Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDRV63V)

DOT Name Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A)
Synonyms DNA damage-inducible transcript 1 protein; DDIT-1
Gene Name GADD45A
Related Disease
Advanced cancer ( )
Glioblastoma multiforme ( )
Adult glioblastoma ( )
Alzheimer disease ( )
Ataxia-telangiectasia ( )
Bladder cancer ( )
Breast cancer ( )
Breast carcinoma ( )
Carcinoma ( )
Colon cancer ( )
Colon carcinoma ( )
Colorectal carcinoma ( )
Epithelial ovarian cancer ( )
Esophageal cancer ( )
Esophageal squamous cell carcinoma ( )
Gastric cancer ( )
Gastric neoplasm ( )
Glioma ( )
Hepatocellular carcinoma ( )
Hereditary diffuse gastric adenocarcinoma ( )
HIV infectious disease ( )
Juvenile idiopathic arthritis ( )
leukaemia ( )
Leukemia ( )
Lung cancer ( )
Lung carcinoma ( )
Malignant glioma ( )
Osteosarcoma ( )
Ovarian cancer ( )
Pancreatic cancer ( )
Pancreatic tumour ( )
Prostate cancer ( )
Prostate carcinoma ( )
Prostate neoplasm ( )
Rheumatoid arthritis ( )
Squamous cell carcinoma ( )
Systemic lupus erythematosus ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Breast neoplasm ( )
Neuroblastoma ( )
Melanoma ( )
Cervical carcinoma ( )
Non-small-cell lung cancer ( )
Ovarian neoplasm ( )
Sarcoma ( )
UniProt ID
GA45A_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2KG4
Pfam ID
PF01248
Sequence
MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
Function
In T-cells, functions as a regulator of p38 MAPKs by inhibiting p88 phosphorylation and activity. Might affect PCNA interaction with some CDK (cell division protein kinase) complexes; stimulates DNA excision repair in vitro and inhibits entry of cells into S phase.
KEGG Pathway
MAPK sig.ling pathway (hsa04010 )
NF-kappa B sig.ling pathway (hsa04064 )
FoxO sig.ling pathway (hsa04068 )
Cell cycle (hsa04110 )
p53 sig.ling pathway (hsa04115 )
Apoptosis (hsa04210 )
Cellular senescence (hsa04218 )
Epstein-Barr virus infection (hsa05169 )
Pathways in cancer (hsa05200 )
Transcriptio.l misregulation in cancer (hsa05202 )
Colorectal cancer (hsa05210 )
Pancreatic cancer (hsa05212 )
Endometrial cancer (hsa05213 )
Glioma (hsa05214 )
Thyroid cancer (hsa05216 )
Basal cell carcinoma (hsa05217 )
Melanoma (hsa05218 )
Chronic myeloid leukemia (hsa05220 )
Small cell lung cancer (hsa05222 )
Non-small cell lung cancer (hsa05223 )
Breast cancer (hsa05224 )
Hepatocellular carcinoma (hsa05225 )
Gastric cancer (hsa05226 )
Reactome Pathway
FOXO-mediated transcription of cell cycle genes (R-HSA-9617828 )
TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest (R-HSA-6804114 )

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Definitive Biomarker [1]
Glioblastoma multiforme DISK8246 Definitive Altered Expression [2]
Adult glioblastoma DISVP4LU Strong Genetic Variation [3]
Alzheimer disease DISF8S70 Strong Altered Expression [4]
Ataxia-telangiectasia DISP3EVR Strong Biomarker [5]
Bladder cancer DISUHNM0 Strong Altered Expression [6]
Breast cancer DIS7DPX1 Strong Altered Expression [7]
Breast carcinoma DIS2UE88 Strong Altered Expression [7]
Carcinoma DISH9F1N Strong Altered Expression [8]
Colon cancer DISVC52G Strong Genetic Variation [9]
Colon carcinoma DISJYKUO Strong Genetic Variation [9]
Colorectal carcinoma DIS5PYL0 Strong Biomarker [10]
Epithelial ovarian cancer DIS56MH2 Strong Genetic Variation [11]
Esophageal cancer DISGB2VN Strong Biomarker [12]
Esophageal squamous cell carcinoma DIS5N2GV Strong Biomarker [13]
Gastric cancer DISXGOUK Strong Biomarker [14]
Gastric neoplasm DISOKN4Y Strong Biomarker [14]
Glioma DIS5RPEH Strong Biomarker [2]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [15]
Hereditary diffuse gastric adenocarcinoma DISUIBYS Strong Biomarker [14]
HIV infectious disease DISO97HC Strong Biomarker [16]
Juvenile idiopathic arthritis DISQZGBV Strong Biomarker [17]
leukaemia DISS7D1V Strong Biomarker [18]
Leukemia DISNAKFL Strong Biomarker [18]
Lung cancer DISCM4YA Strong Altered Expression [19]
Lung carcinoma DISTR26C Strong Altered Expression [19]
Malignant glioma DISFXKOV Strong Biomarker [2]
Osteosarcoma DISLQ7E2 Strong Biomarker [20]
Ovarian cancer DISZJHAP Strong Genetic Variation [11]
Pancreatic cancer DISJC981 Strong Biomarker [21]
Pancreatic tumour DIS3U0LK Strong Therapeutic [21]
Prostate cancer DISF190Y Strong Genetic Variation [22]
Prostate carcinoma DISMJPLE Strong Genetic Variation [22]
Prostate neoplasm DISHDKGQ Strong Biomarker [23]
Rheumatoid arthritis DISTSB4J Strong Genetic Variation [24]
Squamous cell carcinoma DISQVIFL Strong Altered Expression [25]
Systemic lupus erythematosus DISI1SZ7 Strong Genetic Variation [24]
Urinary bladder cancer DISDV4T7 Strong Altered Expression [6]
Urinary bladder neoplasm DIS7HACE Strong Altered Expression [6]
Breast neoplasm DISNGJLM moderate Biomarker [26]
Neuroblastoma DISVZBI4 moderate Biomarker [27]
Melanoma DIS1RRCY Disputed Altered Expression [1]
Cervical carcinoma DIST4S00 Limited Altered Expression [28]
Non-small-cell lung cancer DIS5Y6R9 Limited Genetic Variation [29]
Ovarian neoplasm DISEAFTY Limited Genetic Variation [11]
Sarcoma DISZDG3U Limited Biomarker [30]
------------------------------------------------------------------------------------
⏷ Show the Full List of 46 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 2 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Paclitaxel DMLB81S Approved Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A) decreases the response to substance of Paclitaxel. [113]
Josamycin DMKJ8LB Approved Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A) affects the response to substance of Josamycin. [114]
------------------------------------------------------------------------------------
95 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [31]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [32]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [33]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [34]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [35]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [36]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [37]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [38]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [39]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [40]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [41]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [42]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [43]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [44]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [45]
Decitabine DMQL8XJ Approved Decitabine increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [23]
Marinol DM70IK5 Approved Marinol increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [47]
Zoledronate DMIXC7G Approved Zoledronate decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [48]
Phenobarbital DMXZOCG Approved Phenobarbital affects the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [49]
Progesterone DMUY35B Approved Progesterone increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [50]
Fluorouracil DMUM7HZ Approved Fluorouracil increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [51]
Panobinostat DM58WKG Approved Panobinostat increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [52]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [53]
Cannabidiol DM0659E Approved Cannabidiol increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [54]
Bortezomib DMNO38U Approved Bortezomib increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [55]
Troglitazone DM3VFPD Approved Troglitazone increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [56]
Hydroquinone DM6AVR4 Approved Hydroquinone increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [57]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [58]
Rosiglitazone DMILWZR Approved Rosiglitazone increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [59]
Cytarabine DMZD5QR Approved Cytarabine increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [60]
Aspirin DM672AH Approved Aspirin increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [61]
Etoposide DMNH3PG Approved Etoposide increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [62]
Diclofenac DMPIHLS Approved Diclofenac increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [63]
Menthol DMG2KW7 Approved Menthol decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [64]
Mitomycin DMH0ZJE Approved Mitomycin increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [65]
Azacitidine DMTA5OE Approved Azacitidine increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [23]
Cidofovir DMA13GD Approved Cidofovir affects the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [59]
Cyclophosphamide DM4O2Z7 Approved Cyclophosphamide increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [66]
Sulindac DM2QHZU Approved Sulindac increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [67]
Capsaicin DMGMF6V Approved Capsaicin increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [68]
Bicalutamide DMZMSPF Approved Bicalutamide increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [69]
Hydroxyurea DMOQVU9 Approved Hydroxyurea increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [65]
Gefitinib DM15F0X Approved Gefitinib increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [70]
Adefovir dipivoxil DMMAWY1 Approved Adefovir dipivoxil increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [59]
Sertraline DM0FB1J Approved Sertraline increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [71]
Dihydroartemisinin DMBXVMZ Approved Dihydroartemisinin increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [72]
Dactinomycin DM2YGNW Approved Dactinomycin increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [62]
Docetaxel DMDI269 Approved Docetaxel decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [60]
Gentamicin DMKINJO Approved Gentamicin increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [73]
Penicillamine DM40EF6 Approved Penicillamine increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [74]
Furazolidone DM3P6V7 Approved Furazolidone increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [75]
Fotemustine DMV62ED Approved Fotemustine increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [76]
Tobramycin DMUI0CH Approved Tobramycin increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [73]
Resveratrol DM3RWXL Phase 3 Resveratrol increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [77]
Tamibarotene DM3G74J Phase 3 Tamibarotene decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [33]
Curcumin DMQPH29 Phase 3 Curcumin increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [78]
Fenretinide DMRD5SP Phase 3 Fenretinide increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [79]
Camptothecin DM6CHNJ Phase 3 Camptothecin decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [80]
Bardoxolone methyl DMODA2X Phase 3 Bardoxolone methyl affects the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [81]
Genistein DM0JETC Phase 2/3 Genistein decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [38]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [82]
Tocopherol DMBIJZ6 Phase 2 Tocopherol decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [83]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [84]
PEITC DMOMN31 Phase 2 PEITC increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [85]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [86]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [87]
AMEP DMFELMQ Phase 1 AMEP increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [88]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [89]
PMID28870136-Compound-49 DMTUC9E Patented PMID28870136-Compound-49 increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [90]
Clioquinol DM746BZ Withdrawn from market Clioquinol increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [91]
Torcetrapib DMDHYM7 Discontinued in Phase 2 Torcetrapib increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [92]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [93]
PJ34 DMXO6YH Preclinical PJ34 increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [94]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [38]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [95]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [96]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [97]
Coumestrol DM40TBU Investigative Coumestrol decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [98]
Sulforaphane DMQY3L0 Investigative Sulforaphane increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [85]
chloropicrin DMSGBQA Investigative chloropicrin affects the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [99]
Acetaldehyde DMJFKG4 Investigative Acetaldehyde increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [100]
Deguelin DMXT7WG Investigative Deguelin increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [101]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A decreases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [102]
Paraquat DMR8O3X Investigative Paraquat increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [103]
Glyphosate DM0AFY7 Investigative Glyphosate increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [88]
Nickel chloride DMI12Y8 Investigative Nickel chloride increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [104]
Phencyclidine DMQBEYX Investigative Phencyclidine increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [105]
AHPN DM8G6O4 Investigative AHPN increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [106]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE DMNQL17 Investigative 2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [107]
Linalool DMGZQ5P Investigative Linalool increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [108]
Hydroxydimethylarsine Oxide DMPS2B1 Investigative Hydroxydimethylarsine Oxide increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [109]
1,4-Dithiothreitol DMIFOXE Investigative 1,4-Dithiothreitol increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [93]
DEMETHOXYCURCUMIN DMO5UGV Investigative DEMETHOXYCURCUMIN increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [110]
Fenthion DMKEG49 Investigative Fenthion increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [111]
A192621 DMV8AH6 Investigative A192621 increases the expression of Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A). [112]
------------------------------------------------------------------------------------
⏷ Show the Full List of 95 Drug(s)

References

1 Down-regulation of GADD45A enhances chemosensitivity in melanoma.Sci Rep. 2018 Mar 7;8(1):4111. doi: 10.1038/s41598-018-22484-6.
2 MiR-148a increases glioma cell migration and invasion by downregulating GADD45A in human gliomas with IDH1 R132H mutations.Oncotarget. 2017 Apr 11;8(15):25345-25361. doi: 10.18632/oncotarget.15867.
3 The Mammalian Hairless Protein as a DNA Binding Phosphoprotein.J Cell Biochem. 2017 Feb;118(2):341-350. doi: 10.1002/jcb.25641. Epub 2016 Sep 21.
4 Selective impairment of p53-mediated cell death in fibroblasts from sporadic Alzheimer's disease patients.J Cell Sci. 2002 Aug 1;115(Pt 15):3131-8. doi: 10.1242/jcs.115.15.3131.
5 Middle infrared radiation induces G2/M cell cycle arrest in A549 lung cancer cells.PLoS One. 2013;8(1):e54117. doi: 10.1371/journal.pone.0054117. Epub 2013 Jan 15.
6 GADD45a Mediated Cell Cycle Inhibition Is Regulated By P53 In Bladder Cancer.Onco Targets Ther. 2019 Sep 16;12:7591-7599. doi: 10.2147/OTT.S222223. eCollection 2019.
7 The expression and clinical significance of GADD45A in breast cancer patients.PeerJ. 2018 Aug 15;6:e5344. doi: 10.7717/peerj.5344. eCollection 2018.
8 Analysis of ZNF350/ZBRK1 promoter variants and breast cancer susceptibility in non-BRCA1/2 French Canadian breast cancer families.J Hum Genet. 2013 Feb;58(2):59-66. doi: 10.1038/jhg.2012.127. Epub 2012 Nov 15.
9 Early onset MSI-H colon cancer with MLH1 promoter methylation, is there a genetic predisposition?.BMC Cancer. 2010 May 5;10:180. doi: 10.1186/1471-2407-10-180.
10 CIL-102-Induced Cell Cycle Arrest and Apoptosis in Colorectal Cancer Cells via Upregulation of p21 and GADD45.PLoS One. 2017 Jan 9;12(1):e0168989. doi: 10.1371/journal.pone.0168989. eCollection 2017.
11 The GADD45A (1506T>C) Polymorphism Is Associated with Ovarian Cancer Susceptibility and Prognosis.PLoS One. 2015 Sep 30;10(9):e0138692. doi: 10.1371/journal.pone.0138692. eCollection 2015.
12 Decreased expression and aberrant methylation of Gadd45G is associated with tumor progression and poor prognosis in esophageal squamous cell carcinoma.Clin Exp Metastasis. 2013 Dec;30(8):977-92. doi: 10.1007/s10585-013-9597-2. Epub 2013 Jun 21.
13 Upregulation of a novel lncRNA LINC01980 promotes tumor growth of esophageal squamous cell carcinoma.Biochem Biophys Res Commun. 2019 May 21;513(1):73-80. doi: 10.1016/j.bbrc.2019.03.012. Epub 2019 Mar 29.
14 Combined GADD45A and thymidine phosphorylase expression levels predict response and survival of neoadjuvant-treated gastric cancer patients.Clin Cancer Res. 2005 Apr 15;11(8):3025-31. doi: 10.1158/1078-0432.CCR-04-1605.
15 Derivate isocorydine inhibits cell proliferation in hepatocellular carcinoma cell lines by inducing G2/M cell cycle arrest and apoptosis.Tumour Biol. 2016 May;37(5):5951-61. doi: 10.1007/s13277-015-4362-6. Epub 2015 Nov 23.
16 Anti-HIV activity of olive leaf extract (OLE) and modulation of host cell gene expression by HIV-1 infection and OLE treatment.Biochem Biophys Res Commun. 2003 Aug 8;307(4):1029-37. doi: 10.1016/s0006-291x(03)01292-0.
17 Gene expression signatures in polyarticular juvenile idiopathic arthritis demonstrate disease heterogeneity and offer a molecular classification of disease subsets.Arthritis Rheum. 2009 Jul;60(7):2113-23. doi: 10.1002/art.24534.
18 Gadd45a deficiency accelerates BCR-ABL driven chronic myelogenous leukemia.Oncotarget. 2017 Feb 14;8(7):10809-10821. doi: 10.18632/oncotarget.14580.
19 Apoptosis of human lung cancer cells by curcumin mediated through up-regulation of "growth arrest and DNA damage inducible genes 45 and 153".Biol Pharm Bull. 2010;33(8):1291-9. doi: 10.1248/bpb.33.1291.
20 Multidrug resistant osteosarcoma cell lines exhibit deficiency of GADD45alpha expression.Apoptosis. 2009 Jan;14(1):124-33. doi: 10.1007/s10495-008-0282-x.
21 Adenoviral-mediated gene transfer of Gadd45a results in suppression by inducing apoptosis and cell cycle arrest in pancreatic cancer cell. J Gene Med. 2009 Jan;11(1):3-13. doi: 10.1002/jgm.1270.
22 Serum GADD45a methylation is a useful biomarker to distinguish benign vs malignant prostate disease.Br J Cancer. 2015 Jul 28;113(3):460-8. doi: 10.1038/bjc.2015.240. Epub 2015 Jul 14.
23 Methylation-mediated repression of GADD45alpha in prostate cancer and its role as a potential therapeutic target. Cancer Res. 2009 Feb 15;69(4):1527-35. doi: 10.1158/0008-5472.CAN-08-3609. Epub 2009 Feb 3.
24 GADD45a and GADD45b Genes in Rheumatoid Arthritis and Systemic Lupus Erythematosus Patients.J Clin Med. 2019 Jun 5;8(6):801. doi: 10.3390/jcm8060801.
25 Effect of neoadjuvant chemotherapy and its correlation with HPV status, EGFR, Her-2-neu, and GADD45 expression in oral squamous cell carcinoma.World J Surg Oncol. 2018 Jan 31;16(1):20. doi: 10.1186/s12957-018-1308-7.
26 Estrogen receptor causes a G2 cell cycle arrest by inhibiting CDK1 activity through the regulation of cyclin B1, GADD45A, and BTG2.Breast Cancer Res Treat. 2011 Oct;129(3):777-84. doi: 10.1007/s10549-010-1273-5. Epub 2010 Dec 1.
27 Peroxynitrite induces GADD34, 45, and 153 VIA p38 MAPK in human neuroblastoma SH-SY5Y cells.Free Radic Biol Med. 2001 Jan 15;30(2):213-21. doi: 10.1016/s0891-5849(00)00461-5.
28 Radiation-induced gadd45 expression correlates with clinical response to radiotherapy of cervical carcinoma.Int J Radiat Oncol Biol Phys. 2000 Jan 15;46(2):411-6. doi: 10.1016/s0360-3016(99)00459-9.
29 Genetic variants of GADD45A, GADD45B and MAPK14 predict platinum-based chemotherapy-induced toxicities in Chinese patients with non-small cell lung cancer.Oncotarget. 2016 May 3;7(18):25291-303. doi: 10.18632/oncotarget.8052.
30 Nutlin-3a efficacy in sarcoma predicted by transcriptomic and epigenetic profiling.Cancer Res. 2014 Feb 1;74(3):921-31. doi: 10.1158/0008-5472.CAN-13-2424. Epub 2013 Dec 13.
31 The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
32 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
33 Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
34 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
35 Effects of folic acid on the antiproliferative efficiency of doxorubicin, camptothecin and methyl methanesulfonate in MCF-7 cells by mRNA endpoints. Saudi J Biol Sci. 2018 Dec;25(8):1568-1576. doi: 10.1016/j.sjbs.2016.02.005. Epub 2016 Feb 10.
36 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
37 Azidothymidine and cisplatin increase p14ARF expression in OVCAR-3 ovarian cancer cell line. Toxicol Appl Pharmacol. 2006 Oct 1;216(1):89-97. doi: 10.1016/j.taap.2006.04.015. Epub 2006 May 19.
38 Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
39 Quercetin and Its Fermented Extract as a Potential Inhibitor of Bisphenol A-Exposed HT-29 Colon Cancer Cells' Viability. Int J Mol Sci. 2023 Mar 15;24(6):5604. doi: 10.3390/ijms24065604.
40 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
41 Atrazine potentiation of arsenic trioxide-induced cytotoxicity and gene expression in human liver carcinoma cells (HepG2). Mol Cell Biochem. 2001 Jun;222(1-2):49-59.
42 Chromium III histidinate exposure modulates gene expression in HaCaT human keratinocytes exposed to oxidative stress. Biol Trace Elem Res. 2010 Oct;137(1):23-39.
43 Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
44 Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
45 A dual role of p21waf1/cip1 gene in apoptosis of HEp-2 treated with cisplatin or methotrexate. Cancer Gene Ther. 2008 Sep;15(9):576-90. doi: 10.1038/cgt.2008.28. Epub 2008 May 16.
46 Methylation-mediated repression of GADD45alpha in prostate cancer and its role as a potential therapeutic target. Cancer Res. 2009 Feb 15;69(4):1527-35. doi: 10.1158/0008-5472.CAN-08-3609. Epub 2009 Feb 3.
47 Gene expression changes in human small airway epithelial cells exposed to Delta9-tetrahydrocannabinol. Toxicol Lett. 2005 Aug 14;158(2):95-107.
48 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
49 Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
50 Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
51 Cell-type-specific responses to chemotherapeutics in breast cancer. Cancer Res. 2004 Jun 15;64(12):4218-26.
52 SIRT1 activation enhances HDAC inhibition-mediated upregulation of GADD45G by repressing the binding of NF-B/STAT3 complex to its promoter in malignant lymphoid cells. Cell Death Dis. 2013 May 16;4(5):e635. doi: 10.1038/cddis.2013.159.
53 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
54 Inhibiting Heat Shock Proteins Can Potentiate the Cytotoxic Effect of Cannabidiol in Human Glioma Cells. Anticancer Res. 2015 Nov;35(11):5827-37.
55 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
56 Signaling pathways involved in induction of GADD45 gene expression and apoptosis by troglitazone in human MCF-7 breast carcinoma cells. Oncogene. 2004 Jun 3;23(26):4614-23. doi: 10.1038/sj.onc.1207598.
57 In vitro effects of aldehydes present in tobacco smoke on gene expression in human lung alveolar epithelial cells. Toxicol In Vitro. 2013 Apr;27(3):1072-81.
58 Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
59 Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
60 Development and validation of the TGx-HDACi transcriptomic biomarker to detect histone deacetylase inhibitors in human TK6 cells. Arch Toxicol. 2021 May;95(5):1631-1645. doi: 10.1007/s00204-021-03014-2. Epub 2021 Mar 26.
61 Aspirin and alterations in DNA repair proteins in the SW480 colorectal cancer cell line. Oncol Rep. 2010 Jul;24(1):37-46. doi: 10.3892/or_00000826.
62 Genomic profiling uncovers a molecular pattern for toxicological characterization of mutagens and promutagens in vitro. Toxicol Sci. 2011 Jul;122(1):185-97.
63 Species-specific toxicity of diclofenac and troglitazone in primary human and rat hepatocytes. Chem Biol Interact. 2009 Apr 15;179(1):17-24.
64 Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
65 Differential expression of TP53 associated genes in Fanconi anemia cells after mitomycin C and hydroxyurea treatment. Mutat Res. 2008 Oct 30;656(1-2):1-7.
66 Comparison of Drug Metabolism and Its Related Hepatotoxic Effects in HepaRG, Cryopreserved Human Hepatocytes, and HepG2 Cell Cultures. Biol Pharm Bull. 2018 May 1;41(5):722-732. doi: 10.1248/bpb.b17-00913. Epub 2018 Feb 14.
67 Expression profile analysis of colon cancer cells in response to sulindac or aspirin. Biochem Biophys Res Commun. 2002 Mar 29;292(2):498-512.
68 Triggering of transient receptor potential vanilloid type 1 (TRPV1) by capsaicin induces Fas/CD95-mediated apoptosis of urothelial cancer cells in an ATM-dependent manner. Carcinogenesis. 2009 Aug;30(8):1320-9. doi: 10.1093/carcin/bgp138. Epub 2009 Jun 5.
69 Microarray analysis of bicalutamide action on telomerase activity, p53 pathway and viability of prostate carcinoma cell lines. J Pharm Pharmacol. 2005 Jan;57(1):83-92.
70 Identification of genes linked to gefitinib treatment in prostate cancer cell lines with or without resistance to androgen: a clue to application of gefitinib to hormone-resistant prostate cancer. Oncol Rep. 2006 Jun;15(6):1453-60.
71 Sertraline induces endoplasmic reticulum stress in hepatic cells. Toxicology. 2014 Aug 1;322:78-88. doi: 10.1016/j.tox.2014.05.007. Epub 2014 May 24.
72 The redox antimalarial dihydroartemisinin targets human metastatic melanoma cells but not primary melanocytes with induction of NOXA-dependent apoptosis. Invest New Drugs. 2012 Aug;30(4):1289-301. doi: 10.1007/s10637-011-9676-7. Epub 2011 May 6.
73 A Quantitative Approach to Screen for Nephrotoxic Compounds In Vitro. J Am Soc Nephrol. 2016 Apr;27(4):1015-28. doi: 10.1681/ASN.2015010060. Epub 2015 Aug 10.
74 D-Penicillamine targets metastatic melanoma cells with induction of the unfolded protein response (UPR) and Noxa (PMAIP1)-dependent mitochondrial apoptosis. Apoptosis. 2012 Oct;17(10):1079-94.
75 The Effect of GADD45a on Furazolidone-Induced S-Phase Cell-Cycle Arrest in Human Hepatoma G2 Cells. J Biochem Mol Toxicol. 2015 Oct;29(10):489-495. doi: 10.1002/jbt.21719. Epub 2015 Jun 11.
76 Translesion polymerase is upregulated by cancer therapeutics and confers anticancer drug resistance. Cancer Res. 2014 Oct 1;74(19):5585-96. doi: 10.1158/0008-5472.CAN-14-0953. Epub 2014 Aug 14.
77 Effects of resveratrol on gene expression in renal cell carcinoma. Cancer Biol Ther. 2004 Sep;3(9):882-8. doi: 10.4161/cbt.3.9.1056. Epub 2004 Sep 21.
78 Expression profiles of apoptotic genes induced by curcumin in human breast cancer and mammary epithelial cell lines. Anticancer Res. 2005 Sep-Oct;25(5):3293-302.
79 4-HPR modulates gene expression in ovarian cells. Int J Cancer. 2006 Sep 1;119(5):1005-13. doi: 10.1002/ijc.21797.
80 Myristicin from nutmeg induces apoptosis via the mitochondrial pathway and down regulates genes of the DNA damage response pathways in human leukaemia K562 cells. Chem Biol Interact. 2014 Jul 25;218:1-9. doi: 10.1016/j.cbi.2014.04.014. Epub 2014 Apr 29.
81 Fluorescent tagging of endogenous Heme oxygenase-1 in human induced pluripotent stem cells for high content imaging of oxidative stress in various differentiated lineages. Arch Toxicol. 2021 Oct;95(10):3285-3302. doi: 10.1007/s00204-021-03127-8. Epub 2021 Sep 4.
82 Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
83 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
84 Arsenic mediates cell proliferation and gene expression in the bladder epithelium: association with activating protein-1 transactivation. Cancer Res. 2000 Jul 1;60(13):3445-53.
85 Glutathione- and thioredoxin-related enzymes are modulated by sulfur-containing chemopreventive agents. Biol Chem. 2007 Oct;388(10):1069-81.
86 Altered gene expression patterns in MCF-7 cells induced by the urban dust particulate complex mixture standard reference material 1649a. Cancer Res. 2005 Feb 15;65(4):1251-8.
87 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
88 Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
89 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
90 Pentoxifylline induces apoptosis in vitro in cutaneous T cell lymphoma (HuT-78) and enhances FasL mediated killing by upregulating Fas expression. Biochem Pharmacol. 2009 Jan 1;77(1):30-45. doi: 10.1016/j.bcp.2008.09.018. Epub 2008 Sep 21.
91 Clioquinol induces DNA double-strand breaks, activation of ATM, and subsequent activation of p53 signaling. Toxicology. 2012 Sep 4;299(1):55-9. doi: 10.1016/j.tox.2012.05.013. Epub 2012 May 22.
92 Clarifying off-target effects for torcetrapib using network pharmacology and reverse docking approach. BMC Syst Biol. 2012 Dec 10;6:152.
93 Transient receptor potential vanilloid 1 agonists cause endoplasmic reticulum stress and cell death in human lung cells. J Pharmacol Exp Ther. 2007 Jun;321(3):830-8. doi: 10.1124/jpet.107.119412. Epub 2007 Mar 1.
94 Small PARP inhibitor PJ-34 induces cell cycle arrest and apoptosis of adult T-cell leukemia cells. J Hematol Oncol. 2015 Oct 23;8:117. doi: 10.1186/s13045-015-0217-2.
95 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
96 Molecular events in human T cells treated with diesel exhaust particles or formaldehyde that underlie their diminished interferon-gamma and interleukin-10 production. Int Arch Allergy Immunol. 2009;148(3):239-50. doi: 10.1159/000161584. Epub 2008 Oct 10.
97 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
98 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
99 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
100 Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
101 Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
102 Probiotic Bacillus subtilis CW14 reduces disruption of the epithelial barrier and toxicity of ochratoxin A to Caco-2?cells. Food Chem Toxicol. 2019 Apr;126:25-33. doi: 10.1016/j.fct.2019.02.009. Epub 2019 Feb 11.
103 Identification of genes associated with paraquat-induced toxicity in SH-SY5Y cells by PCR array focused on apoptotic pathways. J Toxicol Environ Health A. 2008;71(22):1457-67. doi: 10.1080/15287390802329364.
104 p53 activation by Ni(II) is a HIF-1 independent response causing caspases 9/3-mediated apoptosis in human lung cells. Toxicol Appl Pharmacol. 2013 Jun 15;269(3):233-9. doi: 10.1016/j.taap.2013.03.023. Epub 2013 Apr 6.
105 Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
106 GADD45A is a mediator of CD437 induced apoptosis in ovarian carcinoma cells. J Cell Physiol. 2007 Sep;212(3):771-9. doi: 10.1002/jcp.21073.
107 Genotoxicity and induction of DNA damage responsive genes by food-borne heterocyclic aromatic amines in human hepatoma HepG2 cells. Food Chem Toxicol. 2013 Sep;59:386-94.
108 Linalool preferentially induces robust apoptosis of a variety of leukemia cells via upregulating p53 and cyclin-dependent kinase inhibitors. Toxicology. 2010 Jan 31;268(1-2):19-24. doi: 10.1016/j.tox.2009.11.013. Epub 2009 Nov 14.
109 Toxicological properties of the thiolated inorganic arsenic and arsenosugar metabolite thio-dimethylarsinic acid in human bladder cells. J Trace Elem Med Biol. 2014 Apr;28(2):138-146. doi: 10.1016/j.jtemb.2013.06.004. Epub 2013 Jul 5.
110 Dimethoxycurcumin reduces proliferation and induces apoptosis in renal tumor cells more efficiently than demethoxycurcumin and curcumin. Chem Biol Interact. 2021 Apr 1;338:109410. doi: 10.1016/j.cbi.2021.109410. Epub 2021 Feb 12.
111 Fenthion and terbufos induce DNA damage, the expression of tumor-related genes, and apoptosis in HEPG2 cells. Environ Mol Mutagen. 2011 Aug;52(7):529-37. doi: 10.1002/em.20652. Epub 2011 Apr 27.
112 Endothelin receptor B antagonists decrease glioma cell viability independently of their cognate receptor. BMC Cancer. 2008 Nov 28;8:354. doi: 10.1186/1471-2407-8-354.
113 cDNA microarray analysis of isogenic paclitaxel- and doxorubicin-resistant breast tumor cell lines reveals distinct drug-specific genetic signatures of resistance. Breast Cancer Res Treat. 2006 Mar;96(1):17-39. doi: 10.1007/s10549-005-9026-6. Epub 2005 Dec 2.
114 A genome-wide analysis of targets of macrolide antibiotics in mammalian cells. J Biol Chem. 2020 Feb 14;295(7):2057-2067. doi: 10.1074/jbc.RA119.010770. Epub 2020 Jan 8.