduced Hydrogen Sulfide Synthesis Contributes to Human Fetal Growth Restriction.Am J Pathol. 2017 Apr;187(4):908-920. doi: 10.1016/j.ajpath.2016.12.002. Epub 2017 Feb 1.
• [31] Beneficial effect of all-trans retinoic acid (ATRA) on glomerulosclerosis rats via the down-regulation of the expression of alpha-smooth muscle actin: a comparative study between ATRA and benazepril.Exp Mol Pathol. 2010 Aug;89(1):51-7. doi: 10.1016/j.yexmp.2010.05.003. Epub 2010 May 21.
• [32] Reactive oxygen species/oxidative stress contributes to progression of kidney fibrosis following transient ischemic injury in mice.Am J Physiol Renal Physiol. 2009 Aug;297(2):F461-70. doi: 10.1152/ajprenal.90735.2008. Epub 2009 May 20.
• [33] Deciphering the impact of common genetic variation on lung cancer risk: a genome-wide association study.Cancer Res. 2009 Aug 15;69(16):6633-41. doi: 10.1158/0008-5472.CAN-09-0680. Epub 2009 Aug 4.
• [34] Effects of lithium and valproic acid on gene expression and phenotypic markers in an NT2 neurosphere model of neural development. PLoS One. 2013;8(3):e58822.
• [35] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [36] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [37] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [38] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [39] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [40] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [41] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [42] Quercetin suppresses pancreatic ductal adenocarcinoma progression via inhibition of SHH and TGF-/Smad signaling pathways. Cell Biol Toxicol. 2021 Jun;37(3):479-496. doi: 10.1007/s10565-020-09562-0. Epub 2020 Oct 17.
• [43] Arsenic trioxide inhibits the differentiation of fibroblasts to myofibroblasts through nuclear factor erythroid 2-like 2 (NFE2L2) protein and the Smad2/3 pathway. J Cell Physiol. 2019 Mar;234(3):2606-2617. doi: 10.1002/jcp.27073. Epub 2018 Oct 14.
• [44] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [45] Proteomic analysis revealed association of aberrant ROS signaling with suberoylanilide hydroxamic acid-induced autophagy in Jurkat T-leukemia cells. Autophagy. 2010 Aug;6(6):711-24. doi: 10.4161/auto.6.6.12397. Epub 2010 Aug 17.
• [46] Primary Human Hepatocyte Spheroids as Tools to Study the Hepatotoxic Potential of Non-Pharmaceutical Chemicals. Int J Mol Sci. 2021 Oct 12;22(20):11005. doi: 10.3390/ijms222011005.
• [47] Editor's Highlight: Modeling Compound-Induced Fibrogenesis In Vitro Using Three-Dimensional Bioprinted Human Liver Tissues. Toxicol Sci. 2016 Dec;154(2):354-367. doi: 10.1093/toxsci/kfw169. Epub 2016 Sep 7.
• [48] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [49] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [50] Zoledronate dysregulates fatty acid metabolism in renal tubular epithelial cells to induce nephrotoxicity. Arch Toxicol. 2018 Jan;92(1):469-485.
• [51] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [52] Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
• [53] Comparison of the antifibrotic effects of the pan-histone deacetylase-inhibitor panobinostat versus the IPF-drug pirfenidone in fibroblasts from patients with idiopathic pulmonary fibrosis. PLoS One. 2018 Nov 27;13(11):e0207915. doi: 10.1371/journal.pone.0207915. eCollection 2018.
• [54] Higher Concentrations of Folic Acid Cause Oxidative Stress, Acute Cytotoxicity, and Long-Term Fibrogenic Changes in Kidney Epithelial Cells. Chem Res Toxicol. 2022 Nov 21;35(11):2168-2179. doi: 10.1021/acs.chemrestox.2c00258. Epub 2022 Nov 10.
• [55] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [56] The anthelmintic drug niclosamide induces GSK--mediated -catenin degradation to potentiate gemcitabine activity, reduce immune evasion ability and suppress pancreatic cancer progression. Cell Death Dis. 2022 Feb 3;13(2):112. doi: 10.1038/s41419-022-04573-7.
• [57] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [58] Association of cell cycle arrest with anticancer drug-induced epithelial-mesenchymal transition in alveolar epithelial cells. Toxicology. 2019 Aug 1;424:152231. doi: 10.1016/j.tox.2019.06.002. Epub 2019 Jun 4.
• [59] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [60] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [61] Proteomics analysis of the proliferative effect of low-dose ouabain on human endothelial cells. Biol Pharm Bull. 2007 Feb;30(2):247-53. doi: 10.1248/bpb.30.247.
• [62] Aryl hydrocarbon receptor-ligand axis mediates pulmonary fibroblast migration and differentiation through increased arachidonic acid metabolism. Toxicology. 2016 Aug 31;370:116-126.
• [63] Inhibitory effects of clinical reagents having anti-oxidative activity on transforming growth factor-1-induced expression of -smooth muscle actin in human fetal lung fibroblasts. J Toxicol Sci. 2011;36(6):733-40. doi: 10.2131/jts.36.733.
• [64] Artesunate alleviates liver fibrosis by regulating ferroptosis signaling pathway. Biomed Pharmacother. 2019 Jan;109:2043-2053. doi: 10.1016/j.biopha.2018.11.030. Epub 2018 Nov 26.
• [65] Pulmonary fibrosis model using micro-CT analyzable human PSC-derived alveolar organoids containing alveolar macrophage-like cells. Cell Biol Toxicol. 2022 Aug;38(4):557-575. doi: 10.1007/s10565-022-09698-1. Epub 2022 Mar 10.
• [66] Ketamine-induced bladder fibrosis involves epithelial-to-mesenchymal transition mediated by transforming growth factor-1. Am J Physiol Renal Physiol. 2017 Oct 1;313(4):F961-F972. doi: 10.1152/ajprenal.00686.2016. Epub 2017 Mar 22.
• [67] Aldosterone induces epithelial-mesenchymal transition via ROS of mitochondrial origin. Am J Physiol Renal Physiol. 2007 Sep;293(3):F723-31. doi: 10.1152/ajprenal.00480.2006. Epub 2007 Jun 27.
• [68] Decreasing fibrogenesis: an immunohistochemical study of paired liver biopsies following lamivudine therapy for chronic hepatitis B. J Hepatol. 2001 Dec;35(6):749-55. doi: 10.1016/s0168-8278(01)00218-5.
• [69] The 2-subtype of adrenoceptors mediates inhibition of pro-fibrotic events in human lung fibroblasts. Naunyn Schmiedebergs Arch Pharmacol. 2011 Aug;384(2):133-45. doi: 10.1007/s00210-011-0655-5. Epub 2011 May 21.
• [70] Targeting the myofibroblast genetic switch: inhibitors of myocardin-related transcription factor/serum response factor-regulated gene transcription prevent fibrosis in a murine model of skin injury. J Pharmacol Exp Ther. 2014 Jun;349(3):480-6. doi: 10.1124/jpet.114.213520. Epub 2014 Apr 4.
• [71] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [72] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [73] Resveratrol inhibits fibrogenesis and induces apoptosis in keloid fibroblasts. Wound Repair Regen. 2013 Jul-Aug;21(4):616-23. doi: 10.1111/wrr.12062.
• [74] Natural product andrographolide alleviated APAP-induced liver fibrosis by activating Nrf2 antioxidant pathway. Toxicology. 2018 Mar 1;396-397:1-12.
• [75] Verbascoside inhibits the epithelial-mesenchymal transition of prostate cancer cells through high-mobility group box 1/receptor for advanced glycation end-products/TGF- pathway. Environ Toxicol. 2021 Jun;36(6):1080-1089. doi: 10.1002/tox.23107. Epub 2021 Feb 1.
• [76] Quantitative proteomics and transcriptomics addressing the estrogen receptor subtype-mediated effects in T47D breast cancer cells exposed to the phytoestrogen genistein. Mol Cell Proteomics. 2011 Jan;10(1):M110.002170.
• [77] Amiodarone induces cell proliferation and myofibroblast differentiation via ERK1/2 and p38 MAPK signaling in fibroblasts. Biomed Pharmacother. 2019 Jul;115:108889. doi: 10.1016/j.biopha.2019.108889. Epub 2019 May 6.
• [78] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [79] Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
• [80] Baicalein represses TGF-1-induced fibroblast differentiation through the inhibition of miR-21. Toxicol Appl Pharmacol. 2018 Nov 1;358:35-42. doi: 10.1016/j.taap.2018.09.007. Epub 2018 Sep 7.
• [81] Intraprostatic androgens and androgen-regulated gene expression persist after testosterone suppression: therapeutic implications for castration-resistant prostate cancer. Cancer Res. 2007 May 15;67(10):5033-41.
• [82] -Mangostin alleviates liver fibrosis through Sirtuin 3-superoxide-high mobility group box 1 signaling axis. Toxicol Appl Pharmacol. 2019 Jan 15;363:142-153. doi: 10.1016/j.taap.2018.11.011. Epub 2018 Nov 29.
• [83] Alternation of extracellular matrix remodeling and apoptosis by activation of the aryl hydrocarbon receptor pathway in human periodontal ligament cells. J Cell Biochem. 2012 Oct;113(10):3093-103. doi: 10.1002/jcb.24186.
• [84] BRD4 is a novel therapeutic target for liver fibrosis. Proc Natl Acad Sci U S A. 2015 Dec 22;112(51):15713-8. doi: 10.1073/pnas.1522163112. Epub 2015 Dec 7.
• [85] Arecoline induces epithelial mesenchymal transition in HK2 cells by upregulating the ERK-mediated signaling pathway. Environ Toxicol. 2020 Sep;35(9):1007-1014. doi: 10.1002/tox.22937. Epub 2020 May 22.
• [86] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [87] Nrf2 knockdown attenuates the ameliorative effects of ligustrazine on hepatic fibrosis by targeting hepatic stellate cell transdifferentiation. Toxicology. 2016 Jul 15;365:35-47. doi: 10.1016/j.tox.2016.07.018. Epub 2016 Jul 28.
• [88] Chemical stresses fail to mimic the unfolded protein response resulting from luminal load with unfolded polypeptides. J Biol Chem. 2018 Apr 13;293(15):5600-5612.
• [89] Epigenetic siRNA and chemical screens identify SETD8 inhibition as a therapeutic strategy for p53 activation in high-risk neuroblastoma. Cancer Cell. 2017 Jan 9;31(1):50-63.
• [90] Synergistic action of the nephrotoxic mycotoxins ochratoxin A and citrinin at nanomolar concentrations in human proximal tubule-derived cells. Toxicol Lett. 2018 Jul;291:149-157. doi: 10.1016/j.toxlet.2018.04.014. Epub 2018 Apr 17.
• [91] Treatment with Cannabinoids as a Promising Approach for Impairing Fibroblast Activation and Prostate Cancer Progression. Int J Mol Sci. 2020 Jan 25;21(3):787. doi: 10.3390/ijms21030787.
• [92] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [93] Long noncoding RNA HOTAIR functions as ceRNA to regulate MMP2 in paraquat induced lung epithelial-mesenchymal transition. Toxicology. 2021 Sep;461:152891. doi: 10.1016/j.tox.2021.152891. Epub 2021 Aug 6.
• [94] Reversal of Sp1 transactivation and TGF1/SMAD1 signaling by H(2)S prevent nickel-induced fibroblast activation. Toxicol Appl Pharmacol. 2018 Oct 1;356:25-35. doi: 10.1016/j.taap.2018.07.029. Epub 2018 Jul 26.
• [95] Aberrant Wnt/Beta-Catenin Pathway Activation in Dialysate-Induced Peritoneal Fibrosis. Front Pharmacol. 2017 Oct 30;8:774. doi: 10.3389/fphar.2017.00774. eCollection 2017.
• [96] Sorafenib reduces steatosis-induced fibrogenesis in a human 3D co-culture model of non-alcoholic fatty liver disease. Environ Toxicol. 2021 Feb;36(2):168-176. doi: 10.1002/tox.23021. Epub 2020 Sep 12.
• [97] Long-term acetaminophen treatment induced liver fibrosis in mice and the involvement of Egr-1. Toxicology. 2017 May 1;382:47-58. doi: 10.1016/j.tox.2017.03.008. Epub 2017 Mar 9.
• [98] The 14-3-3/GSK-3/-catenin complex regulates EndMT induced by 27-hydroxycholesterol in HUVECs and promotes the migration of breast cancer cells. Cell Biol Toxicol. 2021 Aug;37(4):515-529. doi: 10.1007/s10565-020-09564-y. Epub 2020 Nov 1.
• [99] Functional and mechanistic investigation of Shikonin in scarring. Chem Biol Interact. 2015 Feb 25;228:18-27. doi: 10.1016/j.cbi.2014.12.037. Epub 2015 Jan 12.
• [100] 20-Hydroxytetraenoic acid induces hepatic fibrosis via the TGF-1/Smad3 signaling pathway. Toxicol Lett. 2023 Jan 15;373:1-12. doi: 10.1016/j.toxlet.2022.11.001. Epub 2022 Nov 9.
• [101] In vitro and ex vivo anti-fibrotic effects of LY2109761, a small molecule inhibitor against TGF-. Toxicol Appl Pharmacol. 2018 Sep 15;355:127-137. doi: 10.1016/j.taap.2018.07.001. Epub 2018 Jul 3.
• [102] Reactive carbonyl compounds impair wound healing by vimentin collapse and loss of the primary cilium. Food Chem Toxicol. 2017 Oct;108(Pt A):128-138. doi: 10.1016/j.fct.2017.07.055. Epub 2017 Jul 29.
• [103] Identification of potential protein targets of isothiocyanates by proteomics. Chem Res Toxicol. 2011 Oct 17;24(10):1735-43. doi: 10.1021/tx2002806. Epub 2011 Aug 26.