Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNKACJD)

• DOT Name: Transcription factor JunD (JUND)
• Synonyms: Transcription factor AP-1 subunit JunD
• Gene Name: JUND
• Related Disease:
  Acute myelogenous leukaemia
  Adult glioblastoma
  Adult T-cell leukemia/lymphoma
  Advanced cancer
  Amyotrophic lateral sclerosis type 1
  Asthma
  Atopic dermatitis
  Bone osteosarcoma
  Breast cancer
  Breast carcinoma
  Carcinoma
  Cervical cancer
  Cervical carcinoma
  Colorectal carcinoma
  Familial amyotrophic lateral sclerosis
  Liver cirrhosis
  Lung neoplasm
  Lymphoma
  Neoplasm
  Osteoarthritis
  Osteosarcoma
  Pneumonia
  Pneumonitis
  Prostate carcinoma
  Renal carcinoma
  Rheumatoid arthritis
  Status epilepticus seizure
  Systemic lupus erythematosus
  Type-1/2 diabetes
  Anaplastic large cell lymphoma
  Colon cancer
  Colon carcinoma
  Glioblastoma multiforme
  Glomerulonephritis
  Head-neck squamous cell carcinoma
  Lung carcinoma
  Lung cancer
  Plasma cell myeloma
  Breast neoplasm
  Cocaine addiction
  Hepatitis C virus infection
  Melanoma
  Neuroblastoma
  Pancreatic cancer
  Prostate cancer
• UniProt ID: JUND_HUMAN
• PDB ID: 3U86; 5VPA; 5VPB; 5VPC; 5VPD; 5VPE; 5VPF; 7UCC; 7UCD
• Pfam ID: PF00170 ; PF03957
• Sequence:
  METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAA
  ALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTS
  SQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPG
  ELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALK
  DEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKV
  KTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY
• Function: Transcription factor binding AP-1 sites. Heterodimerizes with proteins of the FOS family to form an AP-1 transcription factor complex, thereby enhancing their DNA binding activity to an AP-1 consensus sequence 3'-TGA[GC]TCA-5' and enhancing their transcriptional activity.
• KEGG Pathway:
  MAPK sig.ling pathway (hsa04010)
  Osteoclast differentiation (hsa04380)
  IL-17 sig.ling pathway (hsa04657)
  Parathyroid hormone synthesis, secretion and action (hsa04928)
• Reactome Pathway:
  NGF-stimulated transcription (R-HSA-9031628)
  Estrogen-dependent gene expression (R-HSA-9018519)

Molecular Interaction Atlas (MIA) of This DOT

45 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute myelogenous leukaemia	DISCSPTN	Strong	Altered Expression	[1]
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[2]
Adult T-cell leukemia/lymphoma	DIS882XU	Strong	Biomarker	[3]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[4]
Amyotrophic lateral sclerosis type 1	DIS5A2M0	Strong	Biomarker	[5]
Asthma	DISW9QNS	Strong	Biomarker	[6]
Atopic dermatitis	DISTCP41	Strong	Altered Expression	[7]
Bone osteosarcoma	DIST1004	Strong	Altered Expression	[8]
Breast cancer	DIS7DPX1	Strong	Biomarker	[9]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[9]
Carcinoma	DISH9F1N	Strong	Biomarker	[10]
Cervical cancer	DISFSHPF	Strong	Biomarker	[11]
Cervical carcinoma	DIST4S00	Strong	Altered Expression	[11]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[12]
Familial amyotrophic lateral sclerosis	DISWZ9CJ	Strong	Biomarker	[5]
Liver cirrhosis	DIS4G1GX	Strong	Biomarker	[13]
Lung neoplasm	DISVARNB	Strong	Biomarker	[14]
Lymphoma	DISN6V4S	Strong	Altered Expression	[15]
Neoplasm	DISZKGEW	Strong	Altered Expression	[16]
Osteoarthritis	DIS05URM	Strong	Altered Expression	[17]
Osteosarcoma	DISLQ7E2	Strong	Altered Expression	[8]
Pneumonia	DIS8EF3M	Strong	Biomarker	[18]
Pneumonitis	DIS88E0K	Strong	Biomarker	[18]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[19]
Renal carcinoma	DISER9XT	Strong	Biomarker	[20]
Rheumatoid arthritis	DISTSB4J	Strong	Biomarker	[21]
Status epilepticus seizure	DISY3BIC	Strong	Biomarker	[22]
Systemic lupus erythematosus	DISI1SZ7	Strong	Altered Expression	[23]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[24]
Anaplastic large cell lymphoma	DISP4D1R	moderate	Altered Expression	[15]
Colon cancer	DISVC52G	moderate	Biomarker	[25]
Colon carcinoma	DISJYKUO	moderate	Biomarker	[25]
Glioblastoma multiforme	DISK8246	moderate	Altered Expression	[26]
Glomerulonephritis	DISPZIQ3	moderate	Biomarker	[27]
Head-neck squamous cell carcinoma	DISF7P24	moderate	Genetic Variation	[28]
Lung carcinoma	DISTR26C	moderate	Biomarker	[29]
Lung cancer	DISCM4YA	Disputed	Biomarker	[14]
Plasma cell myeloma	DIS0DFZ0	Disputed	Biomarker	[30]
Breast neoplasm	DISNGJLM	Limited	Biomarker	[31]
Cocaine addiction	DISHTRXG	Limited	Therapeutic	[32]
Hepatitis C virus infection	DISQ0M8R	Limited	Altered Expression	[33]
Melanoma	DIS1RRCY	Limited	Altered Expression	[34]
Neuroblastoma	DISVZBI4	Limited	Biomarker	[35]
Pancreatic cancer	DISJC981	Limited	Biomarker	[36]
Prostate cancer	DISF190Y	Limited	Altered Expression	[19]

5 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Transcription factor JunD (JUND).	[37]
TAK-243	DM4GKV2	Phase 1	TAK-243 decreases the sumoylation of Transcription factor JunD (JUND).	[72]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Transcription factor JunD (JUND).	[73]
Coumarin	DM0N8ZM	Investigative	Coumarin affects the phosphorylation of Transcription factor JunD (JUND).	[73]
2-tert-butylbenzene-1,4-diol	DMNXI1E	Investigative	2-tert-butylbenzene-1,4-diol increases the phosphorylation of Transcription factor JunD (JUND).	[84]

50 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Transcription factor JunD (JUND).	[38]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Transcription factor JunD (JUND).	[39]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Transcription factor JunD (JUND).	[40]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Transcription factor JunD (JUND).	[41]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Transcription factor JunD (JUND).	[42]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of Transcription factor JunD (JUND).	[43]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Transcription factor JunD (JUND).	[44]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Transcription factor JunD (JUND).	[45]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Transcription factor JunD (JUND).	[46]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Transcription factor JunD (JUND).	[47]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Transcription factor JunD (JUND).	[48]
Marinol	DM70IK5	Approved	Marinol increases the expression of Transcription factor JunD (JUND).	[49]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Transcription factor JunD (JUND).	[50]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of Transcription factor JunD (JUND).	[51]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Transcription factor JunD (JUND).	[52]
Diclofenac	DMPIHLS	Approved	Diclofenac increases the expression of Transcription factor JunD (JUND).	[53]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Transcription factor JunD (JUND).	[54]
Menthol	DMG2KW7	Approved	Menthol increases the expression of Transcription factor JunD (JUND).	[55]
Cocaine	DMSOX7I	Approved	Cocaine decreases the expression of Transcription factor JunD (JUND).	[56]
Sulindac	DM2QHZU	Approved	Sulindac increases the expression of Transcription factor JunD (JUND).	[57]
Acetic Acid, Glacial	DM4SJ5Y	Approved	Acetic Acid, Glacial increases the expression of Transcription factor JunD (JUND).	[58]
Motexafin gadolinium	DMEJKRF	Approved	Motexafin gadolinium increases the expression of Transcription factor JunD (JUND).	[58]
Sertraline	DM0FB1J	Approved	Sertraline increases the expression of Transcription factor JunD (JUND).	[59]
Nefazodone	DM4ZS8M	Approved	Nefazodone increases the expression of Transcription factor JunD (JUND).	[60]
Ampicillin	DMHWE7P	Approved	Ampicillin increases the expression of Transcription factor JunD (JUND).	[44]
Romidepsin	DMT5GNL	Approved	Romidepsin increases the expression of Transcription factor JunD (JUND).	[61]
Pomalidomide	DMTGBAX	Approved	Pomalidomide decreases the expression of Transcription factor JunD (JUND).	[62]
Amphetamine	DMSZQAK	Approved	Amphetamine decreases the expression of Transcription factor JunD (JUND).	[56]
Mechlorethamine	DM0CVXA	Approved	Mechlorethamine increases the expression of Transcription factor JunD (JUND).	[63]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Transcription factor JunD (JUND).	[64]
Isoflavone	DM7U58J	Phase 4	Isoflavone increases the expression of Transcription factor JunD (JUND).	[65]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Transcription factor JunD (JUND).	[66]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol decreases the expression of Transcription factor JunD (JUND).	[67]
Rigosertib	DMOSTXF	Phase 3	Rigosertib increases the expression of Transcription factor JunD (JUND).	[68]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Transcription factor JunD (JUND).	[69]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Transcription factor JunD (JUND).	[38]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Transcription factor JunD (JUND).	[70]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Transcription factor JunD (JUND).	[71]
Flavonoid derivative 1	DMCQP0B	Patented	Flavonoid derivative 1 decreases the activity of Transcription factor JunD (JUND).	[74]
T83193	DMHO29Y	Patented	T83193 decreases the expression of Transcription factor JunD (JUND).	[75]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Transcription factor JunD (JUND).	[76]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Transcription factor JunD (JUND).	[77]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Transcription factor JunD (JUND).	[78]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Transcription factor JunD (JUND).	[79]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Transcription factor JunD (JUND).	[80]
Glyphosate	DM0AFY7	Investigative	Glyphosate increases the expression of Transcription factor JunD (JUND).	[81]
geraniol	DMS3CBD	Investigative	geraniol increases the expression of Transcription factor JunD (JUND).	[82]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of Transcription factor JunD (JUND).	[83]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal decreases the expression of Transcription factor JunD (JUND).	[46]
cinnamaldehyde	DMZDUXG	Investigative	cinnamaldehyde decreases the expression of Transcription factor JunD (JUND).	[75]

References

• [1] HDAC inhibition by SNDX-275 (Entinostat) restores expression of silenced leukemia-associated transcription factors Nur77 and Nor1 and of key pro-apoptotic proteins in AML.Leukemia. 2013 Jun;27(6):1358-68. doi: 10.1038/leu.2012.366. Epub 2012 Dec 18.
• [2] Epidermal growth factor receptor and PTEN modulate tissue factor expression in glioblastoma through JunD/activator protein-1 transcriptional activity.Cancer Res. 2009 Mar 15;69(6):2540-9. doi: 10.1158/0008-5472.CAN-08-1547. Epub 2009 Mar 10.
• [3] Anti-adult Tcell leukemia/lymphoma activity of cerdulatinib, a dual SYK/JAK kinase inhibitor.Int J Oncol. 2018 Oct;53(4):1681-1690. doi: 10.3892/ijo.2018.4513. Epub 2018 Aug 1.
• [4] Interplay of transcription factors STAT3, STAT1 and AP-1 mediates activity of the matrix metallo-proteinase-1 promoter in colorectal carcinoma cells.Neoplasma. 2019 May 23;66(3):357-366. doi: 10.4149/neo_2018_180731N560. Epub 2018 Dec 12.
• [5] Differential expression of inflammation- and apoptosis-related genes in spinal cords of a mutant SOD1 transgenic mouse model of familial amyotrophic lateral sclerosis.J Neurochem. 2002 Jan;80(1):158-67. doi: 10.1046/j.0022-3042.2001.00683.x.
• [6] Differential estrogen-receptor activation regulates extracellular matrix deposition in human airway smooth muscle remodeling via NF-B pathway.FASEB J. 2019 Dec;33(12):13935-13950. doi: 10.1096/fj.201901340R. Epub 2019 Oct 22.
• [7] The potential role of impaired Notch signalling in atopic dermatitis.Acta Derm Venereol. 2015 Jan;95(1):5-11. doi: 10.2340/00015555-1898.
• [8] Role of Activator Protein-1 Complex on the Phenotype of Human Osteosarcomas Generated from Mesenchymal Stem Cells.Stem Cells. 2018 Oct;36(10):1487-1500. doi: 10.1002/stem.2869. Epub 2018 Aug 11.
• [9] Cis-guggulsterone inhibits the IKK/NF-B pathway, whereas trans-guggulsterone inhibits MAPK/AP-1 in MCF? breast cancer cells: guggulsterone regulates MMP? expression in an isomer-specific manner.Int J Mol Med. 2013 Feb;31(2):393-9. doi: 10.3892/ijmm.2012.1214. Epub 2012 Dec 14.
• [10] AP-1 Expression and its Clinical Relevance in Immune Disorders and Cancer.Am J Med Sci. 2017 May;353(5):474-483. doi: 10.1016/j.amjms.2017.01.019. Epub 2017 Feb 1.
• [11] Anticancer activity of Phyllanthus emblica Linn. (Indian gooseberry): inhibition of transcription factor AP-1 and HPV gene expression in cervical cancer cells.Nutr Cancer. 2013;65 Suppl 1:88-97. doi: 10.1080/01635581.2013.785008.
• [12] CRMP5-associated GTPase (CRAG) Is a Candidate Driver Gene for Colorectal Cancer Carcinogenesis.Anticancer Res. 2019 Jan;39(1):99-106. doi: 10.21873/anticanres.13084.
• [13] JunD is a profibrogenic transcription factor regulated by Jun N-terminal kinase-independent phosphorylation.Hepatology. 2006 Dec;44(6):1432-40. doi: 10.1002/hep.21436.
• [14] Bronchial airway gene expression signatures in mouse lung squamous cell carcinoma and their modulation by cancer chemopreventive agents.Oncotarget. 2017 Mar 21;8(12):18885-18900. doi: 10.18632/oncotarget.13806.
• [15] The Role of Activator Protein-1 (AP-1) Family Members in CD30-Positive Lymphomas.Cancers (Basel). 2018 Mar 28;10(4):93. doi: 10.3390/cancers10040093.
• [16] Expression of activator protein-1 in papillary thyroid carcinoma and its clinical significance.World J Surg Oncol. 2019 Jan 31;17(1):25. doi: 10.1186/s12957-019-1568-x.
• [17] Regulation of type II collagen, matrix metalloproteinase-13 and cell proliferation by interleukin-1 is mediated by curcumin via inhibition of NF-B signaling in rat chondrocytes.Mol Med Rep. 2017 Aug;16(2):1837-1845. doi: 10.3892/mmr.2017.6771. Epub 2017 Jun 14.
• [18] Ambroxol alleviates ventilator-induced lung injury by inhibiting c-Jun expression.Eur Rev Med Pharmacol Sci. 2019 Jun;23(11):5004-5011. doi: 10.26355/eurrev_201906_18092.
• [19] Suppressor of activator protein-1 regulated by interferon expression in prostate cancer tissues and cells.Life Sci. 2019 Sep 1;232:116626. doi: 10.1016/j.lfs.2019.116626. Epub 2019 Jul 2.
• [20] Overexpression of members of the AP-1 transcriptional factor family from an early stage of renal carcinogenesis and inhibition of cell growth by AP-1 gene antisense oligonucleotides in the Tsc2 gene mutant (Eker) rat model.Biochem Biophys Res Commun. 1997 Dec 8;241(1):24-30. doi: 10.1006/bbrc.1997.7731.
• [21] DDR2-CYR61-MMP1 Signaling Pathway Promotes Bone Erosion in Rheumatoid Arthritis Through Regulating Migration and Invasion of Fibroblast-Like Synoviocytes.J Bone Miner Res. 2017 Feb;32(2):407-418. doi: 10.1002/jbmr.2993. Epub 2016 Nov 3.
• [22] Distinctive rat brain immediate early gene responses to seizures induced by lithium plus pilocarpine.Brain Res Mol Brain Res. 1994 Aug;25(1-2):80-9. doi: 10.1016/0169-328x(94)90281-x.
• [23] A novel intronic cAMP response element modulator (CREM) promoter is regulated by activator protein-1 (AP-1) and accounts for altered activation-induced CREM expression in T cells from patients with systemic lupus erythematosus.J Biol Chem. 2011 Sep 16;286(37):32366-72. doi: 10.1074/jbc.M111.245811. Epub 2011 Jul 13.
• [24] JUND regulates pancreatic cell survival during metabolic stress.Mol Metab. 2019 Jul;25:95-106. doi: 10.1016/j.molmet.2019.04.007. Epub 2019 Apr 11.
• [25] MALAT1-miR663a negative feedback loop in colon cancer cell functions through direct miRNA-lncRNA binding.Cell Death Dis. 2018 Aug 28;9(9):857. doi: 10.1038/s41419-018-0925-y.
• [26] Epidermal growth factor receptor-mediated regulation of urokinase plasminogen activator expression and glioblastoma invasion via C-SRC/MAPK/AP-1 signaling pathways.J Neuropathol Exp Neurol. 2010 Jun;69(6):582-92. doi: 10.1097/NEN.0b013e3181e008fe.
• [27] Jund is a determinant of macrophage activation and is associated with glomerulonephritis susceptibility.Nat Genet. 2008 May;40(5):553-9. doi: 10.1038/ng.137.
• [28] Association between a functional polymorphism (-1195T>C) in the IGFBP5 promoter and head and neck cancer risk.Head Neck. 2011 May;33(5):650-60. doi: 10.1002/hed.21514. Epub 2010 Oct 14.
• [29] Interleukin-7 up-regulates cyclin D1 via activator protein-1 to promote proliferation of cell in lung cancer.Cancer Immunol Immunother. 2012 Jan;61(1):79-88. doi: 10.1007/s00262-011-1078-3. Epub 2011 Aug 17.
• [30] Formononetin Regulates Multiple Oncogenic Signaling Cascades and Enhances Sensitivity to Bortezomib in a Multiple Myeloma Mouse Model.Biomolecules. 2019 Jul 7;9(7):262. doi: 10.3390/biom9070262.
• [31] Progesterone receptor assembly of a transcriptional complex along with activator protein 1, signal transducer and activator of transcription 3 and ErbB-2 governs breast cancer growth and predicts response to endocrine therapy.Breast Cancer Res. 2013 Dec 17;15(6):R118. doi: 10.1186/bcr3587.
• [32] DeltaFosB induction in orbitofrontal cortex mediates tolerance to cocaine-induced cognitive dysfunction.J Neurosci. 2007 Sep 26;27(39):10497-507. doi: 10.1523/JNEUROSCI.2566-07.2007.
• [33] Hepatitis C virus core protein potentiates proangiogenic activity of hepatocellular carcinoma cells.Oncotarget. 2017 Sep 30;8(49):86681-86692. doi: 10.18632/oncotarget.21407. eCollection 2017 Oct 17.
• [34] Apoptosis protease activator protein-1 expression is dispensable for response of human melanoma cells to distinct proapoptotic agents.Cancer Res. 2004 Oct 15;64(20):7386-94. doi: 10.1158/0008-5472.CAN-04-1640.
• [35] Downregulation of Type 3 Deiodinase in the Hypothalamus During Inflammation.Thyroid. 2019 Sep;29(9):1336-1343. doi: 10.1089/thy.2019.0201. Epub 2019 Aug 15.
• [36] The effect of JDP2 and ATF2 on the epithelial-mesenchymal transition of human pancreatic cancer cell lines.Pathol Oncol Res. 2012 Jul;18(3):571-7. doi: 10.1007/s12253-011-9476-6. Epub 2011 Nov 23.
• [37] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [38] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [39] Effect of all-trans retinoic acid on sodium/iodide symporter expression, radioiodine uptake and gene expression profiles in a human anaplastic thyroid carcinoma cell line. Nucl Med Biol. 2006 Oct;33(7):875-82. doi: 10.1016/j.nucmedbio.2006.07.004.
• [40] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [41] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [42] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [43] Estradiol and selective estrogen receptor modulators differentially regulate target genes with estrogen receptors alpha and beta. Mol Biol Cell. 2004 Mar;15(3):1262-72. doi: 10.1091/mbc.e03-06-0360. Epub 2003 Dec 29.
• [44] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [45] Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
• [46] Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
• [47] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [48] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [49] JunD is involved in the antiproliferative effect of Delta9-tetrahydrocannabinol on human breast cancer cells. Oncogene. 2008 Aug 28;27(37):5033-44.
• [50] Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
• [51] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [52] DNA array analysis of the effects of aspirin on colon cancer cells: involvement of Rac1. Carcinogenesis. 2004 Jul;25(7):1293-8.
• [53] Species-specific toxicity of diclofenac and troglitazone in primary human and rat hepatocytes. Chem Biol Interact. 2009 Apr 15;179(1):17-24.
• [54] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [55] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [56] Effect of acute and chronic psychostimulant drugs on redox status, AP-1 activation and pro-enkephalin mRNA in the human astrocyte-like U373 MG cells. Neuropharmacology. 2005 Apr;48(5):673-84. doi: 10.1016/j.neuropharm.2004.12.010.
• [57] Expression profile analysis of colon cancer cells in response to sulindac or aspirin. Biochem Biophys Res Commun. 2002 Mar 29;292(2):498-512.
• [58] Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
• [59] Sertraline induces endoplasmic reticulum stress in hepatic cells. Toxicology. 2014 Aug 1;322:78-88. doi: 10.1016/j.tox.2014.05.007. Epub 2014 May 24.
• [60] Robustness testing and optimization of an adverse outcome pathway on cholestatic liver injury. Arch Toxicol. 2020 Apr;94(4):1151-1172. doi: 10.1007/s00204-020-02691-9. Epub 2020 Mar 10.
• [61] 5-Aza-2'-deoxycytidine and depsipeptide synergistically induce expression of BIK (BCL2-interacting killer). Biochem Biophys Res Commun. 2006 Dec 15;351(2):455-61. doi: 10.1016/j.bbrc.2006.10.055. Epub 2006 Oct 18.
• [62] Immunomodulatory derivative of thalidomide (IMiD CC-4047) induces a shift in lineage commitment by suppressing erythropoiesis and promoting myelopoiesis. Blood. 2005 May 15;105(10):3833-40. doi: 10.1182/blood-2004-03-0828. Epub 2004 Aug 3.
• [63] Nitrogen mustard prevents transport of Fra-1 into the nucleus to promote c-Fos- and FosB-dependent IL-8 induction in injured mouse epidermis. Toxicol Lett. 2020 Feb 1;319:256-263. doi: 10.1016/j.toxlet.2019.10.006. Epub 2019 Oct 19.
• [64] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [65] Soy isoflavones exert differential effects on androgen responsive genes in LNCaP human prostate cancer cells. J Nutr. 2007 Apr;137(4):964-72.
• [66] Resveratrol-induced gene expression profiles in human prostate cancer cells. Cancer Epidemiol Biomarkers Prev. 2005 Mar;14(3):596-604. doi: 10.1158/1055-9965.EPI-04-0398.
• [67] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [68] ON 01910.Na is selectively cytotoxic for chronic lymphocytic leukemia cells through a dual mechanism of action involving PI3K/AKT inhibition and induction of oxidative stress. Clin Cancer Res. 2012 Apr 1;18(7):1979-91. doi: 10.1158/1078-0432.CCR-11-2113. Epub 2012 Feb 20.
• [69] Curcumin suppresses AP1 transcription factor-dependent differentiation and activates apoptosis in human epidermal keratinocytes. J Biol Chem. 2007 Mar 2;282(9):6707-15. doi: 10.1074/jbc.M606003200. Epub 2006 Dec 5.
• [70] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [71] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [72] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [73] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [74] Luteolin, a flavonoid, inhibits AP-1 activation by basophils. Biochem Biophys Res Commun. 2006 Feb 3;340(1):1-7. doi: 10.1016/j.bbrc.2005.11.157. Epub 2005 Dec 6.
• [75] Antimutagenicity of cinnamaldehyde and vanillin in human cells: Global gene expression and possible role of DNA damage and repair. Mutat Res. 2007 Mar 1;616(1-2):60-9. doi: 10.1016/j.mrfmmm.2006.11.022. Epub 2006 Dec 18.
• [76] Chemical stresses fail to mimic the unfolded protein response resulting from luminal load with unfolded polypeptides. J Biol Chem. 2018 Apr 13;293(15):5600-5612.
• [77] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
• [78] Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
• [79] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [80] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [81] Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
• [82] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
• [83] Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
• [84] Regulation of human CYP2C9 expression by electrophilic stress involves activator protein 1 activation and DNA looping. Mol Pharmacol. 2014 Aug;86(2):125-37.