Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUJP9CN)

DOT Name Transcription factor p65 (RELA)
Synonyms Nuclear factor NF-kappa-B p65 subunit; Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3
Gene Name RELA
Related Disease
Brain neoplasm ( )
Clear cell renal carcinoma ( )
Combined immunodeficiency due to RELA haploinsufficiency ( )
End-stage renal disease ( )
Renal cell carcinoma ( )
Alcoholic cirrhosis of liver ( )
Arteriosclerosis ( )
Barrett esophagus ( )
Brain cancer ( )
Breast cancer ( )
Breast carcinoma ( )
Cholestasis ( )
Chronic renal failure ( )
Cystitis ( )
Encephalitis ( )
Ependymoma ( )
Epilepsy ( )
High blood pressure ( )
Mucocutaneous ulceration, chronic ( )
Ovarian neoplasm ( )
Papillary renal cell carcinoma ( )
Parkinsonian disorder ( )
Pneumococcal meningitis ( )
Primary biliary cholangitis ( )
Pulmonary hypertension ( )
Schizophrenia ( )
Status epilepticus seizure ( )
Ulcerative colitis ( )
Uveitis ( )
Colon cancer ( )
Colonic neoplasm ( )
Intracerebral hemorrhage ( )
Lung neoplasm ( )
Skin cancer ( )
Skin neoplasm ( )
Obsolete hereditary pediatric Behet-like disease ( )
Brain ischaemia ( )
Breast neoplasm ( )
Non-insulin dependent diabetes ( )
UniProt ID
TF65_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1NFI ; 2LSP ; 2O61 ; 3GUT ; 3QXY ; 3RC0 ; 4KV1 ; 4KV4 ; 5U4K ; 5URN ; 6NV2 ; 6QHL ; 6QHM ; 6YOW ; 6YOX ; 6YOY ; 6YP2 ; 6YP3 ; 6YP8 ; 6YPL ; 6YPY ; 6YQ2 ; 7BI3 ; 7BIQ ; 7BIW ; 7BIY ; 7BJB ; 7BJF ; 7BJL ; 7BJW ; 7BKH ; 7LET ; 7LEU ; 7LF4 ; 7NJ9 ; 7NJB ; 7NK3 ; 7NK5 ; 7NLA ; 7NLE ; 7NM1 ; 7NM3 ; 7NM9 ; 7NMH ; 7NQP ; 7NR7 ; 7NSV ; 7NV4 ; 7NVI ; 7NWS ; 7NXS ; 7NXT ; 7NXW ; 7NXY ; 7NY4 ; 7NYE ; 7NYF ; 7NYG ; 7NZ6 ; 7NZG ; 7NZK ; 7NZV ; 7O34 ; 7O3A ; 7O3F ; 7O3P ; 7O3Q ; 7O3R ; 7O3S ; 7O57 ; 7O59 ; 7O5A ; 7O5C ; 7O5D ; 7O5F ; 7O5G ; 7O5O ; 7O5P ; 7O5S ; 7O5U ; 7O5X ; 7O6F ; 7O6G ; 7O6I ; 7O6J ; 7O6K ; 7O6M ; 7O6O
Pfam ID
PF16179 ; PF00554
Sequence
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINY
DEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQA
VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQ
GIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADM
DFSALLSQISS
Function
NF-kappa-B is a pleiotropic transcription factor present in almost all cell types and is the endpoint of a series of signal transduction events that are initiated by a vast array of stimuli related to many biological processes such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52. The heterodimeric RELA-NFKB1 complex appears to be most abundant one. The dimers bind at kappa-B sites in the DNA of their target genes and the individual dimers have distinct preferences for different kappa-B sites that they can bind with distinguishable affinity and specificity. Different dimer combinations act as transcriptional activators or repressors, respectively. The NF-kappa-B heterodimeric RELA-NFKB1 and RELA-REL complexes, for instance, function as transcriptional activators. NF-kappa-B is controlled by various mechanisms of post-translational modification and subcellular compartmentalization as well as by interactions with other cofactors or corepressors. NF-kappa-B complexes are held in the cytoplasm in an inactive state complexed with members of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activation pathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs) in response to different activators, subsequently degraded thus liberating the active NF-kappa-B complex which translocates to the nucleus. The inhibitory effect of I-kappa-B on NF-kappa-B through retention in the cytoplasm is exerted primarily through the interaction with RELA. RELA shows a weak DNA-binding site which could contribute directly to DNA binding in the NF-kappa-B complex. Beside its activity as a direct transcriptional activator, it is also able to modulate promoters accessibility to transcription factors and thereby indirectly regulate gene expression. Associates with chromatin at the NF-kappa-B promoter region via association with DDX1. Essential for cytokine gene expression in T-cells. The NF-kappa-B homodimeric RELA-RELA complex appears to be involved in invasin-mediated activation of IL-8 expression. Key transcription factor regulating the IFN response during SARS-CoV-2 infection.
KEGG Pathway
Antifolate resistance (hsa01523 )
MAPK sig.ling pathway (hsa04010 )
Ras sig.ling pathway (hsa04014 )
cAMP sig.ling pathway (hsa04024 )
Chemokine sig.ling pathway (hsa04062 )
NF-kappa B sig.ling pathway (hsa04064 )
HIF-1 sig.ling pathway (hsa04066 )
Sphingolipid sig.ling pathway (hsa04071 )
Mitophagy - animal (hsa04137 )
PI3K-Akt sig.ling pathway (hsa04151 )
Apoptosis (hsa04210 )
Longevity regulating pathway (hsa04211 )
Cellular senescence (hsa04218 )
Osteoclast differentiation (hsa04380 )
Neutrophil extracellular trap formation (hsa04613 )
Toll-like receptor sig.ling pathway (hsa04620 )
NOD-like receptor sig.ling pathway (hsa04621 )
RIG-I-like receptor sig.ling pathway (hsa04622 )
Cytosolic D.-sensing pathway (hsa04623 )
C-type lectin receptor sig.ling pathway (hsa04625 )
IL-17 sig.ling pathway (hsa04657 )
Th1 and Th2 cell differentiation (hsa04658 )
Th17 cell differentiation (hsa04659 )
T cell receptor sig.ling pathway (hsa04660 )
B cell receptor sig.ling pathway (hsa04662 )
TNF sig.ling pathway (hsa04668 )
Neurotrophin sig.ling pathway (hsa04722 )
Prolactin sig.ling pathway (hsa04917 )
Adipocytokine sig.ling pathway (hsa04920 )
Relaxin sig.ling pathway (hsa04926 )
Insulin resistance (hsa04931 )
Non-alcoholic fatty liver disease (hsa04932 )
AGE-RAGE sig.ling pathway in diabetic complications (hsa04933 )
Alcoholic liver disease (hsa04936 )
Alzheimer disease (hsa05010 )
Pathways of neurodegeneration - multiple diseases (hsa05022 )
Cocaine addiction (hsa05030 )
Epithelial cell sig.ling in Helicobacter pylori infection (hsa05120 )
Pathogenic Escherichia coli infection (hsa05130 )
Shigellosis (hsa05131 )
Salmonella infection (hsa05132 )
Pertussis (hsa05133 )
Legionellosis (hsa05134 )
Yersinia infection (hsa05135 )
Leishmaniasis (hsa05140 )
Chagas disease (hsa05142 )
Toxoplasmosis (hsa05145 )
Amoebiasis (hsa05146 )
Tuberculosis (hsa05152 )
Hepatitis C (hsa05160 )
Hepatitis B (hsa05161 )
Measles (hsa05162 )
Human cytomegalovirus infection (hsa05163 )
Influenza A (hsa05164 )
Human papillomavirus infection (hsa05165 )
Human T-cell leukemia virus 1 infection (hsa05166 )
Kaposi sarcoma-associated herpesvirus infection (hsa05167 )
Herpes simplex virus 1 infection (hsa05168 )
Epstein-Barr virus infection (hsa05169 )
Human immunodeficiency virus 1 infection (hsa05170 )
Coro.virus disease - COVID-19 (hsa05171 )
Pathways in cancer (hsa05200 )
Transcriptio.l misregulation in cancer (hsa05202 )
Viral carcinogenesis (hsa05203 )
Chemical carcinogenesis - receptor activation (hsa05207 )
Chemical carcinogenesis - reactive oxygen species (hsa05208 )
Pancreatic cancer (hsa05212 )
Prostate cancer (hsa05215 )
Chronic myeloid leukemia (hsa05220 )
Acute myeloid leukemia (hsa05221 )
Small cell lung cancer (hsa05222 )
PD-L1 expression and PD-1 checkpoint pathway in cancer (hsa05235 )
Inflammatory bowel disease (hsa05321 )
Diabetic cardiomyopathy (hsa05415 )
Lipid and atherosclerosis (hsa05417 )
Fluid shear stress and atherosclerosis (hsa05418 )
Reactome Pathway
RIP-mediated NFkB activation via ZBP1 (R-HSA-1810476 )
Regulated proteolysis of p75NTR (R-HSA-193692 )
Downstream TCR signaling (R-HSA-202424 )
NF-kB is activated and signals survival (R-HSA-209560 )
Senescence-Associated Secretory Phenotype (SASP) (R-HSA-2559582 )
FCERI mediated NF-kB activation (R-HSA-2871837 )
DEx/H-box helicases activate type I IFN and inflammatory cytokines production (R-HSA-3134963 )
PKMTs methylate histone lysines (R-HSA-3214841 )
Transcriptional regulation of white adipocyte differentiation (R-HSA-381340 )
TAK1-dependent IKK and NF-kappa-B activation (R-HSA-445989 )
Interleukin-1 processing (R-HSA-448706 )
SUMOylation of immune response proteins (R-HSA-4755510 )
IkBA variant leads to EDA-ID (R-HSA-5603029 )
Dectin-1 mediated noncanonical NF-kB signaling (R-HSA-5607761 )
CLEC7A (Dectin-1) signaling (R-HSA-5607764 )
CD209 (DC-SIGN) signaling (R-HSA-5621575 )
CLEC7A/inflammasome pathway (R-HSA-5660668 )
The NLRP3 inflammasome (R-HSA-844456 )
Transcriptional Regulation by VENTX (R-HSA-8853884 )
Interleukin-1 signaling (R-HSA-9020702 )
TRAF6 mediated NF-kB activation (R-HSA-933542 )
Purinergic signaling in leishmaniasis infection (R-HSA-9660826 )
SARS-CoV-1 activates/modulates innate immune responses (R-HSA-9692916 )
Regulation of NFE2L2 gene expression (R-HSA-9818749 )
Activation of NF-kappaB in B cells (R-HSA-1169091 )

Molecular Interaction Atlas (MIA) of This DOT

39 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Brain neoplasm DISY3EKS Definitive Biomarker [1]
Clear cell renal carcinoma DISBXRFJ Definitive Biomarker [2]
Combined immunodeficiency due to RELA haploinsufficiency DIS4ATAK Definitive Autosomal dominant [3]
End-stage renal disease DISXA7GG Definitive Biomarker [4]
Renal cell carcinoma DISQZ2X8 Definitive Biomarker [2]
Alcoholic cirrhosis of liver DISQ1WRT Strong Biomarker [5]
Arteriosclerosis DISK5QGC Strong Altered Expression [6]
Barrett esophagus DIS416Y7 Strong Altered Expression [7]
Brain cancer DISBKFB7 Strong Biomarker [1]
Breast cancer DIS7DPX1 Strong Biomarker [8]
Breast carcinoma DIS2UE88 Strong Biomarker [8]
Cholestasis DISDJJWE Strong Biomarker [9]
Chronic renal failure DISGG7K6 Strong Altered Expression [10]
Cystitis DIS2D4B9 Strong Altered Expression [11]
Encephalitis DISLD1RL Strong Altered Expression [12]
Ependymoma DISUMRNZ Strong Genetic Variation [13]
Epilepsy DISBB28L Strong Biomarker [14]
High blood pressure DISY2OHH Strong Biomarker [15]
Mucocutaneous ulceration, chronic DIS3JOYX Strong Autosomal dominant [16]
Ovarian neoplasm DISEAFTY Strong Altered Expression [17]
Papillary renal cell carcinoma DIS25HBV Strong Biomarker [18]
Parkinsonian disorder DISHGY45 Strong Biomarker [19]
Pneumococcal meningitis DISM5U0L Strong Biomarker [20]
Primary biliary cholangitis DIS43E0O Strong Biomarker [21]
Pulmonary hypertension DIS1RSP5 Strong Biomarker [22]
Schizophrenia DISSRV2N Strong Biomarker [23]
Status epilepticus seizure DISY3BIC Strong Altered Expression [24]
Ulcerative colitis DIS8K27O Strong Biomarker [25]
Uveitis DISV0RYS Strong Biomarker [26]
Colon cancer DISVC52G moderate Altered Expression [27]
Colonic neoplasm DISSZ04P moderate Biomarker [28]
Intracerebral hemorrhage DISC81BT moderate Biomarker [29]
Lung neoplasm DISVARNB moderate Altered Expression [30]
Skin cancer DISTM18U moderate Biomarker [31]
Skin neoplasm DIS16DDV moderate Biomarker [31]
Obsolete hereditary pediatric Behet-like disease DISNNKF2 Supportive Autosomal dominant [32]
Brain ischaemia DIS9Q4RT Limited Therapeutic [33]
Breast neoplasm DISNGJLM Limited Altered Expression [34]
Non-insulin dependent diabetes DISK1O5Z Limited Altered Expression [35]
------------------------------------------------------------------------------------
⏷ Show the Full List of 39 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 5 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Hydrogen peroxide DM1NG5W Approved Transcription factor p65 (RELA) decreases the response to substance of Hydrogen peroxide. [128]
Gefitinib DM15F0X Approved Transcription factor p65 (RELA) decreases the response to substance of Gefitinib. [129]
Romidepsin DMT5GNL Approved Transcription factor p65 (RELA) decreases the response to substance of Romidepsin. [109]
Camptothecin DM6CHNJ Phase 3 Transcription factor p65 (RELA) increases the response to substance of Camptothecin. [131]
Rimcazole DMKDS1C Terminated Transcription factor p65 (RELA) increases the response to substance of Rimcazole. [131]
------------------------------------------------------------------------------------
14 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Transcription factor p65 (RELA). [36]
Hydroquinone DM6AVR4 Approved Hydroquinone increases the phosphorylation of Transcription factor p65 (RELA). [59]
Menthol DMG2KW7 Approved Menthol increases the phosphorylation of Transcription factor p65 (RELA). [70]
Beta-carotene DM0RXBT Approved Beta-carotene decreases the phosphorylation of Transcription factor p65 (RELA). [78]
Morphine DMRMS0L Approved Morphine increases the phosphorylation of Transcription factor p65 (RELA). [82]
Glutathione DMAHMT9 Approved Glutathione increases the glutathionylation of Transcription factor p65 (RELA). [83]
Ergotidine DM78IME Approved Ergotidine increases the phosphorylation of Transcription factor p65 (RELA). [86]
Desloratadine DM56YN7 Approved Desloratadine decreases the phosphorylation of Transcription factor p65 (RELA). [95]
Resatorvid DMFMWYC Phase 3 Resatorvid decreases the phosphorylation of Transcription factor p65 (RELA). [106]
Belinostat DM6OC53 Phase 2 Belinostat increases the acetylation of Transcription factor p65 (RELA). [109]
DNCB DMDTVYC Phase 2 DNCB increases the phosphorylation of Transcription factor p65 (RELA). [110]
Antroquinonol DMRGQVZ Phase 2 Antroquinonol decreases the phosphorylation of Transcription factor p65 (RELA). [117]
Taurocholic acid DM2LZ8F Phase 1/2 Taurocholic acid increases the phosphorylation of Transcription factor p65 (RELA). [118]
Tetrandrine DMAOJBX Phase 1 Tetrandrine increases the phosphorylation of Transcription factor p65 (RELA). [122]
------------------------------------------------------------------------------------
⏷ Show the Full List of 14 Drug(s)
61 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Transcription factor p65 (RELA). [37]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Transcription factor p65 (RELA). [38]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Transcription factor p65 (RELA). [39]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Transcription factor p65 (RELA). [40]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Transcription factor p65 (RELA). [41]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Transcription factor p65 (RELA). [42]
Arsenic DMTL2Y1 Approved Arsenic decreases the expression of Transcription factor p65 (RELA). [43]
Quercetin DM3NC4M Approved Quercetin increases the expression of Transcription factor p65 (RELA). [44]
Temozolomide DMKECZD Approved Temozolomide decreases the activity of Transcription factor p65 (RELA). [45]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Transcription factor p65 (RELA). [46]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Transcription factor p65 (RELA). [47]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Transcription factor p65 (RELA). [49]
Selenium DM25CGV Approved Selenium increases the expression of Transcription factor p65 (RELA). [51]
Progesterone DMUY35B Approved Progesterone decreases the activity of Transcription factor p65 (RELA). [52]
Fluorouracil DMUM7HZ Approved Fluorouracil decreases the expression of Transcription factor p65 (RELA). [53]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Transcription factor p65 (RELA). [54]
Niclosamide DMJAGXQ Approved Niclosamide decreases the expression of Transcription factor p65 (RELA). [55]
Cannabidiol DM0659E Approved Cannabidiol decreases the expression of Transcription factor p65 (RELA). [56]
Bortezomib DMNO38U Approved Bortezomib decreases the expression of Transcription factor p65 (RELA). [57]
Troglitazone DM3VFPD Approved Troglitazone decreases the activity of Transcription factor p65 (RELA). [58]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol increases the activity of Transcription factor p65 (RELA). [60]
Rosiglitazone DMILWZR Approved Rosiglitazone decreases the expression of Transcription factor p65 (RELA). [61]
Cytarabine DMZD5QR Approved Cytarabine decreases the activity of Transcription factor p65 (RELA). [63]
Irinotecan DMP6SC2 Approved Irinotecan increases the activity of Transcription factor p65 (RELA). [65]
Paclitaxel DMLB81S Approved Paclitaxel decreases the expression of Transcription factor p65 (RELA). [66]
Diclofenac DMPIHLS Approved Diclofenac affects the expression of Transcription factor p65 (RELA). [49]
Nicotine DMWX5CO Approved Nicotine increases the expression of Transcription factor p65 (RELA). [67]
Malathion DMXZ84M Approved Malathion increases the expression of Transcription factor p65 (RELA). [68]
Mitomycin DMH0ZJE Approved Mitomycin increases the expression of Transcription factor p65 (RELA). [71]
Simvastatin DM30SGU Approved Simvastatin decreases the expression of Transcription factor p65 (RELA). [73]
Gemcitabine DMSE3I7 Approved Gemcitabine increases the expression of Transcription factor p65 (RELA). [74]
Sulindac DM2QHZU Approved Sulindac increases the expression of Transcription factor p65 (RELA). [75]
Imatinib DM7RJXL Approved Imatinib decreases the expression of Transcription factor p65 (RELA). [55]
Ritonavir DMU764S Approved Ritonavir decreases the activity of Transcription factor p65 (RELA). [79]
Deoxycholic acid DM3GYAL Approved Deoxycholic acid increases the expression of Transcription factor p65 (RELA). [80]
Ximelegatran DMU8ANS Approved Ximelegatran decreases the expression of Transcription factor p65 (RELA). [84]
Sulfasalazine DMICA9H Approved Sulfasalazine decreases the activity of Transcription factor p65 (RELA). [87]
Sodium chloride DMM3950 Approved Sodium chloride increases the expression of Transcription factor p65 (RELA). [88]
Hydroxychloroquine DMSIVND Approved Hydroxychloroquine increases the expression of Transcription factor p65 (RELA). [90]
Omacetaxine mepesuccinate DMPU2WX Approved Omacetaxine mepesuccinate increases the expression of Transcription factor p65 (RELA). [91]
Roflumilast DMPGHY8 Approved Roflumilast decreases the expression of Transcription factor p65 (RELA). [94]
Regorafenib DMHSY1I Approved Regorafenib decreases the expression of Transcription factor p65 (RELA). [96]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of Transcription factor p65 (RELA). [100]
Tamibarotene DM3G74J Phase 3 Tamibarotene affects the expression of Transcription factor p65 (RELA). [38]
Curcumin DMQPH29 Phase 3 Curcumin decreases the expression of Transcription factor p65 (RELA). [101]
Chloroquine DMSI5CB Phase 3 Trial Chloroquine decreases the expression of Transcription factor p65 (RELA). [102]
I3C DMIGFOR Phase 3 I3C decreases the expression of Transcription factor p65 (RELA). [103]
MLN4924 DMP36KD Phase 3 MLN4924 affects the activity of Transcription factor p65 (RELA). [104]
ICARIIN DMOJQGT Phase 3 ICARIIN increases the activity of Transcription factor p65 (RELA). [105]
Genistein DM0JETC Phase 2/3 Genistein decreases the expression of Transcription factor p65 (RELA). [107]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate increases the activity of Transcription factor p65 (RELA). [111]
PEITC DMOMN31 Phase 2 PEITC decreases the expression of Transcription factor p65 (RELA). [103]
URSOLIC ACID DM4SOAW Phase 2 URSOLIC ACID decreases the expression of Transcription factor p65 (RELA). [113]
Lithium DMZ3OU6 Phase 2 Lithium increases the activity of Transcription factor p65 (RELA). [114]
Beta-caryophyllene DM7583A Phase 2 Beta-caryophyllene decreases the expression of Transcription factor p65 (RELA). [116]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Transcription factor p65 (RELA). [37]
LY294002 DMY1AFS Phase 1 LY294002 decreases the expression of Transcription factor p65 (RELA). [121]
PMID26394986-Compound-22 DM43Z1G Patented PMID26394986-Compound-22 decreases the expression of Transcription factor p65 (RELA). [124]
MG-132 DMKA2YS Preclinical MG-132 decreases the activity of Transcription factor p65 (RELA). [125]
PJ34 DMXO6YH Preclinical PJ34 increases the expression of Transcription factor p65 (RELA). [126]
Ciglitazone DMAPO0T Preclinical Ciglitazone decreases the activity of Transcription factor p65 (RELA). [58]
------------------------------------------------------------------------------------
⏷ Show the Full List of 61 Drug(s)
25 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Vorinostat DMWMPD4 Approved Vorinostat affects the localization of Transcription factor p65 (RELA). [48]
Decitabine DMQL8XJ Approved Decitabine affects the localization of Transcription factor p65 (RELA). [50]
Ethanol DMDRQZU Approved Ethanol affects the localization of Transcription factor p65 (RELA). [62]
Aspirin DM672AH Approved Aspirin increases the localization of Transcription factor p65 (RELA). [64]
Indomethacin DMSC4A7 Approved Indomethacin affects the localization of Transcription factor p65 (RELA). [69]
Azacitidine DMTA5OE Approved Azacitidine affects the localization of Transcription factor p65 (RELA). [72]
Capsaicin DMGMF6V Approved Capsaicin decreases the localization of Transcription factor p65 (RELA). [76]
Methamphetamine DMPM4SK Approved Methamphetamine affects the localization of Transcription factor p65 (RELA). [77]
Glucosamine DM4ZLFD Approved Glucosamine increases the localization of Transcription factor p65 (RELA). [81]
Trovafloxacin DM6AN32 Approved Trovafloxacin affects the localization of Transcription factor p65 (RELA). [85]
Norepinephrine DMOUC09 Approved Norepinephrine affects the localization of Transcription factor p65 (RELA). [89]
Mercaptopurine DMTM2IK Approved Mercaptopurine affects the localization of Transcription factor p65 (RELA). [92]
Ibrutinib DMHZCPO Approved Ibrutinib affects the localization of Transcription factor p65 (RELA). [93]
Ceritinib DMB920Z Approved Ceritinib affects the localization of Transcription factor p65 (RELA). [97]
Aminolevulinic acid hci DMS4BLQ Approved Aminolevulinic acid hci affects the localization of Transcription factor p65 (RELA). [98]
Amifostine DM5FL14 Approved Amifostine increases the localization of Transcription factor p65 (RELA). [99]
EXISULIND DMBY56U Phase 3 EXISULIND affects the localization of Transcription factor p65 (RELA). [69]
Tocopherol DMBIJZ6 Phase 2 Tocopherol affects the localization of Transcription factor p65 (RELA). [108]
BAICALEIN DM4C7E6 Phase 2 BAICALEIN decreases the localization of Transcription factor p65 (RELA). [112]
CERC-801 DM3SZ7P Phase 2 CERC-801 affects the localization of Transcription factor p65 (RELA). [115]
PIPERINE DMYEAB1 Phase 1/2 PIPERINE decreases the localization of Transcription factor p65 (RELA). [119]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 affects the localization of Transcription factor p65 (RELA). [120]
Sphingosine-1-Phosphate DMJCQKA Phase 1 Sphingosine-1-Phosphate affects the localization of Transcription factor p65 (RELA). [118]
PMID28870136-Compound-48 DMPIM9L Patented PMID28870136-Compound-48 affects the localization of Transcription factor p65 (RELA). [123]
Piperlongumine DMIZCOE Preclinical Piperlongumine affects the localization of Transcription factor p65 (RELA). [127]
------------------------------------------------------------------------------------
⏷ Show the Full List of 25 Drug(s)

References

1 Naringenin, a flavanone inhibits the proliferation of cerebrally implanted C6 glioma cells in rats.Chem Biol Interact. 2011 Jan 15;189(1-2):26-36. doi: 10.1016/j.cbi.2010.09.028. Epub 2010 Oct 7.
2 Nuclear factor-kappa B subunits and their prognostic cancer-specific survival value in renal cell carcinoma patients.Pathology. 2018 Aug;50(5):511-518. doi: 10.1016/j.pathol.2018.03.003. Epub 2018 Jun 21.
3 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
4 Melatonin ameliorates oxidative stress, inflammation, proteinuria, and progression of renal damage in rats with renal mass reduction.Am J Physiol Renal Physiol. 2008 Feb;294(2):F336-44. doi: 10.1152/ajprenal.00500.2007. Epub 2007 Dec 12.
5 Protective effect of genistein isolated from Hydrocotyle sibthorpioides on hepatic injury and fibrosis induced by chronic alcohol in rats.Toxicol Lett. 2013 Feb 27;217(2):102-10. doi: 10.1016/j.toxlet.2012.12.014. Epub 2012 Dec 26.
6 Adipose-Derived Stem Cell Transplantation Inhibits Vascular Inflammatory Responses and Endothelial Dysfunction in Rats with Atherosclerosis.Yonsei Med J. 2019 Nov;60(11):1036-1044. doi: 10.3349/ymj.2019.60.11.1036.
7 Strong NFB Expression is Associated With High-grade Dysplasia in Barrett's Esophagus.Appl Immunohistochem Mol Morphol. 2017 May/Jun;25(5):329-333. doi: 10.1097/PAI.0000000000000359.
8 Salinomycin reduces growth, proliferation and metastasis of cisplatin resistant breast cancer cells via NF-kB deregulation.Toxicol In Vitro. 2019 Oct;60:125-133. doi: 10.1016/j.tiv.2019.05.004. Epub 2019 May 8.
9 Mechanisms of TNFalpha-induced cardiac dysfunction in cholestatic bile duct-ligated mice: interaction between TNFalpha and endocannabinoids.J Hepatol. 2010 Aug;53(2):298-306. doi: 10.1016/j.jhep.2010.03.011. Epub 2010 May 6.
10 NF-B plays an important role in indoxyl sulfate-induced cellular senescence, fibrotic gene expression, and inhibition of proliferation in proximal tubular cells.Am J Physiol Cell Physiol. 2011 Nov;301(5):C1201-12. doi: 10.1152/ajpcell.00471.2010. Epub 2011 Aug 10.
11 Lymphotoxin receptor activation promotes bladder cancer in a nuclear factor-B-dependent manner.Mol Med Rep. 2015 Feb;11(2):783-90. doi: 10.3892/mmr.2014.2826. Epub 2014 Oct 30.
12 Myeloid-Related Protein 8/14 Participates in the Progression of Experimental Pneumococcal Meningitis by Augmentation of Inflammation.J Mol Neurosci. 2019 Aug;68(4):631-639. doi: 10.1007/s12031-019-01314-y. Epub 2019 May 2.
13 The TP53 p.R337H mutation is uncommon in a Brazilian cohort of pediatric patients diagnosed with ependymoma.Neurol Sci. 2020 Mar;41(3):691-694. doi: 10.1007/s10072-019-04112-x. Epub 2019 Nov 14.
14 HMGB1 mediates microglia activation via the TLR4/NF-B pathway in coriaria lactone induced epilepsy.Mol Med Rep. 2018 Apr;17(4):5125-5131. doi: 10.3892/mmr.2018.8485. Epub 2018 Jan 25.
15 Rho kinase activation in circulating leukocytes is related to hypertensive myocardial remodeling.Clin Sci (Lond). 2018 Aug 30;132(16):1837-1853. doi: 10.1042/CS20180312. Print 2018 Aug 31.
16 Neonatal High Bone Mass With First Mutation of the NF-B Complex: Heterozygous De Novo Missense (p.Asp512Ser) RELA (Rela/p65). J Bone Miner Res. 2016 Jan;31(1):163-72. doi: 10.1002/jbmr.2590. Epub 2015 Aug 6.
17 Epigenetic regulation of interleukin-8 expression by class I HDAC and CBP in ovarian cancer cells.Oncotarget. 2017 Aug 7;8(41):70798-70810. doi: 10.18632/oncotarget.19990. eCollection 2017 Sep 19.
18 Targeting the nuclear factor-kappaB rescue pathway has promising future in human renal cell carcinoma therapy.Cancer Res. 2007 Dec 15;67(24):11668-76. doi: 10.1158/0008-5472.CAN-07-0632.
19 The involvement of NF-kappaB p65/p52 in the effects of GDNF on DA neurons in early PD rats.Brain Res Bull. 2008 Jul 30;76(5):505-11. doi: 10.1016/j.brainresbull.2008.03.007. Epub 2008 Apr 9.
20 B7-H3 Augments Inflammatory Responses and Exacerbates Brain Damage via Amplifying NF-B p65 and MAPK p38 Activation during Experimental Pneumococcal Meningitis.PLoS One. 2017 Jan 31;12(1):e0171146. doi: 10.1371/journal.pone.0171146. eCollection 2017.
21 Hepatoprotective effects of diosmin and/or sildenafil against cholestatic liver cirrhosis: The role of Keap-1/Nrf-2 and P(38)-MAPK/NF-B/iNOS signaling pathway.Food Chem Toxicol. 2018 Oct;120:294-304. doi: 10.1016/j.fct.2018.07.027. Epub 2018 Jul 17.
22 A nuclear factor-kappaB inhibitor pyrrolidine dithiocarbamate ameliorates pulmonary hypertension in rats.Chest. 2007 Oct;132(4):1265-74. doi: 10.1378/chest.06-2243.
23 Variants of the RELA gene are associated with schizophrenia and their startle responses.Neuropsychopharmacology. 2011 Aug;36(9):1921-31. doi: 10.1038/npp.2011.78. Epub 2011 May 18.
24 MicroRNA-146a-5p Downregulates the Expression of P-Glycoprotein in Rats with Lithium-Pilocarpine-Induced Status Epilepticus.Biol Pharm Bull. 2019;42(5):744-750. doi: 10.1248/bpb.b18-00937.
25 Activation of adenosine A3 receptor inhibits inflammatory cytokine production in colonic mucosa of patients with ulcerative colitis by down-regulating the nuclear factor-kappa B signaling.J Dig Dis. 2020 Jan;21(1):38-45. doi: 10.1111/1751-2980.12831. Epub 2019 Dec 17.
26 Anti-inflammatory effect of angiotensin type 1 receptor antagonist on endotoxin-induced uveitis in rats.Graefes Arch Clin Exp Ophthalmol. 2008 May;246(5):747-57. doi: 10.1007/s00417-007-0730-2. Epub 2007 Dec 18.
27 PHD2 exerts anti-cancer and anti-inflammatory effects in colon cancer xenografts mice via attenuating NF-B activity.Life Sci. 2020 Feb 1;242:117167. doi: 10.1016/j.lfs.2019.117167. Epub 2019 Dec 12.
28 - and -tocopherols inhibit phIP/DSS-induced colon carcinogenesis by protection against early cellular and DNA damages.Mol Carcinog. 2017 Jan;56(1):172-183. doi: 10.1002/mc.22481. Epub 2016 May 13.
29 Distinct patterns of intracerebral hemorrhage-induced alterations in NF-kappaB subunit, iNOS, and COX-2 expression.J Neurochem. 2007 May;101(3):652-63. doi: 10.1111/j.1471-4159.2006.04414.x. Epub 2007 Jan 23.
30 Potential biomarkers involving IKK/RelA signal in early stage non-small cell lung cancer.Cancer Sci. 2008 Mar;99(3):582-9. doi: 10.1111/j.1349-7006.2007.00713.x. Epub 2008 Jan 21.
31 EMT and CSC-like properties mediated by the IKK/IB/RelA signal pathway via the transcriptional regulator, Snail, are involved in the arsenite-induced neoplastic transformation of human keratinocytes.Arch Toxicol. 2013 Jun;87(6):991-1000. doi: 10.1007/s00204-012-0933-0. Epub 2012 Oct 16.
32 A Novel RELA Truncating Mutation in a Familial Beh?et's Disease-like Mucocutaneous Ulcerative Condition. Arthritis Rheumatol. 2021 Mar;73(3):490-497. doi: 10.1002/art.41531. Epub 2021 Feb 15.
33 The role of Akt signaling in oxidative stress mediates NF-kappaB activation in mild transient focal cerebral ischemia.J Cereb Blood Flow Metab. 2008 Dec;28(12):1917-26. doi: 10.1038/jcbfm.2008.80. Epub 2008 Jul 16.
34 Visfatin promotes cell and tumor growth by upregulating Notch1 in breast cancer.Oncotarget. 2014 Jul 15;5(13):5087-99. doi: 10.18632/oncotarget.2086.
35 Eugenosedin-A improves glucose metabolism and inhibits MAPKs expression in streptozotocin/nicotinamide-induced diabetic rats.Kaohsiung J Med Sci. 2018 Mar;34(3):142-149. doi: 10.1016/j.kjms.2017.11.003. Epub 2017 Nov 29.
36 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
37 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
38 Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
39 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
40 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
41 Reciprocal regulation of 17beta-estradiol, interleukin-6 and interleukin-8 during growth and progression of epithelial ovarian cancer. Cytokine. 2009 Jun;46(3):382-91. doi: 10.1016/j.cyto.2009.03.013. Epub 2009 Apr 28.
42 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
43 Transcriptomics and methylomics of CD4-positive T cells in arsenic-exposed women. Arch Toxicol. 2017 May;91(5):2067-2078. doi: 10.1007/s00204-016-1879-4. Epub 2016 Nov 12.
44 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
45 Inhibition of nuclear factor-kappaB activity by temozolomide involves O6-methylguanine induced inhibition of p65 DNA binding. Cancer Res. 2007 Jul 15;67(14):6889-98.
46 Arsenic trioxide inhibits cell growth and induces apoptosis through inactivation of notch signaling pathway in breast cancer. Int J Mol Sci. 2012;13(8):9627-9641. doi: 10.3390/ijms13089627. Epub 2012 Aug 2.
47 Vitamin D3 induces autophagy in human monocytes/macrophages via cathelicidin. Cell Host Microbe. 2009 Sep 17;6(3):231-43. doi: 10.1016/j.chom.2009.08.004.
48 Combined histone deacetylase and NF-kappaB inhibition sensitizes non-small cell lung cancer to cell death. Surgery. 2004 Aug;136(2):416-25. doi: 10.1016/j.surg.2004.05.018.
49 Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
50 Inhibition of DNA methyltransferase activates tumor necrosis factor alpha-induced monocytic differentiation in acute myeloid leukemia cells. Cancer Res. 2009 Jan 1;69(1):55-64. doi: 10.1158/0008-5472.CAN-08-0245.
51 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
52 Progesterone and calcitriol attenuate inflammatory cytokines CXCL1 and CXCL2 in ovarian and endometrial cancer cells. J Cell Biochem. 2012 Oct;113(10):3143-52. doi: 10.1002/jcb.24191.
53 Adenoviral-mediated gene transfer of Gadd45a results in suppression by inducing apoptosis and cell cycle arrest in pancreatic cancer cell. J Gene Med. 2009 Jan;11(1):3-13. doi: 10.1002/jgm.1270.
54 Dexamethasone and the inflammatory response in explants of human omental adipose tissue. Mol Cell Endocrinol. 2010 Feb 5;315(1-2):292-8.
55 Anthelmintic Niclosamide Disrupts the Interplay of p65 and FOXM1/-catenin and Eradicates Leukemia Stem Cells in Chronic Myelogenous Leukemia. Clin Cancer Res. 2017 Feb 1;23(3):789-803. doi: 10.1158/1078-0432.CCR-16-0226. Epub 2016 Aug 4.
56 Cannabidiol Modulates the Immunophenotype and Inhibits the Activation of the Inflammasome in Human Gingival Mesenchymal Stem Cells. Front Physiol. 2016 Nov 24;7:559. doi: 10.3389/fphys.2016.00559. eCollection 2016.
57 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
58 Peroxisome proliferator-activated receptor-gamma agonists inhibit respiratory syncytial virus-induced expression of intercellular adhesion molecule-1 in human lung epithelial cells. Immunology. 2007 May;121(1):71-81. doi: 10.1111/j.1365-2567.2006.02539.x.
59 Hydroquinone triggers pyroptosis and endoplasmic reticulum stress via AhR-regulated oxidative stress in human lymphocytes. Toxicol Lett. 2023 Mar 1;376:39-50. doi: 10.1016/j.toxlet.2023.01.005. Epub 2023 Jan 13.
60 Activation of kinase pathways in MCF-7 cells by 17beta-estradiol and structurally diverse estrogenic compounds. J Steroid Biochem Mol Biol. 2006 Feb;98(2-3):122-32. doi: 10.1016/j.jsbmb.2005.08.018. Epub 2006 Jan 18.
61 Effects of PPAR-gamma agonist rosiglitazone on MMP-9 and TIMP-1 expression of monocyte-derived macrophages isolated from patients with acute coronary syndrome. Zhonghua Xin Xue Guan Bing Za Zhi. 2009 Aug;37(8):739-45.
62 Ethanol enhances arsenic-induced cyclooxygenase-2 expression via both NFAT and NF-B signalings in colorectal cancer cells. Toxicol Appl Pharmacol. 2015 Oct 15;288(2):232-9.
63 Mechanism of cytosine arabinoside-mediated apoptosis: role of Rel A (p65) dephosphorylation. Oncogene. 2003 Jul 10;22(28):4356-69. doi: 10.1038/sj.onc.1206486.
64 Evidence for colorectal cancer cell specificity of aspirin effects on NF kappa B signalling and apoptosis. Br J Cancer. 2004 Jul 19;91(2):381-8. doi: 10.1038/sj.bjc.6601913.
65 Pharmacological targeting of NF-kappaB potentiates the effect of the topoisomerase inhibitor CPT-11 on colon cancer cells. Br J Cancer. 2008 Jan 29;98(2):335-44. doi: 10.1038/sj.bjc.6604082. Epub 2008 Jan 8.
66 Combination of all-trans retinoic acid and taxol regressed glioblastoma T98G xenografts in nude mice. Apoptosis. 2007 Nov;12(11):2077-87. doi: 10.1007/s10495-007-0116-2. Epub 2007 Aug 16.
67 Nicotine stimulates CYP1A1 expression in human hepatocellular carcinoma cells via AP-1, NF-B, and AhR. Toxicol Lett. 2021 Oct 1;349:155-164. doi: 10.1016/j.toxlet.2021.06.013. Epub 2021 Jun 24.
68 Different Toxic Effects of Racemate, Enantiomers, and Metabolite of Malathion on HepG2 Cells Using High-Performance Liquid Chromatography-Quadrupole-Time-of-Flight-Based Metabolomics. J Agric Food Chem. 2019 Feb 20;67(7):1784-1794. doi: 10.1021/acs.jafc.8b04536. Epub 2019 Feb 8.
69 The proapoptotic effects of sulindac, sulindac sulfone and indomethacin are mediated by nucleolar translocation of the RelA(p65) subunit of NF-kappaB. Oncogene. 2008 Apr 17;27(18):2648-55. doi: 10.1038/sj.onc.1210891. Epub 2007 Dec 3.
70 Menthol in electronic cigarettes: A contributor to respiratory disease?. Toxicol Appl Pharmacol. 2020 Nov 15;407:115238. doi: 10.1016/j.taap.2020.115238. Epub 2020 Sep 17.
71 Mitomycin C induces apoptosis via Fas/FasL dependent pathway and suppression of IL-18 in cervical carcinoma cells. Cancer Lett. 2006 Jun 8;237(1):33-44. doi: 10.1016/j.canlet.2005.05.043. Epub 2005 Jul 12.
72 The effect of azacitidine on interleukin-6 signaling and nuclear factor-kappaB activation and its in vitro and in vivo activity against multiple myeloma. Haematologica. 2008 Jun;93(6):860-9. doi: 10.3324/haematol.12261. Epub 2008 Apr 28.
73 Suppression of RAGE as a basis of simvastatin-dependent plaque stabilization in type 2 diabetes. Arterioscler Thromb Vasc Biol. 2006 Dec;26(12):2716-23.
74 Gemcitabine combined with gum mastic causes potent growth inhibition and apoptosis of pancreatic cancer cells. Acta Pharmacol Sin. 2010 Jun;31(6):741-5. doi: 10.1038/aps.2010.54.
75 Differential gene expression of sulindac-treated human breast epithelial cells. Int J Oncol. 2005 Dec;27(6):1727-36.
76 Suppression of phorbol ester-induced NF-kappaB activation by capsaicin in cultured human promyelocytic leukemia cells. Arch Pharm Res. 2002 Aug;25(4):475-9. doi: 10.1007/BF02976605.
77 Melatonin attenuates methamphetamine-induced neuroinflammation through the melatonin receptor in the SH-SY5Y cell line. Neurotoxicology. 2015 Sep;50:122-30. doi: 10.1016/j.neuro.2015.08.008. Epub 2015 Aug 15.
78 -Carotene Induces Apoptosis in Human Esophageal Squamous Cell Carcinoma Cell Lines via the Cav-1/AKT/NF-B Signaling Pathway. J Biochem Mol Toxicol. 2016 Mar;30(3):148-57. doi: 10.1002/jbt.21773. Epub 2016 Jan 6.
79 Efficient intervention of growth and infiltration of primary adult T-cell leukemia cells by an HIV protease inhibitor, ritonavir. Blood. 2006 Jan 15;107(2):716-24. doi: 10.1182/blood-2005-02-0735. Epub 2005 Sep 20.
80 Prevention of deoxycholate-induced gastric apoptosis by aspirin: roles of NF-kappaB and PKC signaling. J Surg Res. 2008 Mar;145(1):66-73. doi: 10.1016/j.jss.2007.04.039. Epub 2007 Jul 20.
81 Glucosamine regulation of LPS-mediated inflammation in human bronchial epithelial cells. Eur J Pharmacol. 2010 Jun 10;635(1-3):219-26. doi: 10.1016/j.ejphar.2010.02.044. Epub 2010 Mar 20.
82 Mechanisms of the inhibition of nuclear factor-B by morphine in neuronal cells. Mol Pharmacol. 2012 Apr;81(4):587-97. doi: 10.1124/mol.111.076620. Epub 2012 Jan 18.
83 Dual mechanisms of NF-kappaB inhibition in carnosol-treated endothelial cells. Toxicol Appl Pharmacol. 2010 May 15;245(1):21-35. doi: 10.1016/j.taap.2010.01.003. Epub 2010 Jan 29.
84 Effects of Y-27632 on the osteogenic and adipogenic potential of human dental pulp stem cells in vitro. Hum Exp Toxicol. 2022 Jan-Dec;41:9603271221089003. doi: 10.1177/09603271221089003.
85 The hepatotoxic fluoroquinolone trovafloxacin disturbs TNF- and LPS-induced p65 nuclear translocation in vivo and in vitro. Toxicol Appl Pharmacol. 2020 Mar 15;391:114915. doi: 10.1016/j.taap.2020.114915. Epub 2020 Feb 6.
86 Glycyrrhizin attenuates histamine-mediated MUC5AC upregulation, inflammatory cytokine production, and aquaporin 5 downregulation through suppressing the NF-B pathway in human nasal epithelial cells. Chem Biol Interact. 2018 Apr 1;285:21-26. doi: 10.1016/j.cbi.2018.02.010. Epub 2018 Feb 13.
87 Sulfasalazine and BAY 11-7082 interfere with the nuclear factor-kappa B and I kappa B kinase pathway to regulate the release of proinflammatory cytokines from human adipose tissue and skeletal muscle in vitro. Endocrinology. 2005 Mar;146(3):1491-7. doi: 10.1210/en.2004-0809. Epub 2004 Nov 24.
88 Neoplastic-like transformation effect of single-walled and multi-walled carbon nanotubes compared to asbestos on human lung small airway epithelial cells. Nanotoxicology. 2014 Aug;8(5):485-507.
89 Targeting activation of specific NF-B subunits prevents stress-dependent atherothrombotic gene expression. Mol Med. 2012 Dec 20;18(1):1375-86. doi: 10.2119/molmed.2012.00282.
90 Hydroxychloroquine-inhibited dengue virus is associated with host defense machinery. J Interferon Cytokine Res. 2015 Mar;35(3):143-56. doi: 10.1089/jir.2014.0038. Epub 2014 Oct 16.
91 Synergistic killing effects of homoharringtonine and arsenic trioxide on acute myeloid leukemia stem cells and the underlying mechanisms. J Exp Clin Cancer Res. 2019 Jul 15;38(1):308. doi: 10.1186/s13046-019-1295-8.
92 CD28-dependent Rac1 activation is the molecular target of azathioprine in primary human CD4+ T lymphocytes. J Clin Invest. 2003 Apr;111(8):1133-45. doi: 10.1172/JCI16432.
93 Synergistic activity of BET protein antagonist-based combinations in mantle cell lymphoma cells sensitive or resistant to ibrutinib. Blood. 2015 Sep 24;126(13):1565-74.
94 Roflumilast protects from cisplatin-induced testicular toxicity in male rats and enhances its cytotoxicity in prostate cancer cell line. Role of NF-B-p65, cAMP/PKA and Nrf2/HO-1, NQO1 signaling. Food Chem Toxicol. 2021 May;151:112133. doi: 10.1016/j.fct.2021.112133. Epub 2021 Mar 20.
95 Blockade of NMT1 enzymatic activity inhibits N-myristoylation of VILIP3 protein and suppresses liver cancer progression. Signal Transduct Target Ther. 2023 Jan 9;8(1):14. doi: 10.1038/s41392-022-01248-9.
96 Regorefenib induces extrinsic/intrinsic apoptosis and inhibits MAPK/NF-B-modulated tumor progression in bladder cancer in vitro and in vivo. Environ Toxicol. 2019 Jun;34(6):679-688. doi: 10.1002/tox.22734. Epub 2019 Feb 25.
97 1-(4-((5-chloro-4-((2-(isopropylsulfonyl)phenyl)amino)pyrimidin-2-yl)amino)-3-methoxyphenyl)-3-(2-(dimethylamino)ethyl)imidazolidin-2-one (ZX-42) inhibits cell proliferation and induces apoptosis via inhibiting ALK and its downstream pathways in Karpas299 cells. Toxicol Appl Pharmacol. 2022 Sep 1;450:116156. doi: 10.1016/j.taap.2022.116156. Epub 2022 Jul 6.
98 5-aminolevulinic acid induce apoptosis via NF-B/JNK pathway in human oral cancer Ca9-22 cells. J Oral Pathol Med. 2011 Jul;40(6):483-9. doi: 10.1111/j.1600-0714.2010.00973.x. Epub 2010 Dec 8.
99 Amifostine inhibits hematopoietic progenitor cell apoptosis by activating NF-kappaB/Rel transcription factors. Blood. 1999 Dec 15;94(12):4060-6.
100 Interactive gene expression pattern in prostate cancer cells exposed to phenolic antioxidants. Life Sci. 2002 Mar 1;70(15):1821-39.
101 Curcumin downregulates the inflammatory cytokines CXCL1 and -2 in breast cancer cells via NFkappaB. Carcinogenesis. 2008 Apr;29(4):779-89.
102 Niclosamide, an anti-helminthic molecule, downregulates the retroviral oncoprotein Tax and pro-survival Bcl-2 proteins in HTLV-1-transformed T lymphocytes. Biochem Biophys Res Commun. 2015 Aug 14;464(1):221-228. doi: 10.1016/j.bbrc.2015.06.120. Epub 2015 Jun 23.
103 Combination of xanthohumol and phenethyl isothiocyanate inhibits NF-B and activates Nrf2 in pancreatic cancer cells. Toxicol In Vitro. 2020 Jun;65:104799. doi: 10.1016/j.tiv.2020.104799. Epub 2020 Feb 15.
104 The Nedd8-activating enzyme inhibitor MLN4924 thwarts microenvironment-driven NF-B activation and induces apoptosis in chronic lymphocytic leukemia B cells. Clin Cancer Res. 2014 Mar 15;20(6):1576-89. doi: 10.1158/1078-0432.CCR-13-0987.
105 Icariin enhances endothelial nitric-oxide synthase expression on human endothelial cells in vitro. Vascul Pharmacol. 2007 Jul;47(1):18-24.
106 7?Difluoromethyl?5,4'?dimethoxygenistein exerts anti?angiogenic effects on acute promyelocytic leukemia HL?60 cells by inhibiting the TLR4/NF?B signaling pathway. Mol Med Rep. 2020 May;21(5):2251-2259. doi: 10.3892/mmr.2020.11029. Epub 2020 Mar 18.
107 Genistein potentiates the effect of arsenic trioxide against human hepatocellular carcinoma: role of Akt and nuclear factor-B. Cancer Lett. 2011 Feb 1;301(1):75-84.
108 Ultraviolet (UV)A- and UVB-induced redox alterations and activation of nuclear factor-kappaB in human melanocytes-protective effects of alpha-tocopherol. Br J Dermatol. 2006 Aug;155(2):292-300. doi: 10.1111/j.1365-2133.2006.07347.x.
109 Interactions between bortezomib and romidepsin and belinostat in chronic lymphocytic leukemia cells. Clin Cancer Res. 2008 Jan 15;14(2):549-58. doi: 10.1158/1078-0432.CCR-07-1934.
110 Contact allergen (PPD and DNCB)-induced keratinocyte sensitization is partly mediated through a low molecular weight hyaluronan (LMWHA)/TLR4/NF-B signaling axis. Toxicol Appl Pharmacol. 2019 Aug 15;377:114632. doi: 10.1016/j.taap.2019.114632. Epub 2019 Jun 19.
111 Arsenic trioxide induces apoptosis of human monocytes during macrophagic differentiation through nuclear factor-kappaB-related survival pathway down-regulation. J Pharmacol Exp Ther. 2006 Jan;316(1):304-14. doi: 10.1124/jpet.105.092874. Epub 2005 Sep 20.
112 Baicalein inhibits the migration and invasive properties of human hepatoma cells. Toxicol Appl Pharmacol. 2011 Sep 15;255(3):316-26. doi: 10.1016/j.taap.2011.07.008. Epub 2011 Jul 23.
113 2, 3, 23-trihydroxy-urs-12-ene-28-olic acid (TUA) isolated from Actinidia chinensis Radix inhibits NCI-H460 cell proliferation by decreasing NF-B expression. Chem Biol Interact. 2015 Oct 5;240:1-11. doi: 10.1016/j.cbi.2015.06.038. Epub 2015 Jun 30.
114 Lithium induces NF-kappa B activation and interleukin-8 production in human intestinal epithelial cells. J Biol Chem. 2002 Mar 8;277(10):7713-9. doi: 10.1074/jbc.M109711200. Epub 2001 Dec 27.
115 Ginsenoside F1 suppresses astrocytic senescence-associated secretory phenotype. Chem Biol Interact. 2018 Mar 1;283:75-83. doi: 10.1016/j.cbi.2018.02.002. Epub 2018 Feb 3.
116 JAK1/STAT3 regulatory effect of -caryophyllene on MG-63 osteosarcoma cells via ROS-induced apoptotic mitochondrial pathway by DNA fragmentation. J Biochem Mol Toxicol. 2020 Aug;34(8):e22514. doi: 10.1002/jbt.22514. Epub 2020 May 2.
117 Antroquinonol from Antrodia Camphorata suppresses breast tumor migration/invasion through inhibiting ERK-AP-1- and AKT-NF-B-dependent MMP-9 and epithelial-mesenchymal transition expressions. Food Chem Toxicol. 2015 Apr;78:33-41. doi: 10.1016/j.fct.2015.01.012. Epub 2015 Feb 2.
118 Taurocholate induces cyclooxygenase-2 expression via the sphingosine 1-phosphate receptor 2 in a human cholangiocarcinoma cell line. J Biol Chem. 2015 Dec 25;290(52):30988-1002.
119 Piperine is a potent inhibitor of nuclear factor-kappaB (NF-kappaB), c-Fos, CREB, ATF-2 and proinflammatory cytokine gene expression in B16F-10 melanoma cells. Int Immunopharmacol. 2004 Dec 20;4(14):1795-803. doi: 10.1016/j.intimp.2004.08.005.
120 Brd4 maintains constitutively active NF-B in cancer cells by binding to acetylated RelA. Oncogene. 2014 May 1;33(18):2395-404. doi: 10.1038/onc.2013.179. Epub 2013 May 20.
121 The Specific Inhibition of SOD1 Selectively Promotes Apoptosis of Cancer Cells via Regulation of the ROS Signaling Network. Oxid Med Cell Longev. 2019 Feb 18;2019:9706792. doi: 10.1155/2019/9706792. eCollection 2019.
122 Tetrandrine and cepharanthine induce apoptosis through caspase cascade regulation, cell cycle arrest, MAPK activation and PI3K/Akt/mTOR signal modification in glucocorticoid resistant human leukemia Jurkat T cells. Chem Biol Interact. 2019 Sep 1;310:108726. doi: 10.1016/j.cbi.2019.108726. Epub 2019 Jun 28.
123 Theophylline inhibits NF-kappa B activation and I kappa B alpha degradation in human pulmonary epithelial cells. Naunyn Schmiedebergs Arch Pharmacol. 2001 Dec;364(6):558-61. doi: 10.1007/s00210-001-0494-x.
124 [Celecoxib promotes apoptosis of breast cancer cell line MDA-MB-231 through down-regulation of the NF-kappaB pathway]. Ai Zheng. 2009 Jun;28(6):569-74.
125 15-Deoxy-delta 12,14-prostaglandin J2 induces apoptosis in human malignant B cells: an effect associated with inhibition of NF-kappa B activity and down-regulation of antiapoptotic proteins. Blood. 2005 Feb 15;105(4):1750-8. doi: 10.1182/blood-2004-04-1360. Epub 2004 Oct 21.
126 Small PARP inhibitor PJ-34 induces cell cycle arrest and apoptosis of adult T-cell leukemia cells. J Hematol Oncol. 2015 Oct 23;8:117. doi: 10.1186/s13045-015-0217-2.
127 Piperlongumine decreases cell proliferation and the expression of cell cycle-associated proteins by inhibiting Akt pathway in human lung cancer cells. Food Chem Toxicol. 2018 Jan;111:9-18. doi: 10.1016/j.fct.2017.10.058. Epub 2017 Nov 7.
128 Repression of GADD153/CHOP by NF-kappaB: a possible cellular defense against endoplasmic reticulum stress-induced cell death. Oncogene. 2001 Apr 19;20(17):2178-85. doi: 10.1038/sj.onc.1204292.
129 Aurora-A promotes gefitinib resistance via a NF-B signaling pathway in p53 knockdown lung cancer cells. Biochem Biophys Res Commun. 2011 Feb 11;405(2):168-72. doi: 10.1016/j.bbrc.2011.01.001. Epub 2011 Jan 7.
130 Interactions between bortezomib and romidepsin and belinostat in chronic lymphocytic leukemia cells. Clin Cancer Res. 2008 Jan 15;14(2):549-58. doi: 10.1158/1078-0432.CCR-07-1934.
131 The role of RelA (p65) threonine 505 phosphorylation in the regulation of cell growth, survival, and migration. Mol Biol Cell. 2011 Sep;22(17):3032-40. doi: 10.1091/mbc.E11-04-0280. Epub 2011 Jul 7.