Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHCDQ22)

• DOT Name: Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A)
• Synonyms: PGC-1-alpha; PPAR-gamma coactivator 1-alpha; PPARGC-1-alpha; Ligand effect modulator 6
• Gene Name: PPARGC1A
• Related Disease:
  Metabolic disorder
  Abdominal obesity-metabolic syndrome
  Alzheimer disease
  B-cell neoplasm
  Breast cancer
  Breast carcinoma
  Cardiac disease
  Cardiac failure
  Colorectal carcinoma
  Congenital hypothyroidism
  Congestive heart failure
  Coronary atherosclerosis
  Coronary heart disease
  Diabetic kidney disease
  Dilated cardiomyopathy
  Fatty liver disease
  Hepatocellular carcinoma
  Hyperthyroidism
  Kidney failure
  Lewy body dementia
  Multiple sclerosis
  Myocardial infarction
  Neoplasm
  Nephrotic syndrome
  Neuroblastoma
  Non-alcoholic fatty liver disease
  Obesity
  Polycystic ovarian syndrome
  Prediabetes syndrome
  Primary biliary cholangitis
  Renal fibrosis
  Schizophrenia
  Sciatic neuropathy
  Cardiomyopathy
  Colitis
  Hyperglycemia
  Prostate cancer
  Prostate carcinoma
  Amyotrophic lateral sclerosis
  Chronic kidney disease
  Fetal growth restriction
  Melanoma
• UniProt ID: PRGC1_HUMAN
• PDB ID: 1XB7 ; 3B1M ; 3CS8 ; 3D24 ; 3U9Q ; 3V9T ; 3V9V ; 4QJR ; 4QK4 ; 5Q0I ; 5TWO ; 5UNJ ; 5Z5S ; 5Z6S ; 6AD9 ; 6FZF ; 6FZP ; 6IZM ; 6IZN ; 6K0T ; 6KXX ; 6KXY ; 6LN4 ; 6MS7 ; 6NWK ; 6NWL ; 6T1V ; 6W9K ; 6W9L ; 7E2E ; 7KHT ; 7PRV ; 7PRW ; 7PRX ; 8BF1 ; 8DK4
• Pfam ID: PF00076
• Sequence:
  MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGLKWCSD
  QSEIISNQYNNEPSNIFEKIDEENEANLLAVLTETLDSLPVDEDGLPSFDALTDGDVTTD
  NEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNECSGLSTQNHANHNHRIRTNP
  AIVKTENSWSNKAKSICQQQKPQRRPCSELLKYLTTNDDPPHTKPTENRNSSRDKCTSKK
  KSHTQSQSQHLQAKPTTLSLPLTPESPNDPKGSPFENKTIERTLSVELSGTAGLTPPTTP
  PHKANQDNPFRASPKLKSSCKTVVPPPSKKPRYSESSGTQGNNSTKKGPEQSELYAQLSK
  SSVLTGGHEERKTKRPSLRLFGDHDYCQSINSKTEILINISQELQDSRQLENKDVSSDWQ
  GQICSSTDSDQCYLRETLEASKQVSPCSTRKQLQDQEIRAELNKHFGHPSQAVFDDEADK
  TGELRDSDFSNEQFSKLPMFINSGLAMDGLFDDSEDESDKLSYPWDGTQSYSLFNVSPSC
  SSFNSPCRDSVSPPKSLFSQRPQRMRSRSRSFSRHRSCSRSPYSRSRSRSPGSRSSSRSC
  YYYESSHYRHRTHRNSPLYVRSRSRSPYSRRPRYDSYEEYQHERLKREEYRREYEKRESE
  RAKQRERQRQKAIEERRVIYVGKIRPDTTRTELRDRFEVFGEIEECTVNLRDDGDSYGFI
  TYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKY
  DSLDFDSLLKEAQRSLRR
• Function: Transcriptional coactivator for steroid receptors and nuclear receptors. Greatly increases the transcriptional activity of PPARG and thyroid hormone receptor on the uncoupling protein promoter. Can regulate key mitochondrial genes that contribute to the program of adaptive thermogenesis. Plays an essential role in metabolic reprogramming in response to dietary availability through coordination of the expression of a wide array of genes involved in glucose and fatty acid metabolism. Acts as a key regulator of gluconeogenesis: stimulates hepatic gluconeogenesis by increasing the expression of gluconeogenic enzymes, and acting together with FOXO1 to promote the fasting gluconeogenic program. Induces the expression of PERM1 in the skeletal muscle in an ESRRA-dependent manner. Also involved in the integration of the circadian rhythms and energy metabolism. Required for oscillatory expression of clock genes, such as BMAL1 and NR1D1, through the coactivation of RORA and RORC, and metabolic genes, such as PDK4 and PEPCK.
• Tissue Specificity: Heart, skeletal muscle, liver and kidney. Expressed at lower levels in brain and pancreas and at very low levels in the intestine and white adipose tissue. In skeletal muscle, levels were lower in obese than in lean subjects and fasting induced a 2-fold increase in levels in the skeletal muscle in obese subjects.
• KEGG Pathway:
  AMPK sig.ling pathway (hsa04152)
  Longevity regulating pathway (hsa04211)
  Apelin sig.ling pathway (hsa04371)
  Thermogenesis (hsa04714)
  Insulin sig.ling pathway (hsa04910)
  Adipocytokine sig.ling pathway (hsa04920)
  Glucagon sig.ling pathway (hsa04922)
  Insulin resistance (hsa04931)
  Alcoholic liver disease (hsa04936)
  Huntington disease (hsa05016)
• Reactome Pathway:
  Transcriptional activation of mitochondrial biogenesis (R-HSA-2151201)
  Activation of PPARGC1A (PGC-1alpha) by phosphorylation (R-HSA-2151209)
  Transcriptional regulation of white adipocyte differentiation (R-HSA-381340)
  SUMOylation of transcription cofactors (R-HSA-3899300)
  Circadian Clock (R-HSA-400253)
  Regulation of RUNX2 expression and activity (R-HSA-8939902)
  FOXO-mediated transcription of oxidative stress, metabolic and neuronal genes (R-HSA-9615017)
  Heme signaling (R-HSA-9707616)
  PPARA activates gene expression (R-HSA-1989781)

Molecular Interaction Atlas (MIA) of This DOT

42 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Metabolic disorder	DIS71G5H	Definitive	Biomarker	[1]
Abdominal obesity-metabolic syndrome	DISPSIVN	Strong	Biomarker	[2]
Alzheimer disease	DISF8S70	Strong	Biomarker	[3]
B-cell neoplasm	DISVY326	Strong	Altered Expression	[4]
Breast cancer	DIS7DPX1	Strong	Biomarker	[5]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[5]
Cardiac disease	DISVO1I5	Strong	Biomarker	[6]
Cardiac failure	DISDC067	Strong	Biomarker	[7]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[8]
Congenital hypothyroidism	DISL5XVU	Strong	Biomarker	[9]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[7]
Coronary atherosclerosis	DISKNDYU	Strong	Altered Expression	[10]
Coronary heart disease	DIS5OIP1	Strong	Altered Expression	[10]
Diabetic kidney disease	DISJMWEY	Strong	Biomarker	[11]
Dilated cardiomyopathy	DISX608J	Strong	Biomarker	[12]
Fatty liver disease	DIS485QZ	Strong	Altered Expression	[13]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[14]
Hyperthyroidism	DISX87ZH	Strong	Altered Expression	[15]
Kidney failure	DISOVQ9P	Strong	Biomarker	[16]
Lewy body dementia	DISAE66J	Strong	Biomarker	[17]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[18]
Myocardial infarction	DIS655KI	Strong	Biomarker	[19]
Neoplasm	DISZKGEW	Strong	Biomarker	[20]
Nephrotic syndrome	DISSPSC2	Strong	Biomarker	[21]
Neuroblastoma	DISVZBI4	Strong	Biomarker	[22]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Altered Expression	[23]
Obesity	DIS47Y1K	Strong	Altered Expression	[24]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Biomarker	[25]
Prediabetes syndrome	DISH2I53	Strong	Biomarker	[26]
Primary biliary cholangitis	DIS43E0O	Strong	Altered Expression	[27]
Renal fibrosis	DISMHI3I	Strong	Altered Expression	[28]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[29]
Sciatic neuropathy	DISMGDKX	Strong	Biomarker	[30]
Cardiomyopathy	DISUPZRG	moderate	Biomarker	[31]
Colitis	DISAF7DD	moderate	Biomarker	[32]
Hyperglycemia	DIS0BZB5	moderate	Altered Expression	[33]
Prostate cancer	DISF190Y	moderate	Altered Expression	[34]
Prostate carcinoma	DISMJPLE	moderate	Altered Expression	[34]
Amyotrophic lateral sclerosis	DISF7HVM	Limited	Biomarker	[35]
Chronic kidney disease	DISW82R7	Limited	Altered Expression	[36]
Fetal growth restriction	DIS5WEJ5	Limited	Biomarker	[37]
Melanoma	DIS1RRCY	Limited	Biomarker	[38]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Chlorothiazide	DMLHESP	Approved	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A) increases the Metabolic disorder ADR of Chlorothiazide.	[84]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[39]
Nicotinamide	DMUPE07	Approved	Nicotinamide increases the acetylation of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[66]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[71]

78 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[40]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[41]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[42]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[43]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[44]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[45]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[44]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[46]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[47]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[48]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[49]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[50]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[51]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[52]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[53]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[54]
Etoposide	DMNH3PG	Approved	Etoposide increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[55]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[49]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol decreases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[56]
Alitretinoin	DMME8LH	Approved	Alitretinoin increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[57]
Lindane	DMB8CNL	Approved	Lindane increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[58]
Vitamin C	DMXJ7O8	Approved	Vitamin C increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
Bosentan	DMIOGBU	Approved	Bosentan decreases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[60]
Melatonin	DMKWFBT	Approved	Melatonin increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[61]
Glucosamine	DM4ZLFD	Approved	Glucosamine decreases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[62]
Isoniazid	DM5JVS3	Approved	Isoniazid decreases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[63]
Adenosine	DMM2NSK	Approved	Adenosine increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
Glutathione	DMAHMT9	Approved	Glutathione increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
Fructose	DM43AN2	Approved	Fructose decreases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[64]
Clofibrate	DMPC1J7	Approved	Clofibrate increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[65]
Vitamin B3	DMQVRZH	Approved	Vitamin B3 increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
Riboflavin	DM8YMWE	Approved	Riboflavin increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
Cortisone	DMU5QZX	Approved	Cortisone increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
Epoprostenol	DMUTYR2	Approved	Epoprostenol increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
Ergocalciferol	DMHO0AR	Approved	Ergocalciferol increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
Vitamin B6	DMDBZMV	Approved	Vitamin B6 increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
Ketotifen	DM74XKS	Approved	Ketotifen increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[65]
Adenosine monophosphate	DMNIJT0	Approved	Adenosine monophosphate increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
Acetylcarnitine	DM4UE3K	Phase 4	Acetylcarnitine increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[67]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[68]
Acadesine	DM1RMF5	Phase 3	Acadesine increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[63]
Creatine ALS-08	DMKD2BQ	Phase 3	Creatine ALS-08 increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[65]
PF-02545920	DMJPE61	Phase 2	PF-02545920 increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[69]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[40]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[70]
GW-501516	DMPL2KM	Discontinued in Phase 4	GW-501516 increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[72]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[73]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[74]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
D-glucose	DMMG2TO	Investigative	D-glucose decreases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[75]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE	DMNQL17	Investigative	2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE decreases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[76]
Forskolin	DM6ITNG	Investigative	Forskolin increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[77]
Chlorpyrifos	DMKPUI6	Investigative	Chlorpyrifos decreases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[22]
Rutin	DMEHRAJ	Investigative	Rutin increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[79]
Kaempferol	DMHEMUB	Investigative	Kaempferol increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[80]
(E)-4-(3,5-dimethoxystyryl)phenol	DMYXI2V	Investigative	(E)-4-(3,5-dimethoxystyryl)phenol increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[81]
Choline	DM5D9YK	Investigative	Choline increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
Linoleic acid	DMDGPY9	Investigative	Linoleic acid increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
1,4-Dithiothreitol	DMIFOXE	Investigative	1,4-Dithiothreitol increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
Icosapentum	DMF1CM7	Investigative	Icosapentum increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
All-trans-retinal	DM6CEVB	Investigative	All-trans-retinal increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
Propanoic Acid	DM9TN2W	Investigative	Propanoic Acid increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[82]
THIOCTIC ACID	DMNFCXW	Investigative	THIOCTIC ACID increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[67]
PGD2	DMYDW6J	Investigative	PGD2 increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
(L-)-S-adenosyl-L-homocysteine	DMDUN83	Investigative	(L-)-S-adenosyl-L-homocysteine increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
Biotin	DMKMCE1	Investigative	Biotin increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
Lauric Acid	DM9C8KQ	Investigative	Lauric Acid increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
Oxalacetic acid	DMPZSV1	Investigative	Oxalacetic acid increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
Deoxycorticosterone	DMW6YLS	Investigative	Deoxycorticosterone increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
XCT790	DMZ7N8D	Investigative	XCT790 decreases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[83]
Decanoic Acid	DM8FMYL	Investigative	Decanoic Acid increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
MYRISTIC ACID	DMYX0BL	Investigative	MYRISTIC ACID increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
Dihydrofolic Acid	DM1BDM8	Investigative	Dihydrofolic Acid increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
UDP-glucuronic acid	DMW16X2	Investigative	UDP-glucuronic acid increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
malic acid	DMU3O5H	Investigative	malic acid increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]
Dicarboxylate	DML3HEM	Investigative	Dicarboxylate increases the expression of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[59]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
MG-132	DMKA2YS	Preclinical	MG-132 decreases the degradation of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (PPARGC1A).	[53]

References

• [1] TFEB drives PGC-1 expression in adipocytes to protect against diet-induced metabolic dysfunction.Sci Signal. 2019 Nov 5;12(606):eaau2281. doi: 10.1126/scisignal.aau2281.
• [2] Modified high-sucrose diet-induced abdominally obese and normal-weight rats developed high plasma free fatty acid and insulin resistance.Oxid Med Cell Longev. 2012;2012:374346. doi: 10.1155/2012/374346. Epub 2012 Dec 25.
• [3] Protective effects of melatonin on mitochondrial biogenesis and mitochondrial structure and function in the HEK293-APPswe cell model of Alzheimer's disease.Eur Rev Med Pharmacol Sci. 2019 Apr;23(8):3542-3550. doi: 10.26355/eurrev_201904_17723.
• [4] Sodium azide induces mitochondriamediated apoptosis in PC12 cells through Pgc?associated signaling pathway.Mol Med Rep. 2019 Mar;19(3):2211-2219. doi: 10.3892/mmr.2019.9853. Epub 2019 Jan 14.
• [5] PGC-1 induced browning promotes involution and inhibits lactation in mammary glands.Cell Mol Life Sci. 2019 Dec;76(24):5011-5025. doi: 10.1007/s00018-019-03160-y. Epub 2019 Jun 1.
• [6] QiShenYiQi Pills, a Compound Chinese Medicine, Ameliorates Doxorubicin-Induced Myocardial Structure Damage and Cardiac Dysfunction in Rats.Evid Based Complement Alternat Med. 2013;2013:480597. doi: 10.1155/2013/480597. Epub 2013 Feb 26.
• [7] Recruitment of RNA Polymerase II to Metabolic Gene Promoters Is Inhibited in the Failing Heart Possibly Through PGC-1 (Peroxisome Proliferator-Activated Receptor- Coactivator-1) Dysregulation.Circ Heart Fail. 2019 Mar;12(3):e005529. doi: 10.1161/CIRCHEARTFAILURE.118.005529.
• [8] PPARG rs3856806 C>T Polymorphism Increased the Risk of Colorectal Cancer: A Case-Control Study in Eastern Chinese Han Population.Front Oncol. 2019 Feb 19;9:63. doi: 10.3389/fonc.2019.00063. eCollection 2019.
• [9] Evidence of a bigenomic regulation of mitochondrial gene expression by thyroid hormone during rat brain development.Biochem Biophys Res Commun. 2010 Jul 2;397(3):548-52. doi: 10.1016/j.bbrc.2010.05.154. Epub 2010 May 31.
• [10] In vitro and in vivo metabolite identification of a novel benzimidazole compound ZLN005 by liquid chromatography/tandem mass spectrometry.Rapid Commun Mass Spectrom. 2018 Mar 30;32(6):480-488. doi: 10.1002/rcm.8060.
• [11] 4-O-methylhonokiol ameliorates type 2 diabetes-induced nephropathy in mice likely by activation of AMPK-mediated fatty acid oxidation and Nrf2-mediated anti-oxidative stress.Toxicol Appl Pharmacol. 2019 May 1;370:93-105. doi: 10.1016/j.taap.2019.03.007. Epub 2019 Mar 12.
• [12] Mitochondrial-related gene expression profiles suggest an important role of PGC-1alpha in the compensatory mechanism of endemic dilated cardiomyopathy.Exp Cell Res. 2013 Oct 15;319(17):2604-16. doi: 10.1016/j.yexcr.2013.07.018. Epub 2013 Aug 13.
• [13] SEIPIN overexpression in the liver may alleviate hepatic steatosis by influencing the intracellular calcium level.Mol Cell Endocrinol. 2019 May 15;488:70-78. doi: 10.1016/j.mce.2019.03.005. Epub 2019 Mar 12.
• [14] Tumor-Derived -Fetoprotein Suppresses Fatty Acid Metabolism and Oxidative Phosphorylation in Dendritic Cells.Cancer Immunol Res. 2019 Jun;7(6):1001-1012. doi: 10.1158/2326-6066.CIR-18-0513. Epub 2019 Apr 15.
• [15] Decreased PGC1- levels and increased apoptotic protein signaling are associated with the maladaptive cardiac hypertrophy in hyperthyroidism.J Biosci. 2018 Dec;43(5):887-895.
• [16] High-fat diet-induced renal cell apoptosis and oxidative stress in spontaneously hypertensive rat are ameliorated by fenofibrate through the PPAR-FoxO3a-PGC-1 pathway.Nephrol Dial Transplant. 2012 Jun;27(6):2213-25. doi: 10.1093/ndt/gfr613. Epub 2011 Nov 9.
• [17] The PPARGC1A locus and CNS-specific PGC-1 isoforms are associated with Parkinson's Disease.Neurobiol Dis. 2019 Jan;121:34-46. doi: 10.1016/j.nbd.2018.09.016. Epub 2018 Sep 17.
• [18] Expression of LEP, LEPR and PGC1A genes is altered in peripheral blood mononuclear cells of patients with relapsing-remitting multiple sclerosis.J Neuroimmunol. 2020 Jan 15;338:577090. doi: 10.1016/j.jneuroim.2019.577090. Epub 2019 Oct 26.
• [19] A CRM1 Inhibitor Alleviates Cardiac Hypertrophy and Increases the Nuclear Distribution of NT-PGC-1 in NRVMs.Front Pharmacol. 2019 May 7;10:465. doi: 10.3389/fphar.2019.00465. eCollection 2019.
• [20] Cancer-associated fibroblasts modify lung cancer metabolism involving ROS and TGF- signaling.Free Radic Biol Med. 2019 Jan;130:163-173. doi: 10.1016/j.freeradbiomed.2018.10.450. Epub 2018 Nov 1.
• [21] Disorder of fatty acid metabolism in the kidney of PAN-induced nephrotic rats.Am J Physiol Renal Physiol. 2012 Oct;303(7):F1070-9. doi: 10.1152/ajprenal.00365.2011. Epub 2012 Aug 8.
• [22] Chlorpyrifos activates cell pyroptosis and increases susceptibility on oxidative stress-induced toxicity by miR-181/SIRT1/PGC-1/Nrf2 signaling pathway in human neuroblastoma SH-SY5Y cells: Implication for association between chlorpyrifos and Parkinson's disease. Environ Toxicol. 2019 Jun;34(6):699-707. doi: 10.1002/tox.22736. Epub 2019 Mar 5.
• [23] San-Huang-Tang protects obesity/diabetes induced NAFLD by upregulating PGC-1/PEPCK signaling in obese and galr1 knockout mice models.J Ethnopharmacol. 2020 Mar 25;250:112483. doi: 10.1016/j.jep.2019.112483. Epub 2019 Dec 13.
• [24] Obesity caused by a high-fat diet regulates the Sirt1/PGC-1/FNDC5/BDNF pathway to exacerbate isoflurane-induced postoperative cognitive dysfunction in older mice.Nutr Neurosci. 2020 Dec;23(12):971-982. doi: 10.1080/1028415X.2019.1581460. Epub 2019 Feb 22.
• [25] PGC-1 protects against oxidized low-density lipoprotein and luteinizing hormone-induced granulosa cells injury through ROS-p38 pathway.Hum Cell. 2019 Jul;32(3):285-296. doi: 10.1007/s13577-019-00252-6. Epub 2019 Apr 16.
• [26] Pre-diabetes alters testicular PGC1-/SIRT3 axis modulating mitochondrial bioenergetics and oxidative stress.Biochim Biophys Acta. 2014 Mar;1837(3):335-44. doi: 10.1016/j.bbabio.2013.12.008. Epub 2013 Dec 20.
• [27] Alteration of energy metabolism in the pathogenesis of bile duct lesions in primary biliary cirrhosis.J Clin Pathol. 2014 May;67(5):396-402. doi: 10.1136/jclinpath-2013-201815. Epub 2013 Nov 29.
• [28] Combined Blockade of Smad3 and JNK Pathways Ameliorates Progressive Fibrosis in Folic Acid Nephropathy.Front Pharmacol. 2019 Aug 9;10:880. doi: 10.3389/fphar.2019.00880. eCollection 2019.
• [29] Genes in immune pathways associated with abnormal white matter integrity in first-episode and treatment-nave patients with schizophrenia.Br J Psychiatry. 2019 May;214(5):281-287. doi: 10.1192/bjp.2018.297. Epub 2019 Feb 6.
• [30] Salvianolic acid A protects the peripheral nerve function in diabetic rats through regulation of the AMPK-PGC1-Sirt3 axis.Molecules. 2012 Sep 20;17(9):11216-28. doi: 10.3390/molecules170911216.
• [31] Heart specific PGC-1 deletion identifies metabolome of cardiac restricted metabolic heart failure.Cardiovasc Res. 2019 Jan 1;115(1):107-118. doi: 10.1093/cvr/cvy155.
• [32] Dietary supplementation of krill oil attenuates inflammation and oxidative stress in experimental ulcerative colitis in rats.Scand J Gastroenterol. 2012 Jan;47(1):49-58. doi: 10.3109/00365521.2011.634025. Epub 2011 Nov 30.
• [33] Lutein upregulates the PGC-1, NRF1, and TFAM expression by AMPK activation and downregulates ROS to maintain mtDNA integrity and mitochondrial biogenesis in hyperglycemic ARPE-19 cells and rat retina.Biotechnol Appl Biochem. 2019 Nov;66(6):999-1009. doi: 10.1002/bab.1821. Epub 2019 Oct 24.
• [34] PGC1 Suppresses Prostate Cancer Cell Invasion through ERR Transcriptional Control.Cancer Res. 2019 Dec 15;79(24):6153-6165. doi: 10.1158/0008-5472.CAN-19-1231. Epub 2019 Oct 8.
• [35] PGC-1 sparks the fire of neuroprotection against neurodegenerative disorders.Ageing Res Rev. 2018 Jul;44:8-21. doi: 10.1016/j.arr.2018.03.004. Epub 2018 Mar 23.
• [36] Peroxisome Proliferator-Activated Receptor- Coactivator-1 Inhibits Vascular Calcification Through Sirtuin 3-Mediated Reduction of Mitochondrial Oxidative Stress.Antioxid Redox Signal. 2019 Jul 1;31(1):75-91. doi: 10.1089/ars.2018.7620. Epub 2019 Apr 2.
• [37] [Increased expression of gluconeogenic enzymes in the liver of IUGR rats and subsequent insulin resistance].Zhongguo Dang Dai Er Ke Za Zhi. 2008 Apr;10(2):216-20.
• [38] FBXW7 regulates a mitochondrial transcription program by modulating MITF.Pigment Cell Melanoma Res. 2018 Sep;31(5):636-640. doi: 10.1111/pcmr.12704. Epub 2018 Apr 29.
• [39] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [40] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [41] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [42] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [43] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [44] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [45] Aberrant cell proliferation by enhanced mitochondrial biogenesis via mtTFA in arsenical skin cancers. Am J Pathol. 2011 May;178(5):2066-76.
• [46] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [47] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [48] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [49] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [50] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [51] Progesterone regulation of implantation-related genes: new insights into the role of oestrogen. Cell Mol Life Sci. 2007 Apr;64(7-8):1009-32.
• [52] Dexamethasone controls aryl hydrocarbon receptor (AhR)-mediated CYP1A1 and CYP1A2 expression and activity in primary cultures of human hepatocytes. Chem Biol Interact. 2009 May 15;179(2-3):288-96.
• [53] Troglitazone induces cytotoxicity in part by promoting the degradation of peroxisome proliferator-activated receptor co-activator-1 protein. Br J Pharmacol. 2010 Oct;161(4):771-81. doi: 10.1111/j.1476-5381.2010.00900.x.
• [54] Enhanced insulin-stimulated glycogen synthesis in response to insulin, metformin or rosiglitazone is associated with increased mRNA expression of GLUT4 and peroxisomal proliferator activator receptor gamma co-activator 1. Diabetologia. 2005 Jun;48(6):1173-9. doi: 10.1007/s00125-005-1741-3. Epub 2005 Apr 30.
• [55] Etoposide induces necrosis through p53-mediated antiapoptosis in human kidney proximal tubule cells. Toxicol Sci. 2015 Nov;148(1):204-19.
• [56] The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
• [57] Thiazolidinediones and rexinoids induce peroxisome proliferator-activated receptor-coactivator (PGC)-1alpha gene transcription: an autoregulatory loop controls PGC-1alpha expression in adipocytes via peroxisome proliferator-activated receptor-gamma coactivation. Endocrinology. 2006 Jun;147(6):2829-38. doi: 10.1210/en.2006-0070. Epub 2006 Mar 2.
• [58] Plasmatic concentration of organochlorine lindane acts as metabolic disruptors in HepG2 liver cell line by inducing mitochondrial disorder. Toxicol Appl Pharmacol. 2013 Oct 15;272(2):325-34.
• [59] A cardiac-specific robotized cellular assay identified families of human ligands as inducers of PGC-1 expression and mitochondrial biogenesis. PLoS One. 2012;7(10):e46753. doi: 10.1371/journal.pone.0046753. Epub 2012 Oct 3.
• [60] Omics-based responses induced by bosentan in human hepatoma HepaRG cell cultures. Arch Toxicol. 2018 Jun;92(6):1939-1952.
• [61] Melatonin prevents blood-retinal barrier breakdown and mitochondrial dysfunction in high glucose and hypoxia-induced in vitro diabetic macular edema model. Toxicol In Vitro. 2021 Sep;75:105191. doi: 10.1016/j.tiv.2021.105191. Epub 2021 May 5.
• [62] Glucosamine-induced endoplasmic reticulum stress affects GLUT4 expression via activating transcription factor 6 in rat and human skeletal muscle cells. Diabetologia. 2010 May;53(5):955-65. doi: 10.1007/s00125-010-1676-1. Epub 2010 Feb 18.
• [63] AMPK activator acadesine fails to alleviate isoniazid-caused mitochondrial instability in HepG2 cells. J Appl Toxicol. 2017 Oct;37(10):1219-1224. doi: 10.1002/jat.3483. Epub 2017 May 29.
• [64] Effects of four-week high-fructose diet on gene expression in skeletal muscle of healthy men. Diabetes Metab. 2008 Feb;34(1):82-5. doi: 10.1016/j.diabet.2007.08.004. Epub 2007 Dec 11.
• [65] Advantageous use of HepaRG cells for the screening and mechanistic study of drug-induced steatosis. Toxicol Appl Pharmacol. 2016 Jul 1;302:1-9. doi: 10.1016/j.taap.2016.04.007. Epub 2016 Apr 16.
• [66] Concurrent regulation of AMP-activated protein kinase and SIRT1 in mammalian cells. Biochem Biophys Res Commun. 2009 Jan 23;378(4):836-41. doi: 10.1016/j.bbrc.2008.11.130. Epub 2008 Dec 9.
• [67] Combined R-alpha-lipoic acid and acetyl-L-carnitine exerts efficient preventative effects in a cellular model of Parkinson's disease. J Cell Mol Med. 2010 Jan;14(1-2):215-25. doi: 10.1111/j.1582-4934.2008.00390.x.
• [68] Resveratrol induces hepatic mitochondrial biogenesis through the sequential activation of nitric oxide and carbon monoxide production. Antioxid Redox Signal. 2014 Jun 1;20(16):2589-605. doi: 10.1089/ars.2012.5138. Epub 2013 Nov 16.
• [69] A novel thermoregulatory role for PDE10A in mouse and human adipocytes. EMBO Mol Med. 2016 Jul 1;8(7):796-812. doi: 10.15252/emmm.201506085. Print 2016 Jul.
• [70] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [71] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [72] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [73] Sulforaphane induces differential modulation of mitochondrial biogenesis and dynamics in normal cells and tumor cells. Food Chem Toxicol. 2017 Feb;100:90-102. doi: 10.1016/j.fct.2016.12.020. Epub 2016 Dec 18.
• [74] An in vitro strategy using multiple human induced pluripotent stem cell-derived models to assess the toxicity of chemicals: A case study on paraquat. Toxicol In Vitro. 2022 Jun;81:105333. doi: 10.1016/j.tiv.2022.105333. Epub 2022 Feb 16.
• [75] Mitochondria are an essential mediator of nitric oxide/cyclic guanosine 3',5'-monophosphate blocking of glucose depletion induced cytotoxicity in human HepG2 cells. Mol Cancer Res. 2007 Sep;5(9):923-32.
• [76] Heterocyclic amines reduce insulin-induced AKT phosphorylation and induce gluconeogenic gene expression in human hepatocytes. Arch Toxicol. 2023 Jun;97(6):1613-1626. doi: 10.1007/s00204-023-03488-2. Epub 2023 Apr 2.
• [77] Coactivation of liver receptor homologue-1 by peroxisome proliferator-activated receptor gamma coactivator-1alpha on aromatase promoter II and its inhibition by activated retinoid X receptor suggest a novel target for breast-specific antiestrogen therapy. Cancer Res. 2005 Dec 15;65(24):11762-70. doi: 10.1158/0008-5472.CAN-05-2792.
• [78] Chlorpyrifos activates cell pyroptosis and increases susceptibility on oxidative stress-induced toxicity by miR-181/SIRT1/PGC-1/Nrf2 signaling pathway in human neuroblastoma SH-SY5Y cells: Implication for association between chlorpyrifos and Parkinson's disease. Environ Toxicol. 2019 Jun;34(6):699-707. doi: 10.1002/tox.22736. Epub 2019 Mar 5.
• [79] Herbacetin induces apoptosis in HepG2 cells: Involvements of ROS and PI3K/Akt pathway. Food Chem Toxicol. 2013 Jan;51:426-33. doi: 10.1016/j.fct.2012.09.036. Epub 2012 Oct 12.
• [80] The small polyphenolic molecule kaempferol increases cellular energy expenditure and thyroid hormone activation. Diabetes. 2007 Mar;56(3):767-76. doi: 10.2337/db06-1488.
• [81] ERK5/HDAC5-mediated, resveratrol-, and pterostilbene-induced expression of MnSOD in human endothelial cells. Mol Nutr Food Res. 2016 Feb;60(2):266-77. doi: 10.1002/mnfr.201500466. Epub 2015 Oct 23.
• [82] Propionic acid induces mitochondrial dysfunction and affects gene expression for mitochondria biogenesis and neuronal differentiation in SH-SY5Y cell line. Neurotoxicology. 2019 Dec;75:116-122. doi: 10.1016/j.neuro.2019.09.009. Epub 2019 Sep 14.
• [83] Estrogen-related receptor alpha (ERRalpha) inverse agonist XCT-790 induces cell death in chemotherapeutic resistant cancer cells. Chem Biol Interact. 2009 Oct 7;181(2):236-42. doi: 10.1016/j.cbi.2009.05.008. Epub 2009 May 21.
• [84] Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans. Pharmacogenomics J. 2014 Feb;14(1):35-40. doi: 10.1038/tpj.2013.3. Epub 2013 Feb 12.