Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT63ERYM)

• DOT Name: Bcl2-associated agonist of cell death (BAD)
• Synonyms: BAD; Bcl-2-binding component 6; Bcl-2-like protein 8; Bcl2-L-8; Bcl-xL/Bcl-2-associated death promoter; Bcl2 antagonist of cell death
• Gene Name: BAD
• Related Disease:
  Acute kidney injury
  Acute myelogenous leukaemia
  Diabetic neuropathy
  Prostate neoplasm
  Adult glioblastoma
  Advanced cancer
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Carcinoma
  Colon cancer
  Colonic neoplasm
  Colorectal carcinoma
  Epilepsy
  Erectile dysfunction
  Glaucoma/ocular hypertension
  Glioblastoma multiforme
  Hepatocellular carcinoma
  Hypothyroidism
  Intermittent claudication
  Leukemia
  Malignant glioma
  Neoplasm
  Non-insulin dependent diabetes
  Non-small-cell lung cancer
  Obesity
  Ovarian neoplasm
  Parkinsonian disorder
  Prostate carcinoma
  Pulmonary fibrosis
  Squamous cell carcinoma
  Chronic pancreatitis
  Epithelial ovarian cancer
  Gastric ulcer
  Glioma
  Neuroblastoma
  Ovarian cancer
  Pancreatic cancer
  Triple negative breast cancer
  High blood pressure
  Lung cancer
  Lung carcinoma
  Adenocarcinoma
  Melanoma
  Prostate cancer
  Type-1/2 diabetes
• UniProt ID: BAD_HUMAN
• PDB ID: 1G5J; 7Q16
• Pfam ID: PF10514
• Sequence:
  MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
  HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
  FVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ
• Function: Promotes cell death. Successfully competes for the binding to Bcl-X(L), Bcl-2 and Bcl-W, thereby affecting the level of heterodimerization of these proteins with BAX. Can reverse the death repressor activity of Bcl-X(L), but not that of Bcl-2. Appears to act as a link between growth factor receptor signaling and the apoptotic pathways.
• Tissue Specificity: Expressed in a wide variety of tissues.
• KEGG Pathway:
  EGFR tyrosine ki.se inhibitor resistance (hsa01521)
  Endocrine resistance (hsa01522)
  Platinum drug resistance (hsa01524)
  ErbB sig.ling pathway (hsa04012)
  Ras sig.ling pathway (hsa04014)
  cGMP-PKG sig.ling pathway (hsa04022)
  cAMP sig.ling pathway (hsa04024)
  Chemokine sig.ling pathway (hsa04062)
  Autophagy - animal (hsa04140)
  PI3K-Akt sig.ling pathway (hsa04151)
  Apoptosis (hsa04210)
  VEGF sig.ling pathway (hsa04370)
  Focal adhesion (hsa04510)
  Neurotrophin sig.ling pathway (hsa04722)
  Insulin sig.ling pathway (hsa04910)
  Thyroid hormone sig.ling pathway (hsa04919)
  Alzheimer disease (hsa05010)
  Amyotrophic lateral sclerosis (hsa05014)
  Prion disease (hsa05020)
  Pathways of neurodegeneration - multiple diseases (hsa05022)
  Toxoplasmosis (hsa05145)
  Tuberculosis (hsa05152)
  Hepatitis C (hsa05160)
  Hepatitis B (hsa05161)
  Measles (hsa05162)
  Human papillomavirus infection (hsa05165)
  Herpes simplex virus 1 infection (hsa05168)
  Human immunodeficiency virus 1 infection (hsa05170)
  Pathways in cancer (hsa05200)
  Viral carcinogenesis (hsa05203)
  Chemical carcinogenesis - receptor activation (hsa05207)
  Chemical carcinogenesis - reactive oxygen species (hsa05208)
  Colorectal cancer (hsa05210)
  Re.l cell carcinoma (hsa05211)
  Pancreatic cancer (hsa05212)
  Endometrial cancer (hsa05213)
  Prostate cancer (hsa05215)
  Melanoma (hsa05218)
  Chronic myeloid leukemia (hsa05220)
  Acute myeloid leukemia (hsa05221)
  Non-small cell lung cancer (hsa05223)
  Hepatocellular carcinoma (hsa05225)
  Lipid and atherosclerosis (hsa05417)
• Reactome Pathway:
  BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members (R-HSA-111453)
  NRAGE signals death through JNK (R-HSA-193648)
  AKT phosphorylates targets in the cytosol (R-HSA-198323)
  Constitutive Signaling by AKT1 E17K in Cancer (R-HSA-5674400)
  Activation of BAD and translocation to mitochondria (R-HSA-111447)

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute kidney injury	DISXZG0T	Definitive	Therapeutic	[1]
Acute myelogenous leukaemia	DISCSPTN	Definitive	Biomarker	[2]
Diabetic neuropathy	DISX6VF8	Definitive	Therapeutic	[3]
Prostate neoplasm	DISHDKGQ	Definitive	Biomarker	[4]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[5]
Advanced cancer	DISAT1Z9	Strong	Posttranslational Modification	[6]
Breast cancer	DIS7DPX1	Strong	Posttranslational Modification	[7]
Breast carcinoma	DIS2UE88	Strong	Posttranslational Modification	[7]
Breast neoplasm	DISNGJLM	Strong	Genetic Variation	[8]
Carcinoma	DISH9F1N	Strong	Altered Expression	[9]
Colon cancer	DISVC52G	Strong	Genetic Variation	[10]
Colonic neoplasm	DISSZ04P	Strong	Biomarker	[11]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[12]
Epilepsy	DISBB28L	Strong	Genetic Variation	[13]
Erectile dysfunction	DISD8MTH	Strong	Therapeutic	[14]
Glaucoma/ocular hypertension	DISLBXBY	Strong	Biomarker	[15]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[5]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[16]
Hypothyroidism	DISR0H6D	Strong	Biomarker	[17]
Intermittent claudication	DISGY3B0	Strong	Biomarker	[18]
Leukemia	DISNAKFL	Strong	Biomarker	[19]
Malignant glioma	DISFXKOV	Strong	Biomarker	[20]
Neoplasm	DISZKGEW	Strong	Altered Expression	[21]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[22]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Posttranslational Modification	[23]
Obesity	DIS47Y1K	Strong	Genetic Variation	[24]
Ovarian neoplasm	DISEAFTY	Strong	Posttranslational Modification	[25]
Parkinsonian disorder	DISHGY45	Strong	Biomarker	[26]
Prostate carcinoma	DISMJPLE	Strong	Posttranslational Modification	[27]
Pulmonary fibrosis	DISQKVLA	Strong	Biomarker	[28]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[29]
Chronic pancreatitis	DISBUOMJ	moderate	ModifyingMutation	[30]
Epithelial ovarian cancer	DIS56MH2	moderate	Posttranslational Modification	[25]
Gastric ulcer	DISBBGVO	moderate	Therapeutic	[31]
Glioma	DIS5RPEH	moderate	Biomarker	[5]
Neuroblastoma	DISVZBI4	moderate	Altered Expression	[32]
Ovarian cancer	DISZJHAP	moderate	Altered Expression	[25]
Pancreatic cancer	DISJC981	moderate	Altered Expression	[33]
Triple negative breast cancer	DISAMG6N	moderate	Biomarker	[34]
High blood pressure	DISY2OHH	Disputed	Therapeutic	[35]
Lung cancer	DISCM4YA	Disputed	Biomarker	[36]
Lung carcinoma	DISTR26C	Disputed	Biomarker	[36]
Adenocarcinoma	DIS3IHTY	Limited	Biomarker	[37]
Melanoma	DIS1RRCY	Limited	Altered Expression	[38]
Prostate cancer	DISF190Y	Limited	Posttranslational Modification	[27]
Type-1/2 diabetes	DISIUHAP	Limited	Altered Expression	[39]

12 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the phosphorylation of Bcl2-associated agonist of cell death (BAD).	[40]
Marinol	DM70IK5	Approved	Marinol decreases the phosphorylation of Bcl2-associated agonist of cell death (BAD).	[48]
Simvastatin	DM30SGU	Approved	Simvastatin decreases the phosphorylation of Bcl2-associated agonist of cell death (BAD).	[59]
Docetaxel	DMDI269	Approved	Docetaxel decreases the phosphorylation of Bcl2-associated agonist of cell death (BAD).	[65]
Cholecalciferol	DMGU74E	Approved	Cholecalciferol increases the phosphorylation of Bcl2-associated agonist of cell death (BAD).	[66]
Melatonin	DMKWFBT	Approved	Melatonin increases the phosphorylation of Bcl2-associated agonist of cell death (BAD).	[67]
GDC0941	DM1YAK6	Phase 2	GDC0941 decreases the phosphorylation of Bcl2-associated agonist of cell death (BAD).	[80]
PX-866	DMYISJK	Phase 2	PX-866 decreases the phosphorylation of Bcl2-associated agonist of cell death (BAD).	[83]
LY294002	DMY1AFS	Phase 1	LY294002 decreases the phosphorylation of Bcl2-associated agonist of cell death (BAD).	[19]
Steroid derivative 1	DMB0NVQ	Patented	Steroid derivative 1 decreases the phosphorylation of Bcl2-associated agonist of cell death (BAD).	[90]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid increases the phosphorylation of Bcl2-associated agonist of cell death (BAD).	[101]
Microcystin-LR	DMTMLRN	Investigative	Microcystin-LR increases the phosphorylation of Bcl2-associated agonist of cell death (BAD).	[106]

71 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Bcl2-associated agonist of cell death (BAD).	[41]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Bcl2-associated agonist of cell death (BAD).	[42]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Bcl2-associated agonist of cell death (BAD).	[43]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Bcl2-associated agonist of cell death (BAD).	[44]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Bcl2-associated agonist of cell death (BAD).	[45]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Bcl2-associated agonist of cell death (BAD).	[46]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Bcl2-associated agonist of cell death (BAD).	[47]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Bcl2-associated agonist of cell death (BAD).	[49]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of Bcl2-associated agonist of cell death (BAD).	[50]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Bcl2-associated agonist of cell death (BAD).	[51]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Bcl2-associated agonist of cell death (BAD).	[52]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Bcl2-associated agonist of cell death (BAD).	[53]
Paclitaxel	DMLB81S	Approved	Paclitaxel increases the expression of Bcl2-associated agonist of cell death (BAD).	[54]
Nicotine	DMWX5CO	Approved	Nicotine decreases the expression of Bcl2-associated agonist of cell death (BAD).	[55]
Indomethacin	DMSC4A7	Approved	Indomethacin increases the expression of Bcl2-associated agonist of cell death (BAD).	[56]
Menthol	DMG2KW7	Approved	Menthol increases the expression of Bcl2-associated agonist of cell death (BAD).	[57]
Mitomycin	DMH0ZJE	Approved	Mitomycin increases the expression of Bcl2-associated agonist of cell death (BAD).	[58]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid decreases the expression of Bcl2-associated agonist of cell death (BAD).	[60]
Sulindac	DM2QHZU	Approved	Sulindac decreases the expression of Bcl2-associated agonist of cell death (BAD).	[61]
Capsaicin	DMGMF6V	Approved	Capsaicin increases the expression of Bcl2-associated agonist of cell death (BAD).	[62]
Liothyronine	DM6IR3P	Approved	Liothyronine decreases the expression of Bcl2-associated agonist of cell death (BAD).	[63]
Sorafenib	DMS8IFC	Approved	Sorafenib increases the expression of Bcl2-associated agonist of cell death (BAD).	[64]
Ximelegatran	DMU8ANS	Approved	Ximelegatran decreases the expression of Bcl2-associated agonist of cell death (BAD).	[43]
Phenylephrine	DMZHUO5	Approved	Phenylephrine increases the expression of Bcl2-associated agonist of cell death (BAD).	[68]
Omacetaxine mepesuccinate	DMPU2WX	Approved	Omacetaxine mepesuccinate increases the expression of Bcl2-associated agonist of cell death (BAD).	[69]
Clonidine	DM6RZ9Q	Approved	Clonidine increases the expression of Bcl2-associated agonist of cell death (BAD).	[70]
Thiotepa	DMIZKOP	Approved	Thiotepa increases the expression of Bcl2-associated agonist of cell death (BAD).	[54]
Momelotinib	DMF98Q0	Approved	Momelotinib increases the expression of Bcl2-associated agonist of cell death (BAD).	[71]
Norfloxacin	DMIZ6W2	Approved	Norfloxacin increases the expression of Bcl2-associated agonist of cell death (BAD).	[72]
Aprepitant	DM053KT	Approved	Aprepitant increases the expression of Bcl2-associated agonist of cell death (BAD).	[73]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Bcl2-associated agonist of cell death (BAD).	[74]
Curcumin	DMQPH29	Phase 3	Curcumin increases the expression of Bcl2-associated agonist of cell death (BAD).	[75]
HMPL-004	DM29XGY	Phase 3	HMPL-004 increases the expression of Bcl2-associated agonist of cell death (BAD).	[76]
Glycyrrhizin	DM8M2N3	Phase 3	Glycyrrhizin increases the expression of Bcl2-associated agonist of cell death (BAD).	[77]
Buparlisib	DM1WEHC	Phase 3	Buparlisib increases the expression of Bcl2-associated agonist of cell death (BAD).	[78]
Avastin+/-Tarceva	DMA86FL	Phase 3	Avastin+/-Tarceva increases the expression of Bcl2-associated agonist of cell death (BAD).	[56]
Thymoquinone	DMVDTR2	Phase 2/3	Thymoquinone decreases the expression of Bcl2-associated agonist of cell death (BAD).	[79]
Delphinidin	DMS2WIN	Phase 2	Delphinidin increases the expression of Bcl2-associated agonist of cell death (BAD).	[81]
Duvelisib	DM7USVA	Phase 2 Trial	Duvelisib increases the expression of Bcl2-associated agonist of cell death (BAD).	[82]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Bcl2-associated agonist of cell death (BAD).	[55]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Bcl2-associated agonist of cell death (BAD).	[84]
PF-3758309	DM36PKZ	Phase 1	PF-3758309 increases the expression of Bcl2-associated agonist of cell death (BAD).	[86]
Metastat	DMTQ4PN	Phase 1	Metastat increases the expression of Bcl2-associated agonist of cell death (BAD).	[87]
AT7519	DMCE08M	Phase 1	AT7519 increases the expression of Bcl2-associated agonist of cell death (BAD).	[88]
PX-102	DMWU682	Phase 1	PX-102 increases the expression of Bcl2-associated agonist of cell death (BAD).	[89]
PMID26560530-Compound-8	DMN6TG7	Patented	PMID26560530-Compound-8 decreases the expression of Bcl2-associated agonist of cell death (BAD).	[91]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Bcl2-associated agonist of cell death (BAD).	[92]
Dioscin	DM5H2W9	Preclinical	Dioscin increases the expression of Bcl2-associated agonist of cell death (BAD).	[93]
AG490	DM3WKO5	Terminated	AG490 increases the expression of Bcl2-associated agonist of cell death (BAD).	[94]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Bcl2-associated agonist of cell death (BAD).	[95]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the expression of Bcl2-associated agonist of cell death (BAD).	[96]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Bcl2-associated agonist of cell death (BAD).	[97]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of Bcl2-associated agonist of cell death (BAD).	[98]
Paraquat	DMR8O3X	Investigative	Paraquat decreases the expression of Bcl2-associated agonist of cell death (BAD).	[99]
Glyphosate	DM0AFY7	Investigative	Glyphosate increases the expression of Bcl2-associated agonist of cell death (BAD).	[100]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal decreases the expression of Bcl2-associated agonist of cell death (BAD).	[102]
Okadaic acid	DM47CO1	Investigative	Okadaic acid decreases the expression of Bcl2-associated agonist of cell death (BAD).	[103]
Chlorpyrifos	DMKPUI6	Investigative	Chlorpyrifos increases the expression of Bcl2-associated agonist of cell death (BAD).	[104]
acrolein	DMAMCSR	Investigative	acrolein increases the expression of Bcl2-associated agonist of cell death (BAD).	[105]
U0126	DM31OGF	Investigative	U0126 increases the expression of Bcl2-associated agonist of cell death (BAD).	[107]
Cordycepin	DM72Y01	Investigative	Cordycepin increases the expression of Bcl2-associated agonist of cell death (BAD).	[108]
ELLAGIC ACID	DMX8BS5	Investigative	ELLAGIC ACID increases the expression of Bcl2-associated agonist of cell death (BAD).	[109]
BRN-3548355	DM4KXT0	Investigative	BRN-3548355 decreases the expression of Bcl2-associated agonist of cell death (BAD).	[110]
LICOAGROCHACONE A	DMWY0TN	Investigative	LICOAGROCHACONE A increases the expression of Bcl2-associated agonist of cell death (BAD).	[111]
methylglyoxal	DMRC3OZ	Investigative	methylglyoxal increases the expression of Bcl2-associated agonist of cell death (BAD).	[112]
NORCANTHARIDIN	DM9B6Y1	Investigative	NORCANTHARIDIN increases the expression of Bcl2-associated agonist of cell death (BAD).	[113]
P-Coumaric Acid	DMGJSVD	Investigative	P-Coumaric Acid increases the expression of Bcl2-associated agonist of cell death (BAD).	[114]
L-thyroxine	DM83HWL	Investigative	L-thyroxine decreases the expression of Bcl2-associated agonist of cell death (BAD).	[115]
Methylenedioxymethamphetamine	DMYVU47	Investigative	Methylenedioxymethamphetamine increases the expression of Bcl2-associated agonist of cell death (BAD).	[116]
ANTHRAQUINONE	DM29I0Y	Investigative	ANTHRAQUINONE increases the expression of Bcl2-associated agonist of cell death (BAD).	[117]
eucalyptol	DME5CK3	Investigative	eucalyptol increases the expression of Bcl2-associated agonist of cell death (BAD).	[118]

References

• [1] N-acetylcysteine attenuates glycerol-induced acute kidney injury by regulating MAPKs and Bcl-2 family proteins.Nephrol Dial Transplant. 2010 May;25(5):1435-43. doi: 10.1093/ndt/gfp659. Epub 2009 Dec 27.
• [2] Complementary dynamic BH3 profiles predict co-operativity between the multi-kinase inhibitor TG02 and the BH3 mimetic ABT-199 in acute myeloid leukaemia cells.Oncotarget. 2017 Mar 7;8(10):16220-16232. doi: 10.18632/oncotarget.8742.
• [3] Traditional chinese medicine tang-luo-ning ameliorates sciatic nerve injuries in streptozotocin-induced diabetic rats.Evid Based Complement Alternat Med. 2013;2013:989670. doi: 10.1155/2013/989670. Epub 2013 Oct 28.
• [4] Polyunsaturated fatty acids affect the localization and signaling of PIP3/AKT in prostate cancer cells.Carcinogenesis. 2013 Sep;34(9):1968-75. doi: 10.1093/carcin/bgt147. Epub 2013 Apr 30.
• [5] PKC- promotes glioblastoma cell survival by phosphorylating and inhibiting BAD through a phosphatidylinositol 3-kinase pathway.Biochim Biophys Acta. 2011 Jun;1813(6):1190-7. doi: 10.1016/j.bbamcr.2011.03.007. Epub 2011 Mar 17.
• [6] Temporal DNA methylation pattern and targeted therapy in colitis-associated cancer.Carcinogenesis. 2020 Apr 22;41(2):235-244. doi: 10.1093/carcin/bgz199.
• [7] Histone demethylase KDM7A is required for stem cell maintenance and apoptosis inhibition in breast cancer.J Cell Physiol. 2020 Feb;235(2):932-943. doi: 10.1002/jcp.29008. Epub 2019 Jun 24.
• [8] Activity of distinct growth factor receptor network components in breast tumors uncovers two biologically relevant subtypes.Genome Med. 2017 Apr 26;9(1):40. doi: 10.1186/s13073-017-0429-x.
• [9] Immunohistochemical analysis of phospho-BAD protein and mutational analysis of BAD gene in gastric carcinomas.APMIS. 2007 Aug;115(8):976-81. doi: 10.1111/j.1600-0463.2007.apm_804.x.
• [10] BAD-mediated apoptotic pathway is associated with human cancer development.Int J Mol Med. 2015 Apr;35(4):1081-7. doi: 10.3892/ijmm.2015.2091. Epub 2015 Feb 5.
• [11] Proapoptotic Bad and Bid protein expression predict survival in stages II and III colon cancers.Clin Cancer Res. 2008 Jul 1;14(13):4128-33. doi: 10.1158/1078-0432.CCR-07-5160.
• [12] Pro-apoptotic PUMA and anti-apoptotic phospho-BAD are highly expressed in colorectal carcinomas.Dig Dis Sci. 2007 Oct;52(10):2751-6. doi: 10.1007/s10620-007-9799-z. Epub 2007 Mar 28.
• [13] Branch atheromatous disease has a stronger association with late-onset epileptic seizures than lacunar infarction in Japanese patients.J Int Med Res. 2020 Jan;48(1):300060519831572. doi: 10.1177/0300060519831572. Epub 2019 Mar 6.
• [14] PARP inhibition restores erectile function by suppressing corporal smooth muscle apoptosis in diabetic rats.J Sex Med. 2011 Apr;8(4):1072-82. doi: 10.1111/j.1743-6109.2010.02176.x. Epub 2011 Jan 14.
• [15] Calcineurin cleavage is triggered by elevated intraocular pressure, and calcineurin inhibition blocks retinal ganglion cell death in experimental glaucoma.Proc Natl Acad Sci U S A. 2005 Aug 23;102(34):12242-7. doi: 10.1073/pnas.0505138102. Epub 2005 Aug 15.
• [16] Zolmitriptan attenuates hepatocellular carcinoma via activation of caspase mediated apoptosis.Chem Biol Interact. 2019 Aug 1;308:120-129. doi: 10.1016/j.cbi.2019.05.033. Epub 2019 May 23.
• [17] Propylthiouracil-induced hypothyroidism delays apoptosis during the first wave of spermatogenesis.Biol Res. 2011;44(2):181-8. Epub 2011 Sep 20.
• [18] Over-expression of PUMA correlates with the apoptosis of spinal cord cells in rat neuropathic intermittent claudication model.PLoS One. 2013 May 2;8(5):e56580. doi: 10.1371/journal.pone.0056580. Print 2013.
• [19] A new selective AKT pharmacological inhibitor reduces resistance to chemotherapeutic drugs, TRAIL, all-trans-retinoic acid, and ionizing radiation of human leukemia cells. Leukemia. 2003 Sep;17(9):1794-805. doi: 10.1038/sj.leu.2403044.
• [20] pERK, pAkt and pBad: a possible role in cell proliferation and sustained cellular survival during tumorigenesis and tumor progression in ENU induced transplacental glioma rat model.Neurochem Res. 2006 Sep;31(9):1163-70. doi: 10.1007/s11064-006-9142-7. Epub 2006 Aug 31.
• [21] Non-canonical BAD activity regulates breast cancer cell and tumor growth via 14-3-3 binding and mitochondrial metabolism.Oncogene. 2019 May;38(18):3325-3339. doi: 10.1038/s41388-018-0673-6. Epub 2019 Jan 11.
• [22] The hyperglycemia stimulated myocardial endoplasmic reticulum (ER) stress contributes to diabetic cardiomyopathy in the transgenic non-obese type 2 diabetic rats: a differential role of unfolded protein response (UPR) signaling proteins.Int J Biochem Cell Biol. 2013 Feb;45(2):438-47. doi: 10.1016/j.biocel.2012.09.017. Epub 2012 Sep 29.
• [23] Genetic and pharmacologic inhibition of EPHA2 promotes apoptosis in NSCLC.J Clin Invest. 2014 May;124(5):2037-49. doi: 10.1172/JCI72522. Epub 2014 Apr 8.
• [24] Genomic determinants of long-term cardiometabolic complications in childhood acute lymphoblastic leukemia survivors.BMC Cancer. 2017 Nov 10;17(1):751. doi: 10.1186/s12885-017-3722-6.
• [25] BAD phosphorylation determines ovarian cancer chemosensitivity and patient survival. Clin Cancer Res. 2011 Oct 1;17(19):6356-66. doi: 10.1158/1078-0432.CCR-11-0735. Epub 2011 Aug 17.
• [26] Endogenous repair by the activation of cell survival signalling cascades during the early stages of rat Parkinsonism.PLoS One. 2012;7(12):e51294. doi: 10.1371/journal.pone.0051294. Epub 2012 Dec 12.
• [27] Cytoprotective effect of neuropeptides on cancer stem cells: vasoactive intestinal peptide-induced antiapoptotic signaling.Cell Death Dis. 2017 Jun 1;8(6):e2844. doi: 10.1038/cddis.2017.226.
• [28] Novel and extensive aspects of paraquat-induced pulmonary fibrogenesis: comparative and time-course microarray analyses in fibrogenic and non-fibrogenic rats.J Toxicol Sci. 2007 Dec;32(5):529-53. doi: 10.2131/jts.32.529.
• [29] AF1q enhancement of gamma irradiation-induced apoptosis by up-regulation of BAD expression via NF-kappaB in human squamous carcinoma A431 cells.Oncol Rep. 2010 Aug;24(2):547-54.
• [30] p38MAPK suppresses chronic pancreatitis by regulating HSP27 and BAD expression.Free Radic Biol Med. 2012 Jun 1-15;52(11-12):2284-91. doi: 10.1016/j.freeradbiomed.2012.03.010. Epub 2012 Apr 16.
• [31] Cytoprotective effect of American ginseng in a rat ethanol gastric ulcer model.Molecules. 2013 Dec 27;19(1):316-26. doi: 10.3390/molecules19010316.
• [32] Sensitive Ewing sarcoma and neuroblastoma cell lines have increased levels of BAD expression and decreased levels of BAR expression compared to resistant cell lines.Cancer Lett. 2007 Mar 8;247(1):110-4. doi: 10.1016/j.canlet.2006.03.033. Epub 2006 May 11.
• [33] Discovery of a small-molecule inhibitor of specific serine residue BAD phosphorylation.Proc Natl Acad Sci U S A. 2018 Oct 30;115(44):E10505-E10514. doi: 10.1073/pnas.1804897115. Epub 2018 Oct 11.
• [34] Expression of the BAD pathway is a marker of triple-negative status and poor outcome.Sci Rep. 2019 Nov 25;9(1):17496. doi: 10.1038/s41598-019-53695-0.
• [35] Angiotensin II type 1 receptor-activated caspase-3 through ras/mitogen-activated protein kinase/extracellular signal-regulated kinase in the rostral ventrolateral medulla is involved in sympathoexcitation in stroke-prone spontaneously hypertensive rats.Hypertension. 2010 Feb;55(2):291-7. doi: 10.1161/HYPERTENSIONAHA.109.138636. Epub 2010 Jan 11.
• [36] Effect of cytokine-induced killer cells combined with dendritic cells on the survival rate and expression of 14-3-3 and p-Bad proteins in Lewis lung cancer cell lines.Oncol Lett. 2018 Aug;16(2):1815-1820. doi: 10.3892/ol.2018.8834. Epub 2018 May 30.
• [37] Inactivating mutations of proapoptotic Bad gene in human colon cancers.Carcinogenesis. 2004 Aug;25(8):1371-6. doi: 10.1093/carcin/bgh145. Epub 2004 Mar 19.
• [38] Combined BRAF and HSP90 Inhibition in Patients with Unresectable BRAF (V600E)-Mutant Melanoma.Clin Cancer Res. 2018 Nov 15;24(22):5516-5524. doi: 10.1158/1078-0432.CCR-18-0565. Epub 2018 Apr 19.
• [39] Anti-apoptotic activity of human matrix metalloproteinase-2 attenuates diabetes mellitus.Metabolism. 2018 May;82:88-99. doi: 10.1016/j.metabol.2018.01.016. Epub 2018 Jan 31.
• [40] Down regulation of N-acetylglucosaminyltransferase V facilitates all-transretinoic acid to induce apoptosis of human hepatocarcinoma cells. Mol Cell Biochem. 2006 Mar;284(1-2):103-10. doi: 10.1007/s11010-005-9022-5. Epub 2006 Jan 13.
• [41] Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
• [42] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [43] Pharmacological inhibition of Rho-kinase (ROCK) signaling enhances cisplatin resistance in neuroblastoma cells. Int J Oncol. 2010 Nov;37(5):1297-305. doi: 10.3892/ijo_00000781.
• [44] Molecular mechanism of action of bisphenol and bisphenol A mediated by oestrogen receptor alpha in growth and apoptosis of breast cancer cells. Br J Pharmacol. 2013 May;169(1):167-78.
• [45] Quercetin regulates insulin like growth factor signaling and induces intrinsic and extrinsic pathway mediated apoptosis in androgen independent prostate cancer cells (PC-3). Mol Cell Biochem. 2010 Nov;344(1-2):173-84. doi: 10.1007/s11010-010-0540-4. Epub 2010 Jul 25.
• [46] Arsenic trioxide induces different gene expression profiles of genes related to growth and apoptosis in glioma cells dependent on the p53 status. Mol Biol Rep. 2008 Sep;35(3):421-9.
• [47] Suberoylanilide hydroxamic acid (SAHA) potentiates paclitaxel-induced apoptosis in ovarian cancer cell lines. Gynecol Oncol. 2010 Jan;116(1):126-30. doi: 10.1016/j.ygyno.2009.09.039. Epub 2009 Oct 28.
• [48] The cannabinoid delta(9)-tetrahydrocannabinol inhibits RAS-MAPK and PI3K-AKT survival signalling and induces BAD-mediated apoptosis in colorectal cancer cells. Int J Cancer. 2007 Nov 15;121(10):2172-80. doi: 10.1002/ijc.22917.
• [49] Effect of zoledronic acid on oral fibroblasts and epithelial cells: a potential mechanism of bisphosphonate-associated osteonecrosis. Br J Haematol. 2009 Mar;144(5):667-76. doi: 10.1111/j.1365-2141.2008.07504.x. Epub 2008 Nov 20.
• [50] Cannabidiol Modulates the Immunophenotype and Inhibits the Activation of the Inflammasome in Human Gingival Mesenchymal Stem Cells. Front Physiol. 2016 Nov 24;7:559. doi: 10.3389/fphys.2016.00559. eCollection 2016.
• [51] Survival of retinal pigment epithelium after exposure to prolonged oxidative injury: a detailed gene expression and cellular analysis. Invest Ophthalmol Vis Sci. 2004 Oct;45(10):3767-77.
• [52] Rosiglitazone sensitizes MDA-MB-231 breast cancer cells to anti-tumour effects of tumour necrosis factor-alpha, CH11 and CYC202. Endocr Relat Cancer. 2007 Jun;14(2):305-15. doi: 10.1677/ERC-06-0003.
• [53] Lunasin, a novel seed peptide, sensitizes human breast cancer MDA-MB-231 cells to aspirin-arrested cell cycle and induced apoptosis. Chem Biol Interact. 2010 Jul 30;186(2):127-34. doi: 10.1016/j.cbi.2010.04.027. Epub 2010 May 21.
• [54] Susceptibility to drug-induced apoptosis correlates with differential modulation of Bad, Bcl-2 and Bcl-xL protein levels. Cell Death Differ. 2000 Jun;7(6):574-86. doi: 10.1038/sj.cdd.4400688.
• [55] Effects of tobacco compounds on gene expression in fetal lung fibroblasts. Environ Toxicol. 2008 Aug;23(4):423-34.
• [56] Indomethacin and juglone inhibit inflammatory molecules to induce apoptosis in colon cancer cells. J Biochem Mol Toxicol. 2020 Feb;34(2):e22433. doi: 10.1002/jbt.22433. Epub 2020 Jan 9.
• [57] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [58] Mitomycin-C induces the apoptosis of human Tenon's capsule fibroblast by activation of c-Jun N-terminal kinase 1 and caspase-3 protease. Invest Ophthalmol Vis Sci. 2005 Oct;46(10):3545-52. doi: 10.1167/iovs.04-1358.
• [59] Simvastatin induces activation of the serine-threonine protein kinase AKT and increases survival of isolated human pancreatic islets. Transplantation. 2002 Oct 27;74(8):1063-9. doi: 10.1097/00007890-200210270-00001.
• [60] Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
• [61] Sulindac sulfide inhibits epidermal growth factor-induced phosphorylation of extracellular-regulated kinase 1/2 and Bad in human colon cancer cells. Cancer Res. 2003 Feb 1;63(3):616-20.
• [62] Triggering of transient receptor potential vanilloid type 1 (TRPV1) by capsaicin induces Fas/CD95-mediated apoptosis of urothelial cancer cells in an ATM-dependent manner. Carcinogenesis. 2009 Aug;30(8):1320-9. doi: 10.1093/carcin/bgp138. Epub 2009 Jun 5.
• [63] 3,5,3'-triiodothyronine (T3) is a survival factor for pancreatic beta-cells undergoing apoptosis. J Cell Physiol. 2006 Feb;206(2):309-21. doi: 10.1002/jcp.20460.
• [64] Sorafenib induces apoptosis of AML cells via Bim-mediated activation of the intrinsic apoptotic pathway. Leukemia. 2008 Apr;22(4):808-18. doi: 10.1038/sj.leu.2405098. Epub 2008 Jan 17.
• [65] Docetaxel-induced apoptosis of human melanoma is mediated by activation of c-Jun NH2-terminal kinase and inhibited by the mitogen-activated protein kinase extracellular signal-regulated kinase 1/2 pathway. Clin Cancer Res. 2007 Feb 15;13(4):1308-14. doi: 10.1158/1078-0432.CCR-06-2216.
• [66] Vitamin D3 induces autophagy of human myeloid leukemia cells. J Biol Chem. 2008 Sep 12;283(37):25596-25605. doi: 10.1074/jbc.M801716200. Epub 2008 Jul 15.
• [67] Melatonin prevents nitric oxide-induced apoptosis by increasing the interaction between 14-3-3beta and p-Bad in SK-N-MC cells. J Pineal Res. 2008 Jan;44(1):95-100. doi: 10.1111/j.1600-079X.2007.00494.x.
• [68] Phenylephrine induces necroptosis and apoptosis in corneal epithelial cells dose- and time-dependently. Toxicology. 2019 Dec 1;428:152305. doi: 10.1016/j.tox.2019.152305. Epub 2019 Oct 9.
• [69] Homoharringtonine suppresses LoVo cell growth by inhibiting EphB4 and the PI3K/AKT and MAPK/EKR1/2 signaling pathways. Food Chem Toxicol. 2020 Feb;136:110960. doi: 10.1016/j.fct.2019.110960. Epub 2019 Nov 11.
• [70] Clonidine Induces Apoptosis of Human Corneal Epithelial Cells through Death Receptors-Mediated, Mitochondria-Dependent Signaling Pathway. Toxicol Sci. 2017 Mar 1;156(1):252-260. doi: 10.1093/toxsci/kfw249.
• [71] The effect of quercetin nanoparticle on cervical cancer progression by inducing apoptosis, autophagy and anti-proliferation via JAK2 suppression. Biomed Pharmacother. 2016 Aug;82:595-605. doi: 10.1016/j.biopha.2016.05.029. Epub 2016 Jun 9.
• [72] Norfloxacin induces apoptosis and necroptosis in human corneal epithelial cells. Toxicol In Vitro. 2020 Aug;66:104868. doi: 10.1016/j.tiv.2020.104868. Epub 2020 Apr 19.
• [73] Neurokinin-1 receptor (NK1R) inhibition sensitizes APL cells to anti-tumor effect of arsenic trioxide via restriction of NF-B axis: Shedding new light on resistance to Aprepitant. Int J Biochem Cell Biol. 2018 Oct;103:105-114. doi: 10.1016/j.biocel.2018.08.010. Epub 2018 Aug 23.
• [74] Anti-proliferative and gene expression actions of resveratrol in breast cancer cells in vitro. Oncotarget. 2014 Dec 30;5(24):12891-907.
• [75] Curcumin induces apoptosis through the mitochondria-mediated apoptotic pathway in HT-29 cells. J Zhejiang Univ Sci B. 2009 Feb;10(2):93-102. doi: 10.1631/jzus.B0820238.
• [76] Andrographolide inhibits the growth of human osteosarcoma cells by suppressing Wnt/-catenin, PI3K/AKT and NF-B signaling pathways. Chem Biol Interact. 2022 Sep 25;365:110068. doi: 10.1016/j.cbi.2022.110068. Epub 2022 Jul 31.
• [77] Antiproliferative and apoptotic potential of Glycyrrhizin against HPV16+?Caski cervical cancer cells: A plausible association with downreguation of HPV E6 and E7 oncogenes and Notch signaling pathway. Saudi J Biol Sci. 2022 May;29(5):3264-3275. doi: 10.1016/j.sjbs.2022.01.054. Epub 2022 Jan 31.
• [78] Inhibition of PI3K signaling pathway enhances the chemosensitivity of APL cells to ATO: Proposing novel therapeutic potential for BKM120. Eur J Pharmacol. 2018 Dec 15;841:10-18. doi: 10.1016/j.ejphar.2018.10.007. Epub 2018 Oct 11.
• [79] Erk phosphorylation reduces the thymoquinone toxicity in human hepatocarcinoma. Environ Toxicol. 2021 Oct;36(10):1990-1998. doi: 10.1002/tox.23317. Epub 2021 Jun 26.
• [80] Pim 1 kinase inhibitor ETP-45299 suppresses cellular proliferation and synergizes with PI3K inhibition. Cancer Lett. 2011 Jan 28;300(2):145-53. doi: 10.1016/j.canlet.2010.09.016. Epub 2010 Nov 3.
• [81] Delphinidin modulates JAK/STAT3 and MAPKinase signaling to induce apoptosis in HCT116 cells. Environ Toxicol. 2021 Aug;36(8):1557-1566. doi: 10.1002/tox.23152. Epub 2021 May 6.
• [82] Duvelisib treatment is associated with altered expression of apoptotic regulators that helps in sensitization of chronic lymphocytic leukemia cells to venetoclax (ABT-199). Leukemia. 2017 Sep;31(9):1872-1881. doi: 10.1038/leu.2016.382. Epub 2016 Dec 26.
• [83] Combined action of the dinuclear platinum compound BBR3610 with the PI3-K inhibitor PX-866 in glioblastoma. Int J Cancer. 2011 Feb 15;128(4):787-96. doi: 10.1002/ijc.25394.
• [84] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [85] A new selective AKT pharmacological inhibitor reduces resistance to chemotherapeutic drugs, TRAIL, all-trans-retinoic acid, and ionizing radiation of human leukemia cells. Leukemia. 2003 Sep;17(9):1794-805. doi: 10.1038/sj.leu.2403044.
• [86] Inhibition of neuroblastoma proliferation by PF-3758309, a small-molecule inhibitor that targets p21-activated kinase 4. Oncol Rep. 2017 Nov;38(5):2705-2716. doi: 10.3892/or.2017.5989. Epub 2017 Sep 22.
• [87] Cyclooxygenase-2 inhibitor celecoxib augments chemotherapeutic drug-induced apoptosis by enhancing activation of caspase-3 and -9 in prostate cancer cells. Int J Cancer. 2005 Jun 20;115(3):484-92. doi: 10.1002/ijc.20878.
• [88] CDK Blockade Using AT7519 Suppresses Acute Myeloid Leukemia Cell Survival through the Inhibition of Autophagy and Intensifies the Anti-leukemic Effect of Arsenic Trioxide. Iran J Pharm Res. 2019 Fall;18(Suppl1):119-131. doi: 10.22037/ijpr.2019.112560.13827.
• [89] Farnesoid X receptor (FXR) agonists induce hepatocellular apoptosis and impair hepatic functions via FXR/SHP pathway. Arch Toxicol. 2022 Jun;96(6):1829-1843. doi: 10.1007/s00204-022-03266-6. Epub 2022 Mar 10.
• [90] 2-methoxyestradiol induces mitotic arrest, apoptosis, and synergistic cytotoxicity with arsenic trioxide in human urothelial carcinoma cells. PLoS One. 2013 Aug 13;8(8):e68703. doi: 10.1371/journal.pone.0068703. eCollection 2013.
• [91] Tissue transglutaminase 2 inhibition promotes cell death and chemosensitivity in glioblastomas. Mol Cancer Ther. 2005 Sep;4(9):1293-302.
• [92] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [93] Dioscin inhibits human endometrial carcinoma proliferation via G0/G1 cell cycle arrest and mitochondrial-dependent signaling pathway. Food Chem Toxicol. 2021 Feb;148:111941. doi: 10.1016/j.fct.2020.111941. Epub 2020 Dec 24.
• [94] Naphtho[1,2-b]furan-4,5-dione disrupts Janus kinase-2 and induces apoptosis in breast cancer MDA-MB-231 cells. Toxicol In Vitro. 2010 Jun;24(4):1158-67. doi: 10.1016/j.tiv.2010.02.019. Epub 2010 Mar 1.
• [95] Bisphenol A stimulates the epithelial mesenchymal transition of estrogen negative breast cancer cells via FOXA1 signals. Arch Biochem Biophys. 2015 Nov 1;585:10-16. doi: 10.1016/j.abb.2015.09.006. Epub 2015 Sep 9.
• [96] A synthetic coumarin derivative (4-flourophenylacetamide-acetyl coumarin) impedes cell cycle at G0/G1 stage, induces apoptosis, and inhibits metastasis via ROS-mediated p53 and AKT signaling pathways in A549 cells. J Biochem Mol Toxicol. 2020 Oct;34(10):e22553. doi: 10.1002/jbt.22553. Epub 2020 Jun 24.
• [97] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [98] Central role of Nix in the autophagic response to ochratoxin A. Food Chem Toxicol. 2014 Jul;69:202-9. doi: 10.1016/j.fct.2014.04.017. Epub 2014 Apr 19.
• [99] Identification of genes associated with paraquat-induced toxicity in SH-SY5Y cells by PCR array focused on apoptotic pathways. J Toxicol Environ Health A. 2008;71(22):1457-67. doi: 10.1080/15287390802329364.
• [100] Activation of the N-methyl-d-aspartate receptor is involved in glyphosate-induced renal proximal tubule cell apoptosis. J Appl Toxicol. 2019 Aug;39(8):1096-1107. doi: 10.1002/jat.3795. Epub 2019 Mar 25.
• [101] Functional lipidomics: Palmitic acid impairs hepatocellular carcinoma development by modulating membrane fluidity and glucose metabolism. Hepatology. 2017 Aug;66(2):432-448. doi: 10.1002/hep.29033. Epub 2017 Jun 16.
• [102] Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
• [103] Comparison of long-term versus short-term effects of okadaic acid on the apoptotic status of human HepaRG cells. Chem Biol Interact. 2020 Feb 1;317:108937. doi: 10.1016/j.cbi.2020.108937. Epub 2020 Jan 8.
• [104] Chlorpyrifos induces NLRP3 inflammasome and pyroptosis/apoptosis via mitochondrial oxidative stress in human keratinocyte HaCaT cells. Toxicology. 2015 Dec 2;338:37-46. doi: 10.1016/j.tox.2015.09.006. Epub 2015 Oct 3.
• [105] Glutathione is a potential therapeutic target for acrolein toxicity in the cornea. Toxicol Lett. 2021 Apr 1;340:33-42. doi: 10.1016/j.toxlet.2021.01.005. Epub 2021 Jan 6.
• [106] Microcystin-LR promotes proliferation by activating Akt/S6K1 pathway and disordering apoptosis and cell cycle associated proteins phosphorylation in HL7702 cells. Toxicol Lett. 2016 Jan 5;240(1):214-25. doi: 10.1016/j.toxlet.2015.10.015. Epub 2015 Oct 23.
• [107] The novel dual PI3K/mTOR inhibitor GDC-0941 synergizes with the MEK inhibitor U0126 in non-small cell lung cancer cells. Mol Med Rep. 2012 Feb;5(2):503-8. doi: 10.3892/mmr.2011.682. Epub 2011 Nov 16.
• [108] Induction of apoptosis by cordycepin via reactive oxygen species generation in human leukemia cells. Toxicol In Vitro. 2011 Jun;25(4):817-24. doi: 10.1016/j.tiv.2011.02.001. Epub 2011 Feb 15.
• [109] Ellagic acid induces apoptosis in TSGH8301 human bladder cancer cells through the endoplasmic reticulum stress- and mitochondria-dependent signaling pathways. Environ Toxicol. 2014 Nov;29(11):1262-74. doi: 10.1002/tox.21857. Epub 2013 Mar 30.
• [110] Haem oxygenase-1 plays a central role in NNK-mediated lung carcinogenesis. Eur Respir J. 2008 Oct;32(4):911-23. doi: 10.1183/09031936.00064508. Epub 2008 May 28.
• [111] Licochalcone A from licorice root, an inhibitor of human hepatoma cell growth via induction of cell apoptosis and cell cycle arrest. Food Chem Toxicol. 2018 Oct;120:407-417. doi: 10.1016/j.fct.2018.07.044. Epub 2018 Jul 25.
• [112] Methylglyoxal disturbs the expression of antioxidant, apoptotic and glycation responsive genes and triggers programmed cell death in human leukocytes. Toxicol In Vitro. 2019 Mar;55:33-42.
• [113] Norcantharidin induces apoptosis of breast cancer cells: involvement of activities of mitogen activated protein kinases and signal transducers and activators of transcription. Toxicol In Vitro. 2011 Apr;25(3):699-707. doi: 10.1016/j.tiv.2011.01.011. Epub 2011 Jan 23.
• [114] Antitumor activity of 4-O-(2-O-acetyl-6-O-p-coumaroyl--D-glucopyranosyl)-p-coumaric acid against lung cancers via mitochondrial-mediated apoptosis. Chem Biol Interact. 2015 May 25;233:8-13. doi: 10.1016/j.cbi.2015.03.014. Epub 2015 Mar 27.
• [115] NDAT suppresses pro-inflammatory gene expression to enhance resveratrol-induced anti-proliferation in oral cancer cells. Food Chem Toxicol. 2020 Feb;136:111092. doi: 10.1016/j.fct.2019.111092. Epub 2019 Dec 26.
• [116] An insight into the hepatocellular death induced by amphetamines, individually and in combination: the involvement of necrosis and apoptosis. Arch Toxicol. 2013 Dec;87(12):2165-85. doi: 10.1007/s00204-013-1082-9. Epub 2013 Jul 3.
• [117] In vitro antiproliferative activity of 2,3-dihydroxy-9,10-anthraquinone induced apoptosis against COLO320 cells through cytochrome c release caspase mediated pathway with PI3K/AKT and COX-2 inhibition. Chem Biol Interact. 2016 Apr 5;249:23-35.
• [118] Transcriptome Analysis Reveals the Anti-Tumor Mechanism of Eucalyptol Treatment on Neuroblastoma Cell Line SH-SY5Y. Neurochem Res. 2022 Dec;47(12):3854-3862. doi: 10.1007/s11064-022-03786-8. Epub 2022 Nov 4.