Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DES5XRU)

DME Name Cytochrome P450 2C8 (CYP2C8)
Synonyms Cytochrome P450 family 2 subfamily C member 8; Cytochrome P450 IIC2; Cytochrome P450 MP-12; Cytochrome P450 MP-20; Cytochrome P450 form 1; S-mephenytoin 4-hydroxylase; CYP2C8; CYPIIC8
Gene Name CYP2C8
UniProt ID
CP2C8_HUMAN
INTEDE ID
DME0018
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
1558
EC Number EC: 1.14.14.1
Oxidoreductase
Oxygen paired donor oxidoreductase
Flavin/flavoprotein donor oxidoreductase
EC: 1.14.14.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MEPFVVLVLCLSFMLLFSLWRQSCRRRKLPPGPTPLPIIGNMLQIDVKDICKSFTNFSKV
YGPVFTVYFGMNPIVVFHGYEAVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRW
KEIRRFSLTTLRNFGMGKRSIEDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICS
VVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALT
RSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTE
TTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSD
LVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFK
KSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLP
PSYQICFIPV
Function
This enzyme is involved in the metabolism of various endogenous substrates, including fatty acids, steroid hormones and vitamins. It primarily catalyzes the epoxidation of double bonds of polyunsaturated fatty acids (PUFA) with a preference for the last double bond and catalyzes the hydroxylation of carbon-hydrogen bonds. It also metabolizes all trans-retinoic acid toward its 4-hydroxylated form and displays 16-alpha hydroxylase activity toward estrogen steroid hormones, 17beta-estradiol (E2) and estrone (E1). In addition, it plays a role in the oxidative metabolism of xenobiotics. It is the principal enzyme responsible for the metabolism of the anti-cancer drug paclitaxel (taxol).
KEGG Pathway
Arachidonic acid metabolism (hsa00590 )
Chemical carcinogenesis (hsa05204 )
Drug metabolism - cytochrome P450 (hsa00982 )
Linoleic acid metabolism (hsa00591 )
Metabolic pathways (hsa01100 )
Retinol metabolism (hsa00830 )
Serotonergic synapse (hsa04726 )
Reactome Pathway
CYP2E1 reactions (R-HSA-211999 )
Synthesis of (16-20)-hydroxyeicosatetraenoic acids (HETE) (R-HSA-2142816 )
Synthesis of epoxy (EET) and dihydroxyeicosatrienoic acids (DHET) (R-HSA-2142670 )
Xenobiotics (R-HSA-211981 )
Biosynthesis of maresin-like SPMs (R-HSA-9027307 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
128 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Almotriptan malate DMFG5ST Migraine 8A80 Approved [1]
Amiodarone DMUTEX3 Tachyarrhythmias BC71 Approved [2]
Amitriptyline DMK7F9S Depression 6A70-6A7Z Approved [3]
Amodiaquine DME4RA8 Malaria 1F40-1F45 Approved [4]
Anastrozole DMNP60F Breast cancer 2C60-2C65 Approved [5]
Apixaban DM89JLN Thrombosis DB61-GB90 Approved [6]
Arn-509 DMT81LZ Acute myeloid leukaemia 2A60 Approved [7]
Atorvastatin DMF28YC Cardiovascular disease BA00-BE2Z Approved [8]
Azelastine DMXTMBJ Allergic conjunctivitis 9A60.02 Approved [9]
Benzyl alcohol DMBVYDI Head and body lice 1G00.0 Approved [10]
Brigatinib DM7W94S Anaplastic large cell lymphoma 2A90.A Approved [11]
Bromfenac DMKB79O Postoperative inflammation 1A00-CA43.1 Approved [12]
Buprenorphine DMPRI8G Pain MG30-MG3Z Approved [13]
Cabazitaxel DMPAZHC Breast cancer 2C60-2C65 Approved [14]
Caffeine DMKBJWP Orthostatic hypotension BA21 Approved [15]
Capsaicin DMGMF6V Neuropathic pain 8E43.0 Approved [16]
Carbamazepine DMZOLBI Epilepsy 8A60-8A68 Approved [17]
Celecoxib DM6LOQU Rheumatoid arthritis FA20 Approved [18]
Cerivastatin DMXCM7H Hyperlipidaemia 5C80 Approved [8]
Chloroquine DMSI5CB Malaria 1F40-1F45 Approved [19]
Cisapride DMY7PED Gastroesophageal reflux disease DA22.Z Approved [20]
Clozapine DMFC71L Schizophrenia 6A20 Approved [21]
Cyclophosphamide DM4O2Z7 Solid tumour/cancer 2A00-2F9Z Approved [22]
Dabrafenib DMX6OE3 Melanoma 2C30 Approved [8]
Dapsone DM4LT8A Pneumocystis pneumonia CA40.20 Approved [23]
Desloratadine DM56YN7 Allergic rhinitis CA08.0 Approved [24]
Dexibuprofen DMFYBD0 Ankylosing spondylitis FA92.0 Approved [25]
Diazepam DM08E9O Epilepsy 8A60-8A68 Approved [26]
Diclofenac DMPIHLS Osteoarthritis FA00-FA05 Approved [27]
Diethylstilbestrol DMN3UXQ Gonorrheal vaginitis GA02 Approved [28]
Diltiazem DMAI7ZV Hypertension BA00-BA04 Approved [29]
Domperidone DMBDPY0 Gastrointestinal disease DE2Z Approved [30]
Eltrombopag DMOGFIX Thrombocytopenia 3B64 Approved [31]
Enasidenib DM8QXOC Acute myeloid leukaemia 2A60 Approved [32]
Estradiol DMUNTE3 Breast cancer 2C60-2C65 Approved [8]
Estradiol acetate DM07U2A Hormone replacement therapy 8E01 Approved [8]
Estradiol cypionate DM27Z5T Hormone replacement therapy 8E01 Approved [33]
Estradiol valerate DM8MC6O Hormone replacement therapy 8E01 Approved [33]
Eszopiclone DM8RZ9H Insomnia 7A00-7A0Z Approved [34]
Ethinyl estradiol DMODJ40 Female hypogonadism GA30.6 Approved [35]
Fluorouracil DMUM7HZ Solid tumour/cancer 2A00-2F9Z Approved [36]
Fluvastatin DM4MDJY Hypercholesterolaemia 5C80.0 Approved [37]
Halofantrine DMOMK1V Malaria 1F40-1F45 Approved [38]
Ibuprofen DM8VCBE Pain MG30-MG3Z Approved [25]
Ifosfamide DMCT3I8 Solid tumour/cancer 2A00-2F9Z Approved [22]
Imatinib DM7RJXL Acute lymphoblastic leukaemia 2A85 Approved [8]
Irbesartan DMTP1DC Hypertension BA00-BA04 Approved [35]
Istradefylline DM20VSK Parkinson disease 8A00.0 Approved [39]
Ketobemidone DMM3L6Z Pain MG30-MG3Z Approved [40]
Ketorolac DMI4EL5 Postoperative inflammation 1A00-CA43.1 Approved [41]
Lansoprazole DMXYLQ3 Duodenal ulcer DA63 Approved [42]
Lapatinib DM3BH1Y Breast cancer 2C60-2C65 Approved [43]
Levomilnacipran DMV26S8 Fibromyalgia MG30.01 Approved [44]
Lidocaine DML4ZOT Anaesthesia 9A78.6 Approved [45]
Lobeglitazone DMHY3IP Type-2 diabetes 5A11 Approved [46]
Loperamide DMOJZQ9 Diarrhea ME05.1 Approved [47]
Loratadine DMF3AN7 Allergy 4A80-4A85 Approved [8]
Lorlatinib DMICDLV Non-small-cell lung cancer 2C25.Y Approved [48]
Losartan DM72JXH Hypertension BA00-BA04 Approved [49]
Lovastatin DM9OZWQ Hypercholesterolaemia 5C80.0 Approved [50]
Mefenamic acid DMK7HFI Dysmenorrhea GA34.3 Approved [8]
Meloxicam DM2AR7L Arthritis FA20 Approved [51]
Mephenytoin DM5UGDK Epilepsy 8A60-8A68 Approved [52]
Mestranol DMG3F94 Contraception QA21 Approved [53]
Methadone DMTW6IU Dry cough MD12 Approved [54]
Mirtazapine DML53ZJ Depression 6A70-6A7Z Approved [45]
MLN9708 DMCMETN Amyloidosis 5D00 Approved [55]
Montelukast DMD157S Asthma CA23 Approved [56]
Morphine DMRMS0L Chronic pain MG30 Approved [57]
Mycophenolate mofetil DMPQAGE Organ transplant rejection NE84 Approved [58]
Naproxen DMZ5RGV Osteoarthritis FA00-FA05 Approved [59]
Nicardipine DMCDYW7 High blood pressure BA00 Approved [45]
Nicotine DMWX5CO Nicotine dependence 6C4A.2 Approved [60]
Nilotinib DM7HXWT Chronic myelogenous leukaemia 2A20.0 Approved [8]
Omeprazole DM471KJ Gastroesophageal reflux disease DA22.Z Approved [61]
Pazopanib DMF57DM Renal cell carcinoma 2C90 Approved [62]
Pentamidine DMHZJCG Fungal infection 1F29-1F2F Approved [63]
Perospirone DMVHJLX Psychotic disorder 6A20-6A25 Approved [64]
Perphenazine DMA4MRX Schizophrenia 6A20 Approved [65]
PF-04449913 DMSB068 Chronic myelomonocytic leukaemia 2A40 Approved [66]
Phenobarbital DMXZOCG Seizure disorder 8A6Z Approved [67]
Phenprocoumon DMDO279 Thrombosis DB61-GB90 Approved [68]
Phenytoin DMNOKBV Epilepsy 8A60-8A68 Approved [45]
Pioglitazone DMKJ485 Diabetic complication 5A2Y Approved [69]
Piroxicam DMTK234 Pain MG30-MG3Z Approved [70]
Pitavastatin calcium DM1UJO0 Dyslipidemia 5C80-5C81 Approved [71]
Propofol DMB4OLE Anaesthesia 9A78.6 Approved [72]
Quinidine DMLPICK Tachyarrhythmias BC71 Approved [8]
Quinine DMSWYF5 Malaria 1F40-1F45 Approved [8]
Repaglinide DM5SXUV Diabetic complication 5A2Y Approved [73]
Riociguat DMXBLMP Pulmonary arterial hypertension BB01.0 Approved [74]
Rofecoxib DM3P5DA Osteoarthritis FA00-FA05 Approved [8]
Rosiglitazone DMY6EAO Type-2 diabetes 5A11 Approved [75]
Selegiline hydrochloride DM3VR1L Parkinson disease 8A00.0 Approved [76]
Selexipag DMAHSU0 Pulmonary arterial hypertension BB01.0 Approved [77]
Simvastatin DM30SGU Hypercholesterolaemia 5C80.0 Approved [78]
Sitagliptin DMGDKXN Type-2 diabetes 5A11 Approved [79]
Sorafenib DMS8IFC Hepatocellular carcinoma 2C12.02 Approved [80]
Sulfadiazine DMTW3R8 Rheumatic fever 1B40-1B42 Approved [81]
Sulfamethoxazole DMB08GE Bacterial infection 1A00-1C4Z Approved [82]
Sulfinpyrazone DMEV954 Gout FA25 Approved [45]
Tazarotene DM8SMD1 Psoriasis vulgaris EA90 Approved [83]
Tegafur DM31ZQM Solid tumour/cancer 2A00-2F9Z Approved [36]
Temazepam DM02A65 Insomnia 7A00-7A0Z Approved [84]
Terbinafine DMI6HUW Fungal infection 1F29-1F2F Approved [34]
Testosterone cypionate DMC1TEV Testosterone deficiency 5A81.1 Approved [8]
Testosterone enanthate DMB6871 Testosterone deficiency 5A81.1 Approved [8]
Testosterone Undecanoate DMZO10Y Hypogonadism 5A61.0 Approved [8]
Thalidomide DM70BU5 Multiple myeloma 2A83 Approved [85]
Tolbutamide DM02AWV Non-insulin dependent diabetes 5A11 Approved [86]
Torasemide DMXKJ6C Congestive heart failure BD10 Approved [87]
Treprostinil DMTIQF3 Pulmonary arterial hypertension BB01.0 Approved [88]
Tretinoin DM49DUI Acne vulgaris ED80 Approved [89]
Trifarotene DMOL793 Acne vulgaris ED80 Approved [90]
Trimethadione DM0Q8MZ Epilepsy 8A60-8A68 Approved [91]
Trimethoprim DMM7CHK Urinary tract infection GC08 Approved [92]
Troglitazone DM3VFPD Diabetic complication 5A2Y Approved [93]
Velpatasvir DMGF8ZQ Hepatitis virus infection 1E50-1E51 Approved [94]
Verapamil DMA7PEW Hypertension BA00-BA04 Approved [95]
Vitamin A DMJ2AH4 Night blindness 9D45 Approved [96]
Vortioxetine DM6F1PU Major depressive disorder 6A70.3 Approved [97]
Voxilaprevir DMAI83D Hepatitis virus infection 1E50-1E51 Approved [98]
Warfarin DMJYCVW Atrial fibrillation BC81.3 Approved [59]
Zafirlukast DMHNQOG Asthma CA23 Approved [92]
Zidovudine DM4KI7O Human immunodeficiency virus infection 1C62 Approved [45]
Zopiclone DMPI6Z0 Insomnia 7A00-7A0Z Approved [99]
Aminophenazone DMY2AH1 Anaesthesia 9A78.6 Phase 4 [100]
Beraprost DML634R Influenza virus infection 1E30-1E32 Phase 4 [101]
⏷ Show the Full List of 128 Approved Drug(s)
19 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
ABT-267 DMNQ869 Hepatitis C virus infection 1E51.1 Phase 3 [102]
Balaglitazone DMXBHR6 Type-1 diabetes 5A10 Phase 3 [46]
Cinitapride DMEGFYD Functional dyspepsia DD90.3 Phase 3 [103]
Evacetrapib DMCDZ15 Cardiovascular disease BA00-BE2Z Phase 3 [104]
Fenretinide DMRD5SP Macular degeneration 9B78.3 Phase 3 [105]
GSK1278863 DMRNGD2 Anaemia 3A90 Phase 3 [106]
Karenitecin DMCRGY4 Lung cancer 2C25.0 Phase 3 [107]
Momelotinib DMF98Q0 Myelofibrosis 2A20.2 Phase 3 [108]
Muraglitazar DMG3NFZ N. A. N. A. Phase 3 [109]
Odanacatib DM1EO3G Osteoporosis FB83.0 Phase 3 [110]
Rivoglitazone DMBY31K Ocular inflammation 9C61.24 Phase 3 [111]
QLT-091001 DMZI4OV Atopic dermatitis EA80 Phase 2/3 [96]
Sarizotan DMH7IPW Rett syndrome LD90.4 Phase 2/3 [112]
Azd2014 DMOEARH Solid tumour/cancer 2A00-2F9Z Phase 2 [113]
Cenicriviroc DM4V8WF Human immunodeficiency virus infection 1C62 Phase 2 [114]
H3B-6545 DMIFCY2 Breast cancer 2C60-2C65 Phase 1/2 [115]
ABT-333 DM7TOWX Hepatitis C virus infection 1E51.1 Phase 1 [116]
Azd9496 DMPMDTH Breast cancer 2C60-2C65 Phase 1 [117]
Capravirine DM9ERH1 Human immunodeficiency virus infection 1C62 Phase 1 [118]
⏷ Show the Full List of 19 Clinical Trial Drug(s)
4 Discontinued Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Cephaloridine DM4Y95F Gram-positive bacterial infection 1B74-1G40 Withdrawn from market [119]
Aleglitazar DMTG18I Type-2 diabetes 5A11 Discontinued in Phase 3 [120]
Seratrodast DMPNTDL Allergic asthma CA23.0 Discontinued in Phase 3 [121]
Licofelone DM7HLFD Osteoarthritis FA00-FA05 Discontinued in Phase 1 [34]
1 Preclinical Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Ciglitazone DMAPO0T Pulmonary fibrosis CB03.4 Preclinical [46]
3 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Cyamemazine DMZ6YPV Discovery agent N.A. Investigative [122]
Paraoxon DMN4ZKC Discovery agent N.A. Investigative [123]
Phenazone DMCE985 Discovery agent N.A. Investigative [34]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 6.69E-07 4.42E-03 4.31E-02
Alopecia ED70 Skin from scalp 3.37E-02 1.39E-01 5.78E-01
Alzheimer's disease 8A20 Entorhinal cortex 1.82E-04 -1.35E-01 -5.84E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 6.98E-01 2.18E-04 2.03E-03
Aortic stenosis BB70 Calcified aortic valve 9.40E-01 -1.68E-02 -3.18E-02
Apnea 7A40 Hyperplastic tonsil 8.00E-02 -5.54E-02 -3.69E-01
Arthropathy FA00-FA5Z Peripheral blood 8.17E-01 -2.55E-02 -1.87E-01
Asthma CA23 Nasal and bronchial airway 2.93E-03 -2.19E-01 -4.49E-01
Atopic dermatitis EA80 Skin 5.96E-04 9.62E-02 8.89E-01
Autism 6A02 Whole blood 8.53E-01 -3.07E-02 -2.20E-01
Autoimmune uveitis 9A96 Peripheral monocyte 2.86E-02 -7.09E-02 -1.19E+00
Autosomal dominant monocytopenia 4B04 Whole blood 8.46E-01 2.44E-02 2.39E-01
Bacterial infection of gingival 1C1H Gingival tissue 6.65E-02 -4.48E-02 -3.36E-01
Batten disease 5C56.1 Whole blood 9.38E-01 1.89E-02 1.52E-01
Behcet's disease 4A62 Peripheral blood 2.73E-01 4.16E-02 2.75E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.07E-01 3.97E-02 1.59E-01
Bladder cancer 2C94 Bladder tissue 7.15E-03 1.83E-01 9.23E-01
Breast cancer 2C60-2C6Z Breast tissue 5.08E-07 -1.25E-02 -6.37E-02
Cardioembolic stroke 8B11.20 Whole blood 7.71E-01 8.39E-03 3.95E-02
Cervical cancer 2C77 Cervical tissue 6.86E-01 -5.49E-02 -2.79E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 6.66E-01 2.12E-02 2.25E-01
Chronic hepatitis C 1E51.1 Whole blood 2.25E-01 -7.20E-02 -3.91E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 2.41E-01 3.17E-02 2.29E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 5.67E-01 5.11E-02 1.35E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.16E-01 5.43E-02 1.44E-01
Colon cancer 2B90 Colon tissue 2.66E-04 -1.21E-01 -5.72E-01
Coronary artery disease BA80-BA8Z Peripheral blood 3.39E-01 5.91E-02 4.05E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 6.40E-02 1.71E-01 1.15E+00
Endometriosis GA10 Endometrium tissue 7.97E-02 -4.55E-02 -3.54E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 6.28E-01 1.37E-02 1.60E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.47E-02 -1.13E-01 -1.13E+00
Gastric cancer 2B72 Gastric tissue 2.23E-01 -1.33E+00 -1.24E+00
Glioblastopma 2A00.00 Nervous tissue 9.91E-19 -2.17E-01 -5.99E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 6.52E-01 -3.60E-01 -6.10E-01
Glioma 2A00.0Y-2A00.0Z White matter tissue 2.60E-01 -3.65E-02 -2.54E-01
Head and neck cancer 2D42 Head and neck tissue 2.90E-11 -1.06E-01 -1.42E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 6.78E-01 9.78E-03 5.42E-02
Huntington's disease 8A01.10 Whole blood 5.93E-01 3.65E-03 3.43E-02
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 9.63E-01 1.10E-01 2.91E-01
Immunodeficiency 4A00-4A20 Peripheral blood 1.03E-01 6.81E-03 7.23E-02
Influenza 1E30 Whole blood 1.60E-01 6.49E-02 5.99E-01
Interstitial cystitis GC00.3 Bladder tissue 4.00E-01 -2.09E-02 -1.50E-01
Intracranial aneurysm 8B01.0 Intracranial artery 4.08E-03 1.81E-01 1.97E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 9.41E-02 8.09E-02 3.46E-01
Ischemic stroke 8B11 Peripheral blood 3.38E-02 4.92E-02 6.31E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.81E-01 5.13E-02 2.10E-01
Lateral sclerosis 8B60.4 Skin 1.14E-01 7.49E-02 1.11E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 5.03E-01 -2.08E-03 -9.42E-03
Liver cancer 2C12.0 Liver tissue 1.82E-30 -1.89E+00 -2.75E+00
Liver failure DB99.7-DB99.8 Liver tissue 3.77E-03 -1.94E+00 -8.02E+00
Lung cancer 2C25 Lung tissue 5.28E-05 1.90E-02 1.09E-01
Lupus erythematosus 4A40 Whole blood 2.14E-01 -4.97E-02 -1.73E-01
Major depressive disorder 6A70-6A7Z Hippocampus 3.17E-01 -6.95E-02 -2.88E-01
Major depressive disorder 6A70-6A7Z Whole blood 1.38E-01 -3.36E-04 -2.09E-03
Melanoma 2C30 Skin 8.32E-01 -3.32E-02 -1.47E-01
Multiple myeloma 2A83.1 Peripheral blood 7.83E-01 2.87E-03 6.52E-02
Multiple myeloma 2A83.1 Bone marrow 5.86E-02 -1.69E-01 -8.79E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.78E-01 -3.38E-03 -5.71E-02
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 3.53E-02 6.59E-02 3.19E-01
Myelofibrosis 2A20.2 Whole blood 3.34E-04 1.21E-01 1.86E+00
Myocardial infarction BA41-BA50 Peripheral blood 8.39E-02 1.07E-01 3.94E-01
Myopathy 8C70.6 Muscle tissue 5.98E-01 -1.02E-01 -6.90E-01
Neonatal sepsis KA60 Whole blood 1.36E-02 -1.84E-02 -1.77E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.68E-01 -1.36E-01 -8.23E-01
Non-alcoholic fatty liver disease DB92 Liver tissue 4.31E-01 -2.72E-02 -4.58E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 7.09E-01 4.31E-02 5.74E-01
Olive pollen allergy CA08.00 Peripheral blood 8.34E-01 -1.61E-02 -1.81E-01
Oral cancer 2B6E Oral tissue 2.73E-01 -6.13E-02 -3.28E-01
Osteoarthritis FA00-FA0Z Synovial tissue 8.71E-01 -6.68E-03 -3.03E-02
Osteoporosis FB83.1 Bone marrow 1.23E-01 4.59E-02 6.37E-01
Ovarian cancer 2C73 Ovarian tissue 1.13E-01 6.17E-02 2.28E-01
Pancreatic cancer 2C10 Pancreas 2.25E-02 -6.67E-01 -6.53E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 5.57E-01 -7.89E-02 -7.93E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.81E-01 -2.18E-02 -1.84E-01
Pituitary cancer 2D12 Pituitary tissue 6.90E-01 -1.23E-01 -4.33E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.39E-01 4.85E-01 1.63E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 7.04E-01 -4.02E-03 -2.88E-02
Polycythemia vera 2A20.4 Whole blood 3.82E-10 8.78E-02 1.41E+00
Pompe disease 5C51.3 Biceps muscle 3.45E-03 -9.40E-02 -1.00E+00
Preterm birth KA21.4Z Myometrium 7.88E-01 1.19E-02 9.16E-02
Prostate cancer 2C82 Prostate 5.27E-01 -1.74E-02 -6.97E-02
Psoriasis EA90 Skin 4.73E-03 3.91E-02 2.20E-01
Rectal cancer 2B92 Rectal colon tissue 1.51E-01 -1.41E-01 -8.46E-01
Renal cancer 2C90-2C91 Kidney 1.73E-04 1.53E-01 7.44E-01
Retinoblastoma 2D02.2 Uvea 3.09E-09 -1.53E+00 -4.40E+00
Rheumatoid arthritis FA20 Synovial tissue 7.62E-02 -1.65E-01 -6.38E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.43E-01 -6.22E-02 -3.13E-01
Schizophrenia 6A20 Prefrontal cortex 1.94E-01 -1.03E-01 -3.08E-01
Schizophrenia 6A20 Superior temporal cortex 7.37E-02 9.49E-02 8.07E-01
Scleroderma 4A42.Z Whole blood 2.56E-01 7.80E-03 9.30E-02
Seizure 8A60-8A6Z Whole blood 4.57E-01 6.95E-02 3.56E-01
Sensitive skin EK0Z Skin 6.18E-01 3.82E-02 5.52E-01
Sepsis with septic shock 1G41 Whole blood 4.18E-03 3.05E-02 2.48E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 6.03E-01 7.61E-02 6.10E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 3.71E-02 1.03E-01 7.57E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 3.18E-01 -4.49E-03 -3.72E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 8.93E-01 4.14E-02 2.77E-01
Skin cancer 2C30-2C3Z Skin 1.07E-10 1.05E-01 5.98E-01
Thrombocythemia 3B63 Whole blood 3.60E-03 6.33E-02 9.75E-01
Thrombocytopenia 3B64 Whole blood 4.83E-01 3.92E-02 2.84E-01
Thyroid cancer 2D10 Thyroid 6.39E-01 -5.46E-02 -2.77E-01
Tibial muscular dystrophy 8C75 Muscle tissue 4.13E-02 -4.37E-02 -3.73E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 5.00E-01 -6.51E-03 -3.20E-02
Type 2 diabetes 5A11 Liver tissue 4.79E-01 -1.88E-02 -1.73E-01
Ureter cancer 2C92 Urothelium 5.65E-01 2.72E-02 2.78E-01
Uterine cancer 2C78 Endometrium tissue 2.03E-01 -6.96E-02 -3.05E-01
Vitiligo ED63.0 Skin 5.34E-01 -7.52E-02 -5.09E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

References

1 Identification of the human liver enzymes involved in the metabolism of the antimigraine agent almotriptan. Drug Metab Dispos. 2003 Apr;31(4):404-11.
2 Functional characterization of five novel CYP2C8 variants, G171S, R186X, R186G, K247R, and K383N, found in a Japanese population. Drug Metab Dispos. 2005 May;33(5):630-6.
3 The xenobiotic inhibitor profile of cytochrome P4502C8. Br J Clin Pharmacol. 2000 Dec;50(6):573-80.
4 Amodiaquine metabolism is impaired by common polymorphisms in CYP2C8: implications for malaria treatment in Africa. Clin Pharmacol Ther. 2007 Aug;82(2):197-203.
5 In vitro and in vivo oxidative metabolism and glucuronidation of anastrozole. Br J Clin Pharmacol. 2010 Dec;70(6):854-69.
6 Apixaban. Hosp Pharm. 2013 Jun;48(6):494-509.
7 Apalutamide: first global approval. Drugs. 2018 Apr;78(6):699-705.
8 Role of cytochrome P450 2C8 in drug metabolism and interactions. Pharmacol Rev. 2016 Jan;68(1):168-241.
9 Azelastine N-demethylation by cytochrome P-450 (CYP)3A4, CYP2D6, and CYP1A2 in human liver microsomes: evaluation of approach to predict the contribution of multiple CYPs. Drug Metab Dispos. 1999 Dec;27(12):1381-91.
10 Cytochrome P450 isozymes responsible for the metabolism of toluene and styrene in human liver microsomes. Xenobiotica. 1997 Jul;27(7):657-65.
11 Brigatinib: first global approval. Drugs. 2017 Jul;77(10):1131-1135.
12 Metabolite profiling and reaction phenotyping for the in vitro assessment of the bioactivation of bromfenac. Chem Res Toxicol. 2020 Jan 21;33(1):249-257.
13 Buprenorphine in cancer pain. Support Care Cancer. 2005 Nov;13(11):878-87.
14 DAILYMED.nlm.nih.gov: JEVTANA- cabazitaxel kit.
15 PharmGKB summary: caffeine pathway. Pharmacogenet Genomics. 2012 May;22(5):389-95.
16 Metabolism of capsaicin by cytochrome P450 produces novel dehydrogenated metabolites and decreases cytotoxicity to lung and liver cells. Chem Res Toxicol. 2003 Mar;16(3):336-49.
17 Potential interaction between ritonavir and carbamazepine. Pharmacotherapy. 2000 Jul;20(7):851-4.
18 Cytochrome P450 2C8 pharmacogenetics: a review of clinical studies. Pharmacogenomics. 2009 Sep;10(9):1489-510.
19 Short communication: high prevalence of the cytochrome P450 2C8*2 mutation in Northern Ghana. Trop Med Int Health. 2005 Dec;10(12):1271-3.
20 Interaction of cisapride with the human cytochrome P450 system: metabolism and inhibition studies. Drug Metab Dispos. 2000 Jul;28(7):789-800.
21 Elucidation of individual cytochrome P450 enzymes involved in the metabolism of clozapine. Naunyn Schmiedebergs Arch Pharmacol. 1998 Nov;358(5):592-9.
22 Enhanced cyclophosphamide and ifosfamide activation in primary human hepatocyte cultures: response to cytochrome P-450 inducers and autoinduction by oxazaphosphorines. Cancer Res. 1997 May 15;57(10):1946-54.
23 CYP2C8/9 mediate dapsone N-hydroxylation at clinical concentrations of dapsone. Drug Metab Dispos. 2000 Aug;28(8):865-8.
24 Further characterization of the metabolism of desloratadine and its cytochrome P450 and UDP-glucuronosyltransferase inhibition potential: identification of desloratadine as a relatively selective UGT2B10 inhibitor. Drug Metab Dispos. 2015 Sep;43(9):1294-302.
25 Influence of CYP2C8 polymorphisms on the hydroxylation metabolism of paclitaxel, repaglinide and ibuprofen enantiomers in vitro. Biopharm Drug Dispos. 2013 Jul;34(5):278-87.
26 Use of inhibitory monoclonal antibodies to assess the contribution of cytochromes P450 to human drug metabolism. Eur J Pharmacol. 2000 Apr 14;394(2-3):199-209.
27 Analysis of human cytochrome P450 2C8 substrate specificity using a substrate pharmacophore and site-directed mutants. Biochemistry. 2004 Dec 14;43(49):15379-92.
28 Reversible inhibition of four important human liver cytochrome P450 enzymes by diethylstilbestrol. Pharmazie. 2011 Mar;66(3):216-21.
29 Role of CYP3A4 in human hepatic diltiazem N-demethylation: inhibition of CYP3A4 activity by oxidized diltiazem metabolites. J Pharmacol Exp Ther. 1997 Jul;282(1):294-300.
30 Characterization of human cytochrome P450 enzymes catalyzing domperidone N-dealkylation and hydroxylation in vitro. Br J Clin Pharmacol. 2004 Sep;58(3):277-87.
31 Eltrombopag-induced acute liver failure in a pediatric patient: a pharmacokinetic and pharmacogenetic analysis. Ther Drug Monit. 2018 Aug;40(4):386-388.
32 FDA Label of Enasidenib. The 2020 official website of the U.S. Food and Drug Administration.
33 Role of cytochrome P450 in estradiol metabolism in vitro. Acta Pharmacol Sin. 2001 Feb;22(2):148-54.
34 Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development. Curr Med Chem. 2009;16(27):3480-675.
35 Examination of 209 drugs for inhibition of cytochrome P450 2C8. J Clin Pharmacol. 2005 Jan;45(1):68-78.
36 Roles of cytochromes P450 1A2, 2A6, and 2C8 in 5-fluorouracil formation from tegafur, an anticancer prodrug, in human liver microsomes. Drug Metab Dispos. 2000 Dec;28(12):1457-63.
37 Comparison of 3-hydroxy-3-methylglutaryl coenzyme A (HMG-CoA) reductase inhibitors (statins) as inhibitors of cytochrome P450 2C8. Basic Clin Pharmacol Toxicol. 2005 Aug;97(2):104-8.
38 Halofantrine metabolism in microsomes in man: major role of CYP 3A4 and CYP 3A5. J Pharm Pharmacol. 1999 Apr;51(4):419-26.
39 Effects of rifampin on the pharmacokinetics of a single dose of istradefylline in healthy subjects. J Clin Pharmacol. 2018 Feb;58(2):193-201.
40 Ketobemidone is a substrate for cytochrome P4502C9 and 3A4, but not for P-glycoprotein. Xenobiotica. 2005 Aug;35(8):785-96.
41 Body weight, gender and pregnancy affect enantiomer-specific ketorolac pharmacokinetics. Br J Clin Pharmacol. 2017 Sep;83(9):1966-1975.
42 Identification of the human P450 enzymes involved in lansoprazole metabolism. J Pharmacol Exp Ther. 1996 May;277(2):805-16.
43 Mechanism-based inactivation of cytochrome P450 3A4 by lapatinib. Mol Pharmacol. 2010 Oct;78(4):693-703.
44 The role of levomilnacipran in the management of major depressive disorder: a comprehensive review. Curr Neuropharmacol. 2016;14(2):191-9.
45 Summary of information on human CYP enzymes: human P450 metabolism data. Drug Metab Rev. 2002 Feb-May;34(1-2):83-448.
46 Effects of gemfibrozil, itraconazole, and their combination on the pharmacokinetics of pioglitazone. Clin Pharmacol Ther. 2005 May;77(5):404-14.
47 Identification of cytochrome P450 isoforms involved in the metabolism of loperamide in human liver microsomes. Eur J Clin Pharmacol. 2004 Oct;60(8):575-81.
48 FDA label of Lorlatinib. The 2020 official website of the U.S. Food and Drug Administration.
49 Drug-drug interaction between losartan and paclitaxel in human liver microsomes with different CYP2C8 genotypes. Basic Clin Pharmacol Toxicol. 2015 Jun;116(6):493-8.
50 Pharmacogenomics of statins: understanding susceptibility to adverse effects. Pharmgenomics Pers Med. 2016 Oct 3;9:97-106.
51 Genetically based impairment in CYP2C8- and CYP2C9-dependent NSAID metabolism as a risk factor for gastrointestinal bleeding: is a combination of pharmacogenomics and metabolomics required to improve personalized medicine? Expert Opin Drug Metab Toxicol. 2009 Jun;5(6):607-20.
52 Evidence that CYP2C19 is the major (S)-mephenytoin 4'-hydroxylase in humans. Biochemistry. 1994 Feb 22;33(7):1743-52.
53 Loss of orally administered drugs in GI tract. Saudi Pharm J. 2012 Oct;20(4):331-44.
54 Methadone metabolism and drug-drug interactions: in vitro and in vivo literature review. J Pharm Sci. 2018 Dec;107(12):2983-2991.
55 Ninlaro- European Medicines Agency - European Union
56 Determinants of cytochrome P450 2C8 substrate binding: structures of complexes with montelukast, troglitazone, felodipine, and 9-cis-retinoic acid. J Biol Chem. 2008 Jun 20;283(25):17227-37.
57 In vitro metabolism study of buprenorphine: evidence for new metabolic pathways. Drug Metab Dispos. 2005 May;33(5):689-95.
58 PharmGKB summary: mycophenolic acid pathway. Pharmacogenet Genomics. 2014 Jan;24(1):73-9.
59 Involvement of multiple cytochrome P450 isoforms in naproxen O-demethylation. Eur J Clin Pharmacol. 1997;52(4):293-8.
60 Roles of CYP2A6 and CYP2B6 in nicotine C-oxidation by human liver microsomes. Arch Toxicol. 1999 Mar;73(2):65-70.
61 Human CYP2C19 is a major omeprazole 5-hydroxylase, as demonstrated with recombinant cytochrome P450 enzymes. Drug Metab Dispos. 1996 Oct;24(10):1081-7.
62 Pazopanib, a new therapy for metastatic soft tissue sarcoma. Expert Opin Pharmacother. 2013 May;14(7):929-35.
63 Identification of human cytochrome P(450)s that metabolise anti-parasitic drugs and predictions of in vivo drug hepatic clearance from in vitro data. Eur J Clin Pharmacol. 2003 Sep;59(5-6):429-42.
64 Steady-state pharmacokinetics of a new antipsychotic agent perospirone and its active metabolite, and its relationship with prolactin response. Ther Drug Monit. 2004 Aug;26(4):361-5.
65 Identification of the human cytochrome P450 isoforms mediating in vitro N-dealkylation of perphenazine. Br J Clin Pharmacol. 2000 Dec;50(6):563-71.
66 Metabolism, excretion and pharmacokinetics of [14C]glasdegib (PF-04449913) in healthy volunteers following oral administration. Xenobiotica. 2017 Dec;47(12):1064-1076.
67 Colchicine down-regulates cytochrome P450 2B6, 2C8, 2C9, and 3A4 in human hepatocytes by affecting their glucocorticoid receptor-mediated regulation. Mol Pharmacol. 2003 Jul;64(1):160-9.
68 Identification of cytochromes P450 2C9 and 3A4 as the major catalysts of phenprocoumon hydroxylation in vitro. Eur J Clin Pharmacol. 2004 May;60(3):173-82.
69 The role of human CYP2C8 and CYP2C9 variants in pioglitazone metabolism in vitro. Basic Clin Pharmacol Toxicol. 2009 Dec;105(6):374-9.
70 Efficacy of piroxicam for postoperative pain after lower third molar surgery associated with CYP2C8*3 and CYP2C9 J Pain Res. 2017 Jul 6;10:1581-1589.
71 Comparison of the safety, tolerability, and pharmacokinetic profile of a single oral dose of pitavastatin 4 mg in adult subjects with severe renal impairment not on hemodialysis versus healthy adult subjects. J Cardiovasc Pharmacol. 2012 Jul;60(1):42-8.
72 Possible involvement of multiple human cytochrome P450 isoforms in the liver metabolism of propofol. Br J Anaesth. 1998 Jun;80(6):788-95.
73 Drug-drug and food-drug pharmacokinetic interactions with new insulinotropic agents repaglinide and nateglinide. Clin Pharmacokinet. 2007;46(2):93-108.
74 Riociguat (adempas): a novel agent for the treatment of pulmonary arterial hypertension and chronic thromboembolic pulmonary hypertension. P T. 2014 Nov;39(11):749-58.
75 Characterization of the cytochrome P450 enzymes involved in the in vitro metabolism of rosiglitazone. Br J Clin Pharmacol. 1999 Sep;48(3):424-32.
76 Comparative studies on the cytochrome p450-associated metabolism and interaction potential of selegiline between human liver-derived in vitro systems. Drug Metab Dispos. 2003 Sep;31(9):1093-102.
77 FDA Label of Uptravi. The 2020 official website of the U.S. Food and Drug Administration.
78 Drug interactions with lipid-lowering drugs: mechanisms and clinical relevance. Clin Pharmacol Ther. 2006 Dec;80(6):565-81.
79 Pharmacokinetics of dipeptidylpeptidase-4 inhibitors. Diabetes Obes Metab. 2010 Aug;12(8):648-58.
80 Interaction of sorafenib and cytochrome P450 isoenzymes in patients with advanced melanoma: a phase I/II pharmacokinetic interaction study. Cancer Chemother Pharmacol. 2011 Nov;68(5):1111-8.
81 Reduction of sulfamethoxazole and dapsone hydroxylamines by a microsomal enzyme system purified from pig liver and pig and human liver microsomes. Life Sci. 2005 May 27;77(2):205-19.
82 Sulfamethoxazole and its metabolite nitroso sulfamethoxazole stimulate dendritic cell costimulatory signaling. J Immunol. 2007 May 1;178(9):5533-42.
83 Cytochrome P450 2C8 and flavin-containing monooxygenases are involved in the metabolism of tazarotenic acid in humans. Drug Metab Dispos. 2003 Apr;31(4):476-81.
84 Human liver microsomal diazepam metabolism using cDNA-expressed cytochrome P450s: role of CYP2B6, 2C19 and the 3A subfamily. Xenobiotica. 1996 Nov;26(11):1155-66.
85 Thalidomide metabolism by the CYP2C subfamily. Clin Cancer Res. 2002 Jun;8(6):1964-73.
86 Prediction of in vivo drug-drug interactions between tolbutamide and various sulfonamides in humans based on in vitro experiments. Drug Metab Dispos. 2000 Apr;28(4):475-81.
87 Mechanism-based inactivation of human cytochrome P4502C8 by drugs in vitro. J Pharmacol Exp Ther. 2004 Dec;311(3):996-1007.
88 FDA label of Treprostinil. The 2020 official website of the U.S. Food and Drug Administration.
89 Identification of human cytochrome P450s involved in the formation of all-trans-retinoic acid principal metabolites. Mol Pharmacol. 2000 Dec;58(6):1341-8.
90 FDA label of Trifarotene. The 2020 official website of the U.S. Food and Drug Administration.
91 Trimethadione metabolism by human liver cytochrome P450: evidence for the involvement of CYP2E1. Xenobiotica. 1998 Nov;28(11):1041-7.
92 Pioglitazone is metabolised by CYP2C8 and CYP3A4 in vitro: potential for interactions with CYP2C8 inhibitors. Basic Clin Pharmacol Toxicol. 2006 Jul;99(1):44-51.
93 Effect of genetic polymorphisms in cytochrome p450 (CYP) 2C9 and CYP2C8 on the pharmacokinetics of oral antidiabetic drugs: clinical relevance. Clin Pharmacokinet. 2005;44(12):1209-25.
94 FDA Label of Vosevi. The 2020 official website of the U.S. Food and Drug Administration.
95 Differential expression and function of CYP2C isoforms in human intestine and liver. Pharmacogenetics. 2003 Sep;13(9):565-75.
96 Effects of arachidonic acid, prostaglandins, retinol, retinoic acid and cholecalciferol on xenobiotic oxidations catalysed by human cytochrome P450 enzymes. Xenobiotica. 1999 Mar;29(3):231-41.
97 Identification of the cytochrome P450 and other enzymes involved in the in vitro oxidative metabolism of a novel antidepressant, Lu AA21004. Drug Metab Dispos. 2012 Jul;40(7):1357-65.
98 FDA Label of Vosevi. The 2020 official website of the U.S. Food and Drug Administration.
99 Cytochrome P-450 3A4 and 2C8 are involved in zopiclone metabolism. Drug Metab Dispos. 1999 Sep;27(9):1068-73.
100 Contribution of human hepatic cytochrome P450s and steroidogenic CYP17 to the N-demethylation of aminopyrine. Xenobiotica. 1999 Feb;29(2):187-93.
101 Evaluation of drug-drug interaction potential of beraprost sodium mediated by P450 in vitro. Yakugaku Zasshi. 2008 Oct;128(10):1459-65.
102 Metabolism and disposition of pan-genotypic inhibitor of hepatitis C virus NS5A ombitasvir in humans. Drug Metab Dispos. 2016 Aug;44(8):1148-57.
103 The prokinetic cinitapride has no clinically relevant pharmacokinetic interaction and effect on QT during coadministration with ketoconazole. Drug Metab Dispos. 2007 Jul;35(7):1149-56.
104 Identification of cytochrome P450 enzymes involved in the metabolism of 4'-methoxy-alpha-pyrrolidinopropiophenone (MOPPP), a designer drug, in human liver microsomes. Xenobiotica. 2003 Oct;33(10):989-98.
105 Characterization of the metabolism of fenretinide by human liver microsomes, cytochrome P450 enzymes and UDP-glucuronosyltransferases. Br J Pharmacol. 2011 Feb;162(4):989-99.
106 Pharmacokinetics, pharmacodynamics and safety of single, oral doses of GSK1278863, a novel HIF-prolyl hydroxylase inhibitor, in healthy Japanese and Caucasian subjects. Drug Metab Pharmacokinet. 2015 Dec;30(6):410-8.
107 Evaluation of in vitro drug interactions with karenitecin, a novel, highly lipophilic camptothecin derivative in phase II clinical development. J Clin Pharmacol. 2003 Sep;43(9):1008-14.
108 Pharmacokinetics and disposition of momelotinib revealed a disproportionate human metabolite-resolution for clinical development. Drug Metab Dispos. 2018 Mar;46(3):237-247.
109 Involvement of multiple cytochrome P450 and UDP-glucuronosyltransferase enzymes in the in vitro metabolism of muraglitazar. Drug Metab Dispos. 2007 Jan;35(1):139-49.
110 Disposition and metabolism of the cathepsin K inhibitor odanacatib in humans. Drug Metab Dispos. 2014 May;42(5):818-27.
111 In vitro metabolism of rivoglitazone, a novel peroxisome proliferator-activated receptor gama agonist, in rat, monkey, and human liver microsomes and freshly isolated hepatocytes. Drug Metab Dispos. 2011 Jul;39(7):1311-9.
112 In vitro characterization of sarizotan metabolism: hepatic clearance, identification and characterization of metabolites, drug-metabolizing enzyme identification, and evaluation of cytochrome p450 inhibition. Drug Metab Dispos. 2010 Jun;38(6):905-16.
113 First-in-human pharmacokinetic and pharmacodynamic study of the dual m-TORC 1/2 inhibitor AZD2014. Clin Cancer Res. 2015 Aug 1;21(15):3412-9.
114 Pharmacokinetics, safety, and CCR2/CCR5 antagonist activity of cenicriviroc in participants with mild or moderate hepatic impairment. Clin Transl Sci. 2016 Jun;9(3):139-48.
115 Nonclinical pharmacokinetics and in vitro metabolism of H3B-6545, a novel selective ERalpha covalent antagonist (SERCA). Cancer Chemother Pharmacol. 2019 Jan;83(1):151-160.
116 Metabolism and disposition of hepatitis C polymerase inhibitor dasabuvir in humans. Drug Metab Dispos. 2016 Aug;44(8):1139-47.
117 Complete substrate inhibition of cytochrome P450 2C8 by AZD9496, an oral selective estrogen receptor degrader. Drug Metab Dispos. 2018 Sep;46(9):1268-1276.
118 Identification of enzymes responsible for primary and sequential oxygenation reactions of capravirine in human liver microsomes. Drug Metab Dispos. 2006 Nov;34(11):1798-802.
119 Gemfibrozil and its glucuronide inhibit the organic anion transporting polypeptide 2 (OATP2/OATP1B1:SLC21A6)-mediated hepatic uptake and CYP2C8-mediated metabolism of cerivastatin: analysis of the mechanism of the clinically relevant drug-drug interaction between cerivastatin and gemfibrozil. J Pharmacol Exp Ther. 2004 Oct;311(1):228-36.
120 Exposure and response analysis of aleglitazar on cardiovascular risk markers and safety outcomes: an analysis of the AleCardio trial. Diabetes Obes Metab. 2020 Jan;22(1):30-38.
121 Identification of cytochromes P450 involved in the human liver microsomal metabolism of the thromboxane A2 inhibitor seratrodast (ABT-001). Drug Metab Dispos. 1997 Jan;25(1):110-5.
122 Characterization of human cytochrome P450 enzymes involved in the metabolism of cyamemazine. Eur J Pharm Sci. 2007 Dec;32(4-5):357-66.
123 Diazinon, chlorpyrifos and parathion are metabolised by multiple cytochromes P450 in human liver. Toxicology. 2006 Jul 5;224(1-2):22-32.