Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DES5XRU)

DME Name	Cytochrome P450 2C8 (CYP2C8)
Synonyms	Cytochrome P450 family 2 subfamily C member 8; Cytochrome P450 IIC2; Cytochrome P450 MP-12; Cytochrome P450 MP-20; Cytochrome P450 form 1; S-mephenytoin 4-hydroxylase; CYP2C8; CYPIIC8
Gene Name	CYP2C8
UniProt ID	CP2C8_HUMAN
INTEDE ID	DME0018
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Gene ID	1558
EC Number	EC: 1.14.14.1 Oxidoreductase Oxygen paired donor oxidoreductase Flavin/flavoprotein donor oxidoreductase EC: 1.14.14.1
Lineage	Species: Homo sapiens Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens
Sequence	MEPFVVLVLCLSFMLLFSLWRQSCRRRKLPPGPTPLPIIGNMLQIDVKDICKSFTNFSKV YGPVFTVYFGMNPIVVFHGYEAVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRW KEIRRFSLTTLRNFGMGKRSIEDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICS VVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALT RSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTE TTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSD LVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFK KSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLP PSYQICFIPV
Function	This enzyme is involved in the metabolism of various endogenous substrates, including fatty acids, steroid hormones and vitamins. It primarily catalyzes the epoxidation of double bonds of polyunsaturated fatty acids (PUFA) with a preference for the last double bond and catalyzes the hydroxylation of carbon-hydrogen bonds. It also metabolizes all trans-retinoic acid toward its 4-hydroxylated form and displays 16-alpha hydroxylase activity toward estrogen steroid hormones, 17beta-estradiol (E2) and estrone (E1). In addition, it plays a role in the oxidative metabolism of xenobiotics. It is the principal enzyme responsible for the metabolism of the anti-cancer drug paclitaxel (taxol).
KEGG Pathway	Arachidonic acid metabolism (hsa00590 ) Chemical carcinogenesis (hsa05204 ) Drug metabolism - cytochrome P450 (hsa00982 ) Linoleic acid metabolism (hsa00591 ) Metabolic pathways (hsa01100 ) Retinol metabolism (hsa00830 ) Serotonergic synapse (hsa04726 )
Reactome Pathway	CYP2E1 reactions (R-HSA-211999 ) Synthesis of (16-20)-hydroxyeicosatetraenoic acids (HETE) (R-HSA-2142816 ) Synthesis of epoxy (EET) and dihydroxyeicosatrienoic acids (DHET) (R-HSA-2142670 ) Xenobiotics (R-HSA-211981 ) Biosynthesis of maresin-like SPMs (R-HSA-9027307 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DME

130 Approved Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Almotriptan malate	DMFG5ST	N. A.	N. A.	Approved	[1]
Amiodarone	DMUTEX3	Tachyarrhythmias	BC71	Approved	[2]
Amitriptyline	DMK7F9S	Depression	6A70-6A7Z	Approved	[3]
Amodiaquine	DME4RA8	Malaria	1F40-1F45	Approved	[4]
Anastrozole	DMNP60F	Breast cancer	2C60-2C65	Approved	[5]
Apixaban	DM89JLN	Thrombosis	DB61-GB90	Approved	[6]
ARN-509	DMT81LZ	Acute myeloid leukaemia	2A60	Approved	[7]
Atorvastatin	DMF28YC	Acute coronary syndrome	BA41	Approved	[8]
Azelastine	DMXTMBJ	Allergic conjunctivitis	9A60.02	Approved	[9]
Benzyl alcohol	DMBVYDI	Head and body lice	1G00.0	Approved	[10]
Brigatinib	DM7W94S	Anaplastic large cell lymphoma	2A90.A	Approved	[11]
Bromfenac	DMKB79O	Pain	MG30-MG3Z	Approved	[12]
Buprenorphine	DMPRI8G	Opioid dependence	6C43.2Z	Approved	[13]
Cabazitaxel	DMPAZHC	Breast cancer	2C60-2C65	Approved	[14]
Caffeine	DMKBJWP	Allergic rhinitis	CA08.0	Approved	[15]
Capsaicin	DMGMF6V	Back pain	ME84.Z	Approved	[16]
Carbamazepine	DMZOLBI	Epilepsy	8A60-8A68	Approved	[17]
Celecoxib	DM6LOQU	Dysmenorrhea	GA34.3	Approved	[18]
Cerivastatin	DMXCM7H	Hyperlipidaemia	5C80	Approved	[8]
Chloroquine	DMSI5CB	Malaria	1F40-1F45	Approved	[19]
Cisapride	DMY7PED	Gastroesophageal reflux disease	DA22.Z	Approved	[20]
Clozapine	DMFC71L	Schizophrenia	6A20	Approved	[21]
Cyclophosphamide	DM4O2Z7	Advanced cancer	2A00-2F9Z	Approved	[22]
Dabrafenib	DMX6OE3	Melanoma	2C30	Approved	[8]
Daprodustat	DMRNGD2	Anaemia	3A90	Approved	[23]
Dapsone	DM4LT8A	Acne vulgaris	ED80	Approved	[24]
Desloratadine	DM56YN7	Allergic rhinitis	CA08.0	Approved	[25]
Dexibuprofen	DMFYBD0	Ankylosing spondylitis	FA92.0	Approved	[26]
Diazepam	DM08E9O	Alcohol withdrawal		Approved	[27]
Diclofenac	DMPIHLS	Chronic renal failure	GB61.Z	Approved	[28]
Diethylstilbestrol	DMN3UXQ	Gonorrheal vaginitis	GA02	Approved	[29]
Diltiazem	DMAI7ZV	Angina pectoris	BA40	Approved	[30]
Domperidone	DMBDPY0	Gastrointestinal disease	DE2Z	Approved	[31]
Eltrombopag	DMOGFIX	Thrombocytopenia	3B64	Approved	[32]
Enasidenib	DM8QXOC	N. A.	N. A.	Approved	[33]
Estradiol	DMUNTE3	Acne vulgaris	ED80	Approved	[8]
Estradiol Acetate	DM07U2A	Hormone replacement therapy	8E01	Approved	[8]
Estradiol Cypionate	DM27Z5T	Hormone replacement therapy	8E01	Approved	[34]
Estradiol Valerate	DM8MC6O	Hormone replacement therapy	8E01	Approved	[34]
Eszopiclone	DM8RZ9H	Insomnia	7A00-7A0Z	Approved	[35]
Ethinyl Estradiol	DMODJ40	Acne vulgaris	ED80	Approved	[36]
Fluorouracil	DMUM7HZ	Adenocarcinoma	2D40	Approved	[37]
Fluvastatin	DM4MDJY	Arteriosclerosis	BD40	Approved	[38]
Halofantrine	DMOMK1V	Malaria	1F40-1F45	Approved	[39]
Ibuprofen	DM8VCBE	Dysmenorrhea	GA34.3	Approved	[26]
Ifosfamide	DMCT3I8	Adult central nervous system germ cell tumor		Approved	[22]
Imatinib	DM7RJXL	Acute lymphoblastic leukaemia	2A85	Approved	[8]
Irbesartan	DMTP1DC	Diabetic kidney disease	GB61.Z	Approved	[36]
Istradefylline	DM20VSK	Parkinson disease	8A00.0	Approved	[40]
Ketobemidone	DMM3L6Z	Pain	MG30-MG3Z	Approved	[41]
Ketorolac	DMI4EL5	Postoperative inflammation	1A00-CA43.1	Approved	[42]
Lansoprazole	DMXYLQ3	Gastric ulcer	DA60	Approved	[43]
Lapatinib	DM3BH1Y	Breast cancer	2C60-2C65	Approved	[44]
Levomilnacipran	DMV26S8	Fibromyalgia	MG30.01	Approved	[45]
Lidocaine	DML4ZOT	Anaesthesia	9A78.6	Approved	[46]
Lobeglitazone	DMHY3IP	Type-2 diabetes	5A11	Approved	[47]
Loperamide	DMOJZQ9	Diarrhea	ME05.1	Approved	[48]
Loratadine	DMF3AN7	Allergy	4A80-4A85	Approved	[8]
Lorlatinib	DMICDLV	Non-small-cell lung cancer	2C25.Y	Approved	[49]
Losartan	DM72JXH	Diabetic kidney disease	GB61.Z	Approved	[50]
Lovastatin	DM9OZWQ	Arteriosclerosis	BD40	Approved	[51]
Mefenamic acid	DMK7HFI	Dysmenorrhea	GA34.3	Approved	[8]
Meloxicam	DM2AR7L	Arthritis	FA20	Approved	[52]
Mephenytoin	DM5UGDK	Epilepsy	8A60-8A68	Approved	[53]
Mestranol	DMG3F94	Contraception	QA21	Approved	[54]
Methadone	DMTW6IU	Advanced cancer	2A00-2F9Z	Approved	[55]
Mirtazapine	DML53ZJ	Depression	6A70-6A7Z	Approved	[46]
MLN9708	DMCMETN	Amyloidosis	5D00	Approved	[56]
Momelotinib	DMF98Q0	Myelofibrosis	2A20.2	Approved	[57]
Montelukast	DMD157S	Allergic asthma	CA23.0	Approved	[58]
Morphine	DMRMS0L	Advanced cancer	2A00-2F9Z	Approved	[59]
Mycophenolate mofetil	DMPQAGE	Hepatosplenic T-cell lymphoma		Approved	[60]
Naproxen	DMZ5RGV	Bursitis		Approved	[61]
Nicardipine	DMCDYW7	High blood pressure	BA00	Approved	[46]
Nicotine	DMWX5CO	Lung cancer	2C25.0	Approved	[62]
Nilotinib	DM7HXWT	Chronic myelogenous leukaemia	2A20.0	Approved	[8]
Omeprazole	DM471KJ	Cystic fibrosis	CA25	Approved	[63]
Pazopanib	DMF57DM	N. A.	N. A.	Approved	[64]
Pentamidine	DMHZJCG	African trypanosomiasis	1F51	Approved	[65]
Perospirone	DMVHJLX	Psychotic disorder	6A20-6A25	Approved	[66]
Perphenazine	DMA4MRX	Schizophrenia	6A20	Approved	[67]
PF-04449913	DMSB068	Chronic myelomonocytic leukaemia	2A40	Approved	[68]
Phenobarbital	DMXZOCG	Cluster headache	8A81.0	Approved	[69]
Phenprocoumon	DMDO279	Myocardial infarction	BA41-BA43	Approved	[70]
Phenytoin	DMNOKBV	Epilepsy	8A60-8A68	Approved	[46]
Pioglitazone	DMKJ485	Amyotrophic lateral sclerosis	8B60.0	Approved	[71]
Piroxicam	DMTK234	Osteoarthritis	FA00-FA05	Approved	[72]
PITAVASTATIN CALCIUM	DM1UJO0	Dyslipidemia	5C80-5C81	Approved	[73]
Propofol	DMB4OLE	Anaesthesia	9A78.6	Approved	[74]
Quinidine	DMLPICK	N. A.	N. A.	Approved	[8]
Quinine	DMSWYF5	Malaria	1F40-1F45	Approved	[8]
Repaglinide	DM5SXUV	Diabetic complication	5A2Y	Approved	[75]
Riociguat	DMXBLMP	Chronic thromboembolic pulmonary hypertension		Approved	[76]
Rofecoxib	DM3P5DA	Osteoarthritis	FA00-FA05	Approved	[8]
Rosiglitazone	DMILWZR	Chronic kidney disease	GB61	Approved	[77]
Selegiline Hydrochloride	DM3VR1L	Parkinson disease	8A00.0	Approved	[78]
Selexipag	DMAHSU0	Pulmonary arterial hypertension	BB01.0	Approved	[79]
Simvastatin	DM30SGU	Arteriosclerosis	BD40	Approved	[80]
Sitagliptin	DMGDKXN	Cystic fibrosis	CA25	Approved	[81]
Sorafenib	DMS8IFC	Adenocarcinoma	2D40	Approved	[82]
Sulfadiazine	DMTW3R8	Rheumatic fever	1B40-1B42	Approved	[83]
Sulfamethoxazole	DMB08GE	Acute otitis media	AB00	Approved	[84]
Sulfinpyrazone	DMEV954	Gout	FA25	Approved	[46]
Tazarotene	DM8SMD1	Acne vulgaris	ED80	Approved	[85]
Tegafur	DM31ZQM	Solid tumour/cancer	2A00-2F9Z	Approved	[37]
Temazepam	DM02A65	Insomnia	7A00-7A0Z	Approved	[86]
Terbinafine	DMI6HUW	Fungal infection	1F29-1F2F	Approved	[35]
Testosterone cypionate	DMC1TEV	N. A.	N. A.	Approved	[8]
Testosterone enanthate	DMB6871	N. A.	N. A.	Approved	[8]
Testosterone undecanoate	DMZO10Y	Hypogonadism	5A61.0	Approved	[8]
Thalidomide	DM70BU5	Adult T-cell leukemia/lymphoma		Approved	[87]
Tolbutamide	DM02AWV	Advanced cancer	2A00-2F9Z	Approved	[88]
Torasemide	DMXKJ6C	Congestive heart failure	BD10	Approved	[89]
Treprostinil	DMTIQF3	Pulmonary arterial hypertension	BB01.0	Approved	[90]
Tretinoin	DM49DUI	Acne vulgaris	ED80	Approved	[91]
Trifarotene	DMOL793	Acne vulgaris	ED80	Approved	[92]
Trimethadione	DM0Q8MZ	Absence epilepsy		Approved	[93]
Trimethoprim	DMM7CHK	Acute otitis media	AB00	Approved	[94]
Troglitazone	DM3VFPD	Diabetic complication	5A2Y	Approved	[95]
Velpatasvir	DMGF8ZQ	N. A.	N. A.	Approved	[96]
Verapamil	DMA7PEW	Angina pectoris	BA40	Approved	[97]
Vitamin A	DMJ2AH4	Night blindness	9D45	Approved	[98]
Vortioxetine	DM6F1PU	Major depressive disorder	6A70.3	Approved	[99]
Voxilaprevir	DMAI83D	N. A.	N. A.	Approved	[100]
Warfarin	DMJYCVW	Atrial fibrillation	BC81.3	Approved	[61]
Zafirlukast	DMHNQOG	Asthma	CA23	Approved	[94]
Zidovudine	DM4KI7O	Human immunodeficiency virus infection	1C62	Approved	[46]
Zopiclone	DMPI6Z0	Insomnia	7A00-7A0Z	Approved	[101]
Aminophenazone	DMY2AH1	N. A.	N. A.	Phase 4	[102]
Beraprost	DML634R	Pulmonary hypertension	BB01	Phase 4	[103]
------------------------------------------------------------------------------------


⏷ Show the Full List of 130 Approved Drug(s)

17 Clinical Trial Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ABT-267	DMNQ869	Hepatitis C virus infection	1E51.1	Phase 3	[104]
Balaglitazone	DMXBHR6	Type-1 diabetes	5A10	Phase 3	[47]
Cinitapride	DMEGFYD	Functional dyspepsia	DD90.3	Phase 3	[105]
Evacetrapib	DMCDZ15	Cardiovascular disease	BA00-BE2Z	Phase 3	[106]
Fenretinide	DMRD5SP	Macular degeneration	9B78.3	Phase 3	[107]
Karenitecin	DMCRGY4	Lung cancer	2C25.0	Phase 3	[108]
MURAGLITAZAR	DMG3NFZ	N. A.	N. A.	Phase 3	[109]
Odanacatib	DM1EO3G	Osteoporosis	FB83.0	Phase 3	[110]
Rivoglitazone	DMBY31K	Ocular inflammation	9C61.24	Phase 3	[111]
QLT-091001	DMZI4OV	Restless legs syndrome	7A80	Phase 2/3	[98]
Sarizotan	DMH7IPW	Rett syndrome	LD90.4	Phase 2/3	[112]
AZD2014	DMOEARH	Solid tumour/cancer	2A00-2F9Z	Phase 2	[113]
Cenicriviroc	DM4V8WF	Human immunodeficiency virus infection	1C62	Phase 2	[114]
H3B-6545	DMIFCY2	Breast cancer	2C60-2C65	Phase 1/2	[115]
ABT-333	DM7TOWX	Hepatitis C virus infection	1E51.1	Phase 1	[116]
AZD9496	DMPMDTH	Breast cancer	2C60-2C65	Phase 1	[117]
Capravirine	DM9ERH1	Human immunodeficiency virus infection	1C62	Phase 1	[118]
------------------------------------------------------------------------------------


⏷ Show the Full List of 17 Clinical Trial Drug(s)

4 Discontinued Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Cephaloridine	DM4Y95F	Gram-positive bacterial infection	1B74-1G40	Withdrawn from market	[119]
Aleglitazar	DMTG18I	Type-2 diabetes	5A11	Discontinued in Phase 3	[120]
Seratrodast	DMPNTDL	Allergic asthma	CA23.0	Discontinued in Phase 3	[121]
Licofelone	DM7HLFD	Osteoarthritis	FA00-FA05	Discontinued in Phase 1	[35]
------------------------------------------------------------------------------------

1 Preclinical Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Ciglitazone	DMAPO0T	Pulmonary fibrosis	CB03.4	Preclinical	[47]
------------------------------------------------------------------------------------

3 Investigative Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
cyamemazine	DMZ6YPV	Discovery agent	N.A.	Investigative	[122]
PARAOXON	DMN4ZKC	Discovery agent	N.A.	Investigative	[123]
Phenazone	DMCE985	Discovery agent	N.A.	Investigative	[35]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This DME

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	6.69E-07	4.42E-03	4.31E-02
Alopecia	ED70	Skin from scalp	3.37E-02	1.39E-01	5.78E-01
Alzheimer's disease	8A20	Entorhinal cortex	1.82E-04	-1.35E-01	-5.84E-01
Ankylosing spondylitis	FA92.0	Pheripheral blood	6.98E-01	2.18E-04	2.03E-03
Aortic stenosis	BB70	Calcified aortic valve	9.40E-01	-1.68E-02	-3.18E-02
Apnea	7A40	Hyperplastic tonsil	8.00E-02	-5.54E-02	-3.69E-01
Arthropathy	FA00-FA5Z	Peripheral blood	8.17E-01	-2.55E-02	-1.87E-01
Asthma	CA23	Nasal and bronchial airway	2.93E-03	-2.19E-01	-4.49E-01
Atopic dermatitis	EA80	Skin	5.96E-04	9.62E-02	8.89E-01
Autism	6A02	Whole blood	8.53E-01	-3.07E-02	-2.20E-01
Autoimmune uveitis	9A96	Peripheral monocyte	2.86E-02	-7.09E-02	-1.19E+00
Autosomal dominant monocytopenia	4B04	Whole blood	8.46E-01	2.44E-02	2.39E-01
Bacterial infection of gingival	1C1H	Gingival tissue	6.65E-02	-4.48E-02	-3.36E-01
Batten disease	5C56.1	Whole blood	9.38E-01	1.89E-02	1.52E-01
Behcet's disease	4A62	Peripheral blood	2.73E-01	4.16E-02	2.75E-01
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	3.07E-01	3.97E-02	1.59E-01
Bladder cancer	2C94	Bladder tissue	7.15E-03	1.83E-01	9.23E-01
Breast cancer	2C60-2C6Z	Breast tissue	5.08E-07	-1.25E-02	-6.37E-02
Cardioembolic stroke	8B11.20	Whole blood	7.71E-01	8.39E-03	3.95E-02
Cervical cancer	2C77	Cervical tissue	6.86E-01	-5.49E-02	-2.79E-01
Childhood onset rheumatic disease	FA20.Z	Peripheral blood	6.66E-01	2.12E-02	2.25E-01
Chronic hepatitis C	1E51.1	Whole blood	2.25E-01	-7.20E-02	-3.91E-01
Chronic obstructive pulmonary disease	CA22	Lung tissue	2.41E-01	3.17E-02	2.29E-01
Chronic obstructive pulmonary disease	CA22	Small airway epithelium	5.67E-01	5.11E-02	1.35E-01
Chronic rhinosinusitis	CA0A	Sinus mucosa tissue	5.16E-01	5.43E-02	1.44E-01
Colon cancer	2B90	Colon tissue	2.66E-04	-1.21E-01	-5.72E-01
Coronary artery disease	BA80-BA8Z	Peripheral blood	3.39E-01	5.91E-02	4.05E-01
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	6.40E-02	1.71E-01	1.15E+00
Endometriosis	GA10	Endometrium tissue	7.97E-02	-4.55E-02	-3.54E-01
Familial hypercholesterolemia	5C80.00	Peripheral blood	6.28E-01	1.37E-02	1.60E-01
Familial hypercholesterolemia	5C80.00	Whole blood	1.47E-02	-1.13E-01	-1.13E+00
Gastric cancer	2B72	Gastric tissue	2.23E-01	-1.33E+00	-1.24E+00
Glioblastopma	2A00.00	Nervous tissue	9.91E-19	-2.17E-01	-5.99E-01
Glioma	2A00.0Y-2A00.0Z	Brain stem tissue	6.52E-01	-3.60E-01	-6.10E-01
Glioma	2A00.0Y-2A00.0Z	White matter tissue	2.60E-01	-3.65E-02	-2.54E-01
Head and neck cancer	2D42	Head and neck tissue	2.90E-11	-1.06E-01	-1.42E-01
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	6.78E-01	9.78E-03	5.42E-02
Huntington's disease	8A01.10	Whole blood	5.93E-01	3.65E-03	3.43E-02
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	9.63E-01	1.10E-01	2.91E-01
Immunodeficiency	4A00-4A20	Peripheral blood	1.03E-01	6.81E-03	7.23E-02
Influenza	1E30	Whole blood	1.60E-01	6.49E-02	5.99E-01
Interstitial cystitis	GC00.3	Bladder tissue	4.00E-01	-2.09E-02	-1.50E-01
Intracranial aneurysm	8B01.0	Intracranial artery	4.08E-03	1.81E-01	1.97E+00
Irritable bowel syndrome	DD91.0	Rectal colon tissue	9.41E-02	8.09E-02	3.46E-01
Ischemic stroke	8B11	Peripheral blood	3.38E-02	4.92E-02	6.31E-01
Juvenile idiopathic arthritis	FA24	Peripheral blood	1.81E-01	5.13E-02	2.10E-01
Lateral sclerosis	8B60.4	Skin	1.14E-01	7.49E-02	1.11E+00
Lateral sclerosis	8B60.4	Cervical spinal cord	5.03E-01	-2.08E-03	-9.42E-03
Liver cancer	2C12.0	Liver tissue	1.82E-30	-1.89E+00	-2.75E+00
Liver failure	DB99.7-DB99.8	Liver tissue	3.77E-03	-1.94E+00	-8.02E+00
Lung cancer	2C25	Lung tissue	5.28E-05	1.90E-02	1.09E-01
Lupus erythematosus	4A40	Whole blood	2.14E-01	-4.97E-02	-1.73E-01
Major depressive disorder	6A70-6A7Z	Hippocampus	3.17E-01	-6.95E-02	-2.88E-01
Major depressive disorder	6A70-6A7Z	Whole blood	1.38E-01	-3.36E-04	-2.09E-03
Melanoma	2C30	Skin	8.32E-01	-3.32E-02	-1.47E-01
Multiple myeloma	2A83.1	Peripheral blood	7.83E-01	2.87E-03	6.52E-02
Multiple myeloma	2A83.1	Bone marrow	5.86E-02	-1.69E-01	-8.79E-01
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	9.78E-01	-3.38E-03	-5.71E-02
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	3.53E-02	6.59E-02	3.19E-01
Myelofibrosis	2A20.2	Whole blood	3.34E-04	1.21E-01	1.86E+00
Myocardial infarction	BA41-BA50	Peripheral blood	8.39E-02	1.07E-01	3.94E-01
Myopathy	8C70.6	Muscle tissue	5.98E-01	-1.02E-01	-6.90E-01
Neonatal sepsis	KA60	Whole blood	1.36E-02	-1.84E-02	-1.77E-01
Neuroectodermal tumour	2A00.11	Brain stem tissue	6.68E-01	-1.36E-01	-8.23E-01
Non-alcoholic fatty liver disease	DB92	Liver tissue	4.31E-01	-2.72E-02	-4.58E-02
Obesity related type 2 diabetes	5A11	Omental adipose tissue	7.09E-01	4.31E-02	5.74E-01
Olive pollen allergy	CA08.00	Peripheral blood	8.34E-01	-1.61E-02	-1.81E-01
Oral cancer	2B6E	Oral tissue	2.73E-01	-6.13E-02	-3.28E-01
Osteoarthritis	FA00-FA0Z	Synovial tissue	8.71E-01	-6.68E-03	-3.03E-02
Osteoporosis	FB83.1	Bone marrow	1.23E-01	4.59E-02	6.37E-01
Ovarian cancer	2C73	Ovarian tissue	1.13E-01	6.17E-02	2.28E-01
Pancreatic cancer	2C10	Pancreas	2.25E-02	-6.67E-01	-6.53E-01
Parkinson's disease	8A00.0	Substantia nigra tissue	5.57E-01	-7.89E-02	-7.93E-01
Pediatric respiratory syncytial virus infection	CA40.11	Peripheral blood	8.81E-01	-2.18E-02	-1.84E-01
Pituitary cancer	2D12	Pituitary tissue	6.90E-01	-1.23E-01	-4.33E-01
Pituitary gonadotrope tumour	2D12	Pituitary tissue	1.39E-01	4.85E-01	1.63E+00
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	7.04E-01	-4.02E-03	-2.88E-02
Polycythemia vera	2A20.4	Whole blood	3.82E-10	8.78E-02	1.41E+00
Pompe disease	5C51.3	Biceps muscle	3.45E-03	-9.40E-02	-1.00E+00
Preterm birth	KA21.4Z	Myometrium	7.88E-01	1.19E-02	9.16E-02
Prostate cancer	2C82	Prostate	5.27E-01	-1.74E-02	-6.97E-02
Psoriasis	EA90	Skin	4.73E-03	3.91E-02	2.20E-01
Rectal cancer	2B92	Rectal colon tissue	1.51E-01	-1.41E-01	-8.46E-01
Renal cancer	2C90-2C91	Kidney	1.73E-04	1.53E-01	7.44E-01
Retinoblastoma	2D02.2	Uvea	3.09E-09	-1.53E+00	-4.40E+00
Rheumatoid arthritis	FA20	Synovial tissue	7.62E-02	-1.65E-01	-6.38E-01
Rhinovirus infection	CA42.1	Nasal epithelium tissue	2.43E-01	-6.22E-02	-3.13E-01
Schizophrenia	6A20	Prefrontal cortex	1.94E-01	-1.03E-01	-3.08E-01
Schizophrenia	6A20	Superior temporal cortex	7.37E-02	9.49E-02	8.07E-01
Scleroderma	4A42.Z	Whole blood	2.56E-01	7.80E-03	9.30E-02
Seizure	8A60-8A6Z	Whole blood	4.57E-01	6.95E-02	3.56E-01
Sensitive skin	EK0Z	Skin	6.18E-01	3.82E-02	5.52E-01
Sepsis with septic shock	1G41	Whole blood	4.18E-03	3.05E-02	2.48E-01
Shwachman-Diamond syndrome	3A70.0	Bone marrow	6.03E-01	7.61E-02	6.10E-01
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	3.71E-02	1.03E-01	7.57E-01
Simpson golabi behmel syndrome	LD2C	Adipose tissue	3.18E-01	-4.49E-03	-3.72E-01
Sjogren's syndrome	4A43.2	Salivary gland tissue	8.93E-01	4.14E-02	2.77E-01
Skin cancer	2C30-2C3Z	Skin	1.07E-10	1.05E-01	5.98E-01
Thrombocythemia	3B63	Whole blood	3.60E-03	6.33E-02	9.75E-01
Thrombocytopenia	3B64	Whole blood	4.83E-01	3.92E-02	2.84E-01
Thyroid cancer	2D10	Thyroid	6.39E-01	-5.46E-02	-2.77E-01
Tibial muscular dystrophy	8C75	Muscle tissue	4.13E-02	-4.37E-02	-3.73E-01
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	5.00E-01	-6.51E-03	-3.20E-02
Type 2 diabetes	5A11	Liver tissue	4.79E-01	-1.88E-02	-1.73E-01
Ureter cancer	2C92	Urothelium	5.65E-01	2.72E-02	2.78E-01
Uterine cancer	2C78	Endometrium tissue	2.03E-01	-6.96E-02	-3.05E-01
Vitiligo	ED63.0	Skin	5.34E-01	-7.52E-02	-5.09E-01
------------------------------------------------------------------------------------


⏷ Show the Full List of DME Expression Under 107 Diseases

References

1	Identification of the human liver enzymes involved in the metabolism of the antimigraine agent almotriptan. Drug Metab Dispos. 2003 Apr;31(4):404-11.
2	Functional characterization of five novel CYP2C8 variants, G171S, R186X, R186G, K247R, and K383N, found in a Japanese population. Drug Metab Dispos. 2005 May;33(5):630-6.
3	The xenobiotic inhibitor profile of cytochrome P4502C8. Br J Clin Pharmacol. 2000 Dec;50(6):573-80.
4	Amodiaquine metabolism is impaired by common polymorphisms in CYP2C8: implications for malaria treatment in Africa. Clin Pharmacol Ther. 2007 Aug;82(2):197-203.
5	In vitro and in vivo oxidative metabolism and glucuronidation of anastrozole. Br J Clin Pharmacol. 2010 Dec;70(6):854-69.
6	Apixaban. Hosp Pharm. 2013 Jun;48(6):494-509.
7	Apalutamide: first global approval. Drugs. 2018 Apr;78(6):699-705.
8	Role of cytochrome P450 2C8 in drug metabolism and interactions. Pharmacol Rev. 2016 Jan;68(1):168-241.
9	Azelastine N-demethylation by cytochrome P-450 (CYP)3A4, CYP2D6, and CYP1A2 in human liver microsomes: evaluation of approach to predict the contribution of multiple CYPs. Drug Metab Dispos. 1999 Dec;27(12):1381-91.
10	Cytochrome P450 isozymes responsible for the metabolism of toluene and styrene in human liver microsomes. Xenobiotica. 1997 Jul;27(7):657-65.
11	Brigatinib: first global approval. Drugs. 2017 Jul;77(10):1131-1135.
12	Metabolite profiling and reaction phenotyping for the in vitro assessment of the bioactivation of bromfenac. Chem Res Toxicol. 2020 Jan 21;33(1):249-257.
13	Buprenorphine in cancer pain. Support Care Cancer. 2005 Nov;13(11):878-87.
14	DAILYMED.nlm.nih.gov: JEVTANA- cabazitaxel kit.
15	PharmGKB summary: caffeine pathway. Pharmacogenet Genomics. 2012 May;22(5):389-95.
16	Metabolism of capsaicin by cytochrome P450 produces novel dehydrogenated metabolites and decreases cytotoxicity to lung and liver cells. Chem Res Toxicol. 2003 Mar;16(3):336-49.
17	Potential interaction between ritonavir and carbamazepine. Pharmacotherapy. 2000 Jul;20(7):851-4.
18	Cytochrome P450 2C8 pharmacogenetics: a review of clinical studies. Pharmacogenomics. 2009 Sep;10(9):1489-510.
19	Short communication: high prevalence of the cytochrome P450 2C8*2 mutation in Northern Ghana. Trop Med Int Health. 2005 Dec;10(12):1271-3.
20	Interaction of cisapride with the human cytochrome P450 system: metabolism and inhibition studies. Drug Metab Dispos. 2000 Jul;28(7):789-800.
21	Elucidation of individual cytochrome P450 enzymes involved in the metabolism of clozapine. Naunyn Schmiedebergs Arch Pharmacol. 1998 Nov;358(5):592-9.
22	Enhanced cyclophosphamide and ifosfamide activation in primary human hepatocyte cultures: response to cytochrome P-450 inducers and autoinduction by oxazaphosphorines. Cancer Res. 1997 May 15;57(10):1946-54.
23	Pharmacokinetics, pharmacodynamics and safety of single, oral doses of GSK1278863, a novel HIF-prolyl hydroxylase inhibitor, in healthy Japanese and Caucasian subjects. Drug Metab Pharmacokinet. 2015 Dec;30(6):410-8.
24	CYP2C8/9 mediate dapsone N-hydroxylation at clinical concentrations of dapsone. Drug Metab Dispos. 2000 Aug;28(8):865-8.
25	Further characterization of the metabolism of desloratadine and its cytochrome P450 and UDP-glucuronosyltransferase inhibition potential: identification of desloratadine as a relatively selective UGT2B10 inhibitor. Drug Metab Dispos. 2015 Sep;43(9):1294-302.
26	Influence of CYP2C8 polymorphisms on the hydroxylation metabolism of paclitaxel, repaglinide and ibuprofen enantiomers in vitro. Biopharm Drug Dispos. 2013 Jul;34(5):278-87.
27	Use of inhibitory monoclonal antibodies to assess the contribution of cytochromes P450 to human drug metabolism. Eur J Pharmacol. 2000 Apr 14;394(2-3):199-209.
28	Analysis of human cytochrome P450 2C8 substrate specificity using a substrate pharmacophore and site-directed mutants. Biochemistry. 2004 Dec 14;43(49):15379-92.
29	Reversible inhibition of four important human liver cytochrome P450 enzymes by diethylstilbestrol. Pharmazie. 2011 Mar;66(3):216-21.
30	Role of CYP3A4 in human hepatic diltiazem N-demethylation: inhibition of CYP3A4 activity by oxidized diltiazem metabolites. J Pharmacol Exp Ther. 1997 Jul;282(1):294-300.
31	Characterization of human cytochrome P450 enzymes catalyzing domperidone N-dealkylation and hydroxylation in vitro. Br J Clin Pharmacol. 2004 Sep;58(3):277-87.
32	Eltrombopag-induced acute liver failure in a pediatric patient: a pharmacokinetic and pharmacogenetic analysis. Ther Drug Monit. 2018 Aug;40(4):386-388.
33	FDA Label of Enasidenib. The 2020 official website of the U.S. Food and Drug Administration.
34	Role of cytochrome P450 in estradiol metabolism in vitro. Acta Pharmacol Sin. 2001 Feb;22(2):148-54.
35	Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development. Curr Med Chem. 2009;16(27):3480-675.
36	Examination of 209 drugs for inhibition of cytochrome P450 2C8. J Clin Pharmacol. 2005 Jan;45(1):68-78.
37	Roles of cytochromes P450 1A2, 2A6, and 2C8 in 5-fluorouracil formation from tegafur, an anticancer prodrug, in human liver microsomes. Drug Metab Dispos. 2000 Dec;28(12):1457-63.
38	Comparison of 3-hydroxy-3-methylglutaryl coenzyme A (HMG-CoA) reductase inhibitors (statins) as inhibitors of cytochrome P450 2C8. Basic Clin Pharmacol Toxicol. 2005 Aug;97(2):104-8.
39	Halofantrine metabolism in microsomes in man: major role of CYP 3A4 and CYP 3A5. J Pharm Pharmacol. 1999 Apr;51(4):419-26.
40	Effects of rifampin on the pharmacokinetics of a single dose of istradefylline in healthy subjects. J Clin Pharmacol. 2018 Feb;58(2):193-201.
41	Ketobemidone is a substrate for cytochrome P4502C9 and 3A4, but not for P-glycoprotein. Xenobiotica. 2005 Aug;35(8):785-96.
42	Body weight, gender and pregnancy affect enantiomer-specific ketorolac pharmacokinetics. Br J Clin Pharmacol. 2017 Sep;83(9):1966-1975.
43	Identification of the human P450 enzymes involved in lansoprazole metabolism. J Pharmacol Exp Ther. 1996 May;277(2):805-16.
44	Mechanism-based inactivation of cytochrome P450 3A4 by lapatinib. Mol Pharmacol. 2010 Oct;78(4):693-703.
45	The role of levomilnacipran in the management of major depressive disorder: a comprehensive review. Curr Neuropharmacol. 2016;14(2):191-9.
46	Summary of information on human CYP enzymes: human P450 metabolism data. Drug Metab Rev. 2002 Feb-May;34(1-2):83-448.
47	Effects of gemfibrozil, itraconazole, and their combination on the pharmacokinetics of pioglitazone. Clin Pharmacol Ther. 2005 May;77(5):404-14.
48	Identification of cytochrome P450 isoforms involved in the metabolism of loperamide in human liver microsomes. Eur J Clin Pharmacol. 2004 Oct;60(8):575-81.
49	FDA label of Lorlatinib. The 2020 official website of the U.S. Food and Drug Administration.
50	Drug-drug interaction between losartan and paclitaxel in human liver microsomes with different CYP2C8 genotypes. Basic Clin Pharmacol Toxicol. 2015 Jun;116(6):493-8.
51	Pharmacogenomics of statins: understanding susceptibility to adverse effects. Pharmgenomics Pers Med. 2016 Oct 3;9:97-106.
52	Genetically based impairment in CYP2C8- and CYP2C9-dependent NSAID metabolism as a risk factor for gastrointestinal bleeding: is a combination of pharmacogenomics and metabolomics required to improve personalized medicine? Expert Opin Drug Metab Toxicol. 2009 Jun;5(6):607-20.
53	Evidence that CYP2C19 is the major (S)-mephenytoin 4'-hydroxylase in humans. Biochemistry. 1994 Feb 22;33(7):1743-52.
54	Loss of orally administered drugs in GI tract. Saudi Pharm J. 2012 Oct;20(4):331-44.
55	Methadone metabolism and drug-drug interactions: in vitro and in vivo literature review. J Pharm Sci. 2018 Dec;107(12):2983-2991.
56	Ninlaro- European Medicines Agency - European Union
57	Pharmacokinetics and disposition of momelotinib revealed a disproportionate human metabolite-resolution for clinical development. Drug Metab Dispos. 2018 Mar;46(3):237-247.
58	Determinants of cytochrome P450 2C8 substrate binding: structures of complexes with montelukast, troglitazone, felodipine, and 9-cis-retinoic acid. J Biol Chem. 2008 Jun 20;283(25):17227-37.
59	In vitro metabolism study of buprenorphine: evidence for new metabolic pathways. Drug Metab Dispos. 2005 May;33(5):689-95.
60	PharmGKB summary: mycophenolic acid pathway. Pharmacogenet Genomics. 2014 Jan;24(1):73-9.
61	Involvement of multiple cytochrome P450 isoforms in naproxen O-demethylation. Eur J Clin Pharmacol. 1997;52(4):293-8.
62	Roles of CYP2A6 and CYP2B6 in nicotine C-oxidation by human liver microsomes. Arch Toxicol. 1999 Mar;73(2):65-70.
63	Human CYP2C19 is a major omeprazole 5-hydroxylase, as demonstrated with recombinant cytochrome P450 enzymes. Drug Metab Dispos. 1996 Oct;24(10):1081-7.
64	Pazopanib, a new therapy for metastatic soft tissue sarcoma. Expert Opin Pharmacother. 2013 May;14(7):929-35.
65	Identification of human cytochrome P(450)s that metabolise anti-parasitic drugs and predictions of in vivo drug hepatic clearance from in vitro data. Eur J Clin Pharmacol. 2003 Sep;59(5-6):429-42.
66	Steady-state pharmacokinetics of a new antipsychotic agent perospirone and its active metabolite, and its relationship with prolactin response. Ther Drug Monit. 2004 Aug;26(4):361-5.
67	Identification of the human cytochrome P450 isoforms mediating in vitro N-dealkylation of perphenazine. Br J Clin Pharmacol. 2000 Dec;50(6):563-71.
68	Metabolism, excretion and pharmacokinetics of [14C]glasdegib (PF-04449913) in healthy volunteers following oral administration. Xenobiotica. 2017 Dec;47(12):1064-1076.
69	Colchicine down-regulates cytochrome P450 2B6, 2C8, 2C9, and 3A4 in human hepatocytes by affecting their glucocorticoid receptor-mediated regulation. Mol Pharmacol. 2003 Jul;64(1):160-9.
70	Identification of cytochromes P450 2C9 and 3A4 as the major catalysts of phenprocoumon hydroxylation in vitro. Eur J Clin Pharmacol. 2004 May;60(3):173-82.
71	The role of human CYP2C8 and CYP2C9 variants in pioglitazone metabolism in vitro. Basic Clin Pharmacol Toxicol. 2009 Dec;105(6):374-9.
72	Efficacy of piroxicam for postoperative pain after lower third molar surgery associated with CYP2C8*3 and CYP2C9 J Pain Res. 2017 Jul 6;10:1581-1589.
73	Comparison of the safety, tolerability, and pharmacokinetic profile of a single oral dose of pitavastatin 4 mg in adult subjects with severe renal impairment not on hemodialysis versus healthy adult subjects. J Cardiovasc Pharmacol. 2012 Jul;60(1):42-8.
74	Possible involvement of multiple human cytochrome P450 isoforms in the liver metabolism of propofol. Br J Anaesth. 1998 Jun;80(6):788-95.
75	Drug-drug and food-drug pharmacokinetic interactions with new insulinotropic agents repaglinide and nateglinide. Clin Pharmacokinet. 2007;46(2):93-108.
76	Riociguat (adempas): a novel agent for the treatment of pulmonary arterial hypertension and chronic thromboembolic pulmonary hypertension. P T. 2014 Nov;39(11):749-58.
77	Characterization of the cytochrome P450 enzymes involved in the in vitro metabolism of rosiglitazone. Br J Clin Pharmacol. 1999 Sep;48(3):424-32.
78	Comparative studies on the cytochrome p450-associated metabolism and interaction potential of selegiline between human liver-derived in vitro systems. Drug Metab Dispos. 2003 Sep;31(9):1093-102.
79	FDA Label of Uptravi. The 2020 official website of the U.S. Food and Drug Administration.
80	Drug interactions with lipid-lowering drugs: mechanisms and clinical relevance. Clin Pharmacol Ther. 2006 Dec;80(6):565-81.
81	Pharmacokinetics of dipeptidylpeptidase-4 inhibitors. Diabetes Obes Metab. 2010 Aug;12(8):648-58.
82	Interaction of sorafenib and cytochrome P450 isoenzymes in patients with advanced melanoma: a phase I/II pharmacokinetic interaction study. Cancer Chemother Pharmacol. 2011 Nov;68(5):1111-8.
83	Reduction of sulfamethoxazole and dapsone hydroxylamines by a microsomal enzyme system purified from pig liver and pig and human liver microsomes. Life Sci. 2005 May 27;77(2):205-19.
84	Sulfamethoxazole and its metabolite nitroso sulfamethoxazole stimulate dendritic cell costimulatory signaling. J Immunol. 2007 May 1;178(9):5533-42.
85	Cytochrome P450 2C8 and flavin-containing monooxygenases are involved in the metabolism of tazarotenic acid in humans. Drug Metab Dispos. 2003 Apr;31(4):476-81.
86	Human liver microsomal diazepam metabolism using cDNA-expressed cytochrome P450s: role of CYP2B6, 2C19 and the 3A subfamily. Xenobiotica. 1996 Nov;26(11):1155-66.
87	Thalidomide metabolism by the CYP2C subfamily. Clin Cancer Res. 2002 Jun;8(6):1964-73.
88	Prediction of in vivo drug-drug interactions between tolbutamide and various sulfonamides in humans based on in vitro experiments. Drug Metab Dispos. 2000 Apr;28(4):475-81.
89	Mechanism-based inactivation of human cytochrome P4502C8 by drugs in vitro. J Pharmacol Exp Ther. 2004 Dec;311(3):996-1007.
90	FDA label of Treprostinil. The 2020 official website of the U.S. Food and Drug Administration.
91	Identification of human cytochrome P450s involved in the formation of all-trans-retinoic acid principal metabolites. Mol Pharmacol. 2000 Dec;58(6):1341-8.
92	FDA label of Trifarotene. The 2020 official website of the U.S. Food and Drug Administration.
93	Trimethadione metabolism by human liver cytochrome P450: evidence for the involvement of CYP2E1. Xenobiotica. 1998 Nov;28(11):1041-7.
94	Pioglitazone is metabolised by CYP2C8 and CYP3A4 in vitro: potential for interactions with CYP2C8 inhibitors. Basic Clin Pharmacol Toxicol. 2006 Jul;99(1):44-51.
95	Effect of genetic polymorphisms in cytochrome p450 (CYP) 2C9 and CYP2C8 on the pharmacokinetics of oral antidiabetic drugs: clinical relevance. Clin Pharmacokinet. 2005;44(12):1209-25.
96	FDA Label of Vosevi. The 2020 official website of the U.S. Food and Drug Administration.
97	Differential expression and function of CYP2C isoforms in human intestine and liver. Pharmacogenetics. 2003 Sep;13(9):565-75.
98	Effects of arachidonic acid, prostaglandins, retinol, retinoic acid and cholecalciferol on xenobiotic oxidations catalysed by human cytochrome P450 enzymes. Xenobiotica. 1999 Mar;29(3):231-41.
99	Identification of the cytochrome P450 and other enzymes involved in the in vitro oxidative metabolism of a novel antidepressant, Lu AA21004. Drug Metab Dispos. 2012 Jul;40(7):1357-65.
100	FDA Label of Vosevi. The 2020 official website of the U.S. Food and Drug Administration.
101	Cytochrome P-450 3A4 and 2C8 are involved in zopiclone metabolism. Drug Metab Dispos. 1999 Sep;27(9):1068-73.
102	Contribution of human hepatic cytochrome P450s and steroidogenic CYP17 to the N-demethylation of aminopyrine. Xenobiotica. 1999 Feb;29(2):187-93.
103	Evaluation of drug-drug interaction potential of beraprost sodium mediated by P450 in vitro. Yakugaku Zasshi. 2008 Oct;128(10):1459-65.
104	Metabolism and disposition of pan-genotypic inhibitor of hepatitis C virus NS5A ombitasvir in humans. Drug Metab Dispos. 2016 Aug;44(8):1148-57.
105	The prokinetic cinitapride has no clinically relevant pharmacokinetic interaction and effect on QT during coadministration with ketoconazole. Drug Metab Dispos. 2007 Jul;35(7):1149-56.
106	Identification of cytochrome P450 enzymes involved in the metabolism of 4'-methoxy-alpha-pyrrolidinopropiophenone (MOPPP), a designer drug, in human liver microsomes. Xenobiotica. 2003 Oct;33(10):989-98.
107	Characterization of the metabolism of fenretinide by human liver microsomes, cytochrome P450 enzymes and UDP-glucuronosyltransferases. Br J Pharmacol. 2011 Feb;162(4):989-99.
108	Evaluation of in vitro drug interactions with karenitecin, a novel, highly lipophilic camptothecin derivative in phase II clinical development. J Clin Pharmacol. 2003 Sep;43(9):1008-14.
109	Involvement of multiple cytochrome P450 and UDP-glucuronosyltransferase enzymes in the in vitro metabolism of muraglitazar. Drug Metab Dispos. 2007 Jan;35(1):139-49.
110	Disposition and metabolism of the cathepsin K inhibitor odanacatib in humans. Drug Metab Dispos. 2014 May;42(5):818-27.
111	In vitro metabolism of rivoglitazone, a novel peroxisome proliferator-activated receptor gama agonist, in rat, monkey, and human liver microsomes and freshly isolated hepatocytes. Drug Metab Dispos. 2011 Jul;39(7):1311-9.
112	In vitro characterization of sarizotan metabolism: hepatic clearance, identification and characterization of metabolites, drug-metabolizing enzyme identification, and evaluation of cytochrome p450 inhibition. Drug Metab Dispos. 2010 Jun;38(6):905-16.
113	First-in-human pharmacokinetic and pharmacodynamic study of the dual m-TORC 1/2 inhibitor AZD2014. Clin Cancer Res. 2015 Aug 1;21(15):3412-9.
114	Pharmacokinetics, safety, and CCR2/CCR5 antagonist activity of cenicriviroc in participants with mild or moderate hepatic impairment. Clin Transl Sci. 2016 Jun;9(3):139-48.
115	Nonclinical pharmacokinetics and in vitro metabolism of H3B-6545, a novel selective ERalpha covalent antagonist (SERCA). Cancer Chemother Pharmacol. 2019 Jan;83(1):151-160.
116	Metabolism and disposition of hepatitis C polymerase inhibitor dasabuvir in humans. Drug Metab Dispos. 2016 Aug;44(8):1139-47.
117	Complete substrate inhibition of cytochrome P450 2C8 by AZD9496, an oral selective estrogen receptor degrader. Drug Metab Dispos. 2018 Sep;46(9):1268-1276.
118	Identification of enzymes responsible for primary and sequential oxygenation reactions of capravirine in human liver microsomes. Drug Metab Dispos. 2006 Nov;34(11):1798-802.
119	Gemfibrozil and its glucuronide inhibit the organic anion transporting polypeptide 2 (OATP2/OATP1B1:SLC21A6)-mediated hepatic uptake and CYP2C8-mediated metabolism of cerivastatin: analysis of the mechanism of the clinically relevant drug-drug interaction between cerivastatin and gemfibrozil. J Pharmacol Exp Ther. 2004 Oct;311(1):228-36.
120	Exposure and response analysis of aleglitazar on cardiovascular risk markers and safety outcomes: an analysis of the AleCardio trial. Diabetes Obes Metab. 2020 Jan;22(1):30-38.
121	Identification of cytochromes P450 involved in the human liver microsomal metabolism of the thromboxane A2 inhibitor seratrodast (ABT-001). Drug Metab Dispos. 1997 Jan;25(1):110-5.
122	Characterization of human cytochrome P450 enzymes involved in the metabolism of cyamemazine. Eur J Pharm Sci. 2007 Dec;32(4-5):357-66.
123	Diazinon, chlorpyrifos and parathion are metabolised by multiple cytochromes P450 in human liver. Toxicology. 2006 Jul 5;224(1-2):22-32.