Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKGIE76)

DOT Name	Heat shock 70 kDa protein 1A (HSPA1A)
Synonyms	Heat shock 70 kDa protein 1; HSP70-1; HSP70.1
Gene Name	HSPA1A
Related Disease	Glioma ( ) Multiple sclerosis ( ) Prostate carcinoma ( ) Acute kidney injury ( ) Adult glioblastoma ( ) Arteriosclerosis ( ) Atherosclerosis ( ) Breast carcinoma ( ) Carcinoma ( ) Clear cell renal carcinoma ( ) Colon carcinoma ( ) Colorectal carcinoma ( ) Coronary atherosclerosis ( ) Epithelial ovarian cancer ( ) Fatty liver disease ( ) Glioblastoma multiforme ( ) Graft-versus-host disease ( ) Hepatocellular carcinoma ( ) Hypopigmentation of the skin ( ) Lung cancer ( ) Lung carcinoma ( ) Myocardial ischemia ( ) Nasopharyngeal carcinoma ( ) Neoplasm ( ) Neuroblastoma ( ) Non-alcoholic fatty liver disease ( ) Non-insulin dependent diabetes ( ) Non-small-cell lung cancer ( ) Ovarian cancer ( ) Ovarian neoplasm ( ) Pneumonia ( ) Renal cell carcinoma ( ) Small-cell lung cancer ( ) Stomach cancer ( ) Stroke ( ) Type-1 diabetes ( ) Urinary bladder cancer ( ) Cardiovascular disease ( ) Parkinson disease ( ) Alzheimer disease ( ) Autoimmune disease ( ) Chronic obstructive pulmonary disease ( ) Inflammatory bowel disease ( ) Melanoma ( ) Prostate cancer ( ) Prostate neoplasm ( ) Type-1/2 diabetes ( )
UniProt ID	HS71A_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	1HJO ; 1S3X ; 1XQS ; 2E88 ; 2E8A ; 2LMG ; 3A8Y ; 3ATU ; 3ATV ; 3AY9 ; 3D2E ; 3D2F ; 3JXU ; 3LOF ; 3Q49 ; 4IO8 ; 4J8F ; 4PO2 ; 4WV5 ; 4WV7 ; 5AQW ; 5AQX ; 5AQY ; 5AQZ ; 5AR0 ; 5BN8 ; 5BN9 ; 5BPL ; 5BPM ; 5BPN ; 5GJJ ; 5MKR ; 5MKS ; 5XI9 ; 5XIR ; 6FHK ; 6G3R ; 6G3S ; 6JPV ; 6K39 ; 6ZYI ; 7FGM ; 7KW7 ; 7Q4R
Pfam ID	PF00012
Sequence	MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA LNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEIS SMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA IAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNH FVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRA RFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLN KSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTI PTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDI DANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKN ALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELE QVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD
Function	Molecular chaperone implicated in a wide variety of cellular processes, including protection of the proteome from stress, folding and transport of newly synthesized polypeptides, activation of proteolysis of misfolded proteins and the formation and dissociation of protein complexes. Plays a pivotal role in the protein quality control system, ensuring the correct folding of proteins, the re-folding of misfolded proteins and controlling the targeting of proteins for subsequent degradation. This is achieved through cycles of ATP binding, ATP hydrolysis and ADP release, mediated by co-chaperones. The co-chaperones have been shown to not only regulate different steps of the ATPase cycle, but they also have an individual specificity such that one co-chaperone may promote folding of a substrate while another may promote degradation. The affinity for polypeptides is regulated by its nucleotide bound state. In the ATP-bound form, it has a low affinity for substrate proteins. However, upon hydrolysis of the ATP to ADP, it undergoes a conformational change that increases its affinity for substrate proteins. It goes through repeated cycles of ATP hydrolysis and nucleotide exchange, which permits cycles of substrate binding and release. The co-chaperones are of three types: J-domain co-chaperones such as HSP40s (stimulate ATPase hydrolysis by HSP70), the nucleotide exchange factors (NEF) such as BAG1/2/3 (facilitate conversion of HSP70 from the ADP-bound to the ATP-bound state thereby promoting substrate release), and the TPR domain chaperones such as HOPX and STUB1. Maintains protein homeostasis during cellular stress through two opposing mechanisms: protein refolding and degradation. Its acetylation/deacetylation state determines whether it functions in protein refolding or protein degradation by controlling the competitive binding of co-chaperones HOPX and STUB1. During the early stress response, the acetylated form binds to HOPX which assists in chaperone-mediated protein refolding, thereafter, it is deacetylated and binds to ubiquitin ligase STUB1 that promotes ubiquitin-mediated protein degradation. Regulates centrosome integrity during mitosis, and is required for the maintenance of a functional mitotic centrosome that supports the assembly of a bipolar mitotic spindle. Enhances STUB1-mediated SMAD3 ubiquitination and degradation and facilitates STUB1-mediated inhibition of TGF-beta signaling. Essential for STUB1-mediated ubiquitination and degradation of FOXP3 in regulatory T-cells (Treg) during inflammation. Required as a co-chaperone for optimal STUB1/CHIP ubiquitination of NFATC3. Negatively regulates heat shock-induced HSF1 transcriptional activity during the attenuation and recovery phase period of the heat shock response. Involved in the clearance of misfolded PRDM1/Blimp-1 proteins. Sequesters them in the cytoplasm and promotes their association with SYNV1/HRD1, leading to proteasomal degradation ; (Microbial infection) In case of rotavirus A infection, serves as a post-attachment receptor for the virus to facilitate entry into the cell.
KEGG Pathway	Spliceosome (hsa03040 ) MAPK sig.ling pathway (hsa04010 ) Protein processing in endoplasmic reticulum (hsa04141 ) Endocytosis (hsa04144 ) Longevity regulating pathway - multiple species (hsa04213 ) Antigen processing and presentation (hsa04612 ) Estrogen sig.ling pathway (hsa04915 ) Prion disease (hsa05020 ) Legionellosis (hsa05134 ) Toxoplasmosis (hsa05145 ) Measles (hsa05162 ) Lipid and atherosclerosis (hsa05417 )
Reactome Pathway	Regulation of HSF1-mediated heat shock response (R-HSA-3371453 ) HSP90 chaperone cycle for steroid hormone receptors (SHR) in the presence of ligand (R-HSA-3371497 ) Attenuation phase (R-HSA-3371568 ) HSF1-dependent transactivation (R-HSA-3371571 ) AUF1 (hnRNP D0) binds and destabilizes mRNA (R-HSA-450408 ) Neutrophil degranulation (R-HSA-6798695 ) PKR-mediated signaling (R-HSA-9833482 ) Viral RNP Complexes in the Host Cell Nucleus (R-HSA-168330 )

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Glioma	DIS5RPEH	Definitive	Altered Expression	[1]
Multiple sclerosis	DISB2WZI	Definitive	Genetic Variation	[2]
Prostate carcinoma	DISMJPLE	Definitive	Biomarker	[3]
Acute kidney injury	DISXZG0T	Strong	Biomarker	[4]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[5]
Arteriosclerosis	DISK5QGC	Strong	Genetic Variation	[6]
Atherosclerosis	DISMN9J3	Strong	Genetic Variation	[6]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[7]
Carcinoma	DISH9F1N	Strong	Altered Expression	[8]
Clear cell renal carcinoma	DISBXRFJ	Strong	Biomarker	[9]
Colon carcinoma	DISJYKUO	Strong	Biomarker	[10]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[11]
Coronary atherosclerosis	DISKNDYU	Strong	Biomarker	[12]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[13]
Fatty liver disease	DIS485QZ	Strong	Biomarker	[14]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[15]
Graft-versus-host disease	DIS0QADF	Strong	ModifyingMutation	[16]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[17]
Hypopigmentation of the skin	DIS39YKC	Strong	Biomarker	[18]
Lung cancer	DISCM4YA	Strong	Altered Expression	[19]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[19]
Myocardial ischemia	DISFTVXF	Strong	Biomarker	[20]
Nasopharyngeal carcinoma	DISAOTQ0	Strong	Altered Expression	[21]
Neoplasm	DISZKGEW	Strong	Biomarker	[22]
Neuroblastoma	DISVZBI4	Strong	Altered Expression	[23]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Altered Expression	[24]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Altered Expression	[14]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[25]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[13]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[13]
Pneumonia	DIS8EF3M	Strong	Biomarker	[26]
Renal cell carcinoma	DISQZ2X8	Strong	Biomarker	[9]
Small-cell lung cancer	DISK3LZD	Strong	Altered Expression	[27]
Stomach cancer	DISKIJSX	Strong	Genetic Variation	[28]
Stroke	DISX6UHX	Strong	Biomarker	[29]
Type-1 diabetes	DIS7HLUB	Strong	Biomarker	[30]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[31]
Cardiovascular disease	DIS2IQDX	moderate	Genetic Variation	[32]
Parkinson disease	DISQVHKL	moderate	Therapeutic	[33]
Alzheimer disease	DISF8S70	Limited	Biomarker	[34]
Autoimmune disease	DISORMTM	Limited	Altered Expression	[35]
Chronic obstructive pulmonary disease	DISQCIRF	Limited	Genetic Variation	[36]
Inflammatory bowel disease	DISGN23E	Limited	Biomarker	[37]
Melanoma	DIS1RRCY	Limited	Biomarker	[38]
Prostate cancer	DISF190Y	Limited	Biomarker	[3]
Prostate neoplasm	DISHDKGQ	Limited	Biomarker	[39]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[40]
------------------------------------------------------------------------------------


⏷ Show the Full List of 47 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 3 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Carbamazepine	DMZOLBI	Approved	Heat shock 70 kDa protein 1A (HSPA1A) affects the response to substance of Carbamazepine.	[116]
Vemurafenib	DM62UG5	Approved	Heat shock 70 kDa protein 1A (HSPA1A) decreases the response to substance of Vemurafenib.	[38]
Triptolide	DMCMDVR	Phase 3	Heat shock 70 kDa protein 1A (HSPA1A) decreases the response to substance of Triptolide.	[4]
------------------------------------------------------------------------------------

82 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[41]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[42]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[43]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[44]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[45]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[42]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[46]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[47]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[48]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[49]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[50]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[51]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[52]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[53]
Selenium	DM25CGV	Approved	Selenium increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[54]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[55]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[56]
Menadione	DMSJDTY	Approved	Menadione increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[51]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[57]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[58]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[59]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[60]
Aspirin	DM672AH	Approved	Aspirin increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[61]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[62]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[63]
Indomethacin	DMSC4A7	Approved	Indomethacin increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[64]
Amphotericin B	DMTAJQE	Approved	Amphotericin B decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[65]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol affects the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[66]
Cidofovir	DMA13GD	Approved	Cidofovir decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[67]
Cyclophosphamide	DM4O2Z7	Approved	Cyclophosphamide increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[68]
Ifosfamide	DMCT3I8	Approved	Ifosfamide increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[67]
Ibuprofen	DM8VCBE	Approved	Ibuprofen increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[64]
Acetic Acid, Glacial	DM4SJ5Y	Approved	Acetic Acid, Glacial increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[69]
Motexafin gadolinium	DMEJKRF	Approved	Motexafin gadolinium increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[69]
Sodium phenylbutyrate	DMXLBCQ	Approved	Sodium phenylbutyrate increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[72]
Adefovir dipivoxil	DMMAWY1	Approved	Adefovir dipivoxil decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[67]
Sertraline	DM0FB1J	Approved	Sertraline increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[73]
Etretinate	DM2CZFA	Approved	Etretinate decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[74]
Gentamicin	DMKINJO	Approved	Gentamicin increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[75]
Aminoglutethimide	DMWFHMZ	Approved	Aminoglutethimide increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[76]
Dihydroxyacetone	DMM1LG2	Approved	Dihydroxyacetone increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[77]
Penicillamine	DM40EF6	Approved	Penicillamine increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[78]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[79]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[80]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[81]
Curcumin	DMQPH29	Phase 3	Curcumin increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[82]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[66]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[54]
Tanespimycin	DMNLQHK	Phase 2	Tanespimycin increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[84]
Disulfiram	DMCL2OK	Phase 2 Trial	Disulfiram increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[85]
NVP-AUY922	DMTYXQF	Phase 2	NVP-AUY922 increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[84]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[87]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[88]
AMEP	DMFELMQ	Phase 1	AMEP increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[89]
T83193	DMHO29Y	Patented	T83193 increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[91]
Geldanamycin	DMS7TC5	Discontinued in Phase 2	Geldanamycin increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[92]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[93]
Celastrol	DMWQIJX	Preclinical	Celastrol increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[94]
Wortmannin	DM8EVK5	Terminated	Wortmannin decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[95]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[96]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[97]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[98]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[99]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[100]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[101]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[102]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[103]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[104]
Paraquat	DMR8O3X	Investigative	Paraquat decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[105]
Glyphosate	DM0AFY7	Investigative	Glyphosate increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[89]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[106]
Phencyclidine	DMQBEYX	Investigative	Phencyclidine increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[107]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[64]
Resorcinol	DMM37C0	Investigative	Resorcinol decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[109]
cinnamaldehyde	DMZDUXG	Investigative	cinnamaldehyde increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[91]
crotylaldehyde	DMTWRQI	Investigative	crotylaldehyde increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[110]
Rapamycin Immunosuppressant Drug	DM678IB	Investigative	Rapamycin Immunosuppressant Drug decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[111]
CH-223191	DMMJZYC	Investigative	CH-223191 decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[112]
U0126	DM31OGF	Investigative	U0126 increases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[95]
AM251	DMTAWHL	Investigative	AM251 decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[113]
Flavone	DMEQH6J	Investigative	Flavone decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[114]
L-Serine	DM6WPIS	Investigative	L-Serine decreases the expression of Heat shock 70 kDa protein 1A (HSPA1A).	[115]
------------------------------------------------------------------------------------


⏷ Show the Full List of 82 Drug(s)

3 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Lindane	DMB8CNL	Approved	Lindane affects the localization of Heat shock 70 kDa protein 1A (HSPA1A).	[70]
Gefitinib	DM15F0X	Approved	Gefitinib increases the secretion of Heat shock 70 kDa protein 1A (HSPA1A).	[71]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal affects the binding of Heat shock 70 kDa protein 1A (HSPA1A).	[108]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Biochemical Pathways of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
DNCB	DMDTVYC	Phase 2	DNCB increases the metabolism of Heat shock 70 kDa protein 1A (HSPA1A).	[83]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Heat shock 70 kDa protein 1A (HSPA1A).	[86]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Heat shock 70 kDa protein 1A (HSPA1A).	[90]
------------------------------------------------------------------------------------

References

1	The effect of quercetin and imperatorin on programmed cell death induction in T98G cells in vitro.Pharmacol Rep. 2014 Apr;66(2):292-300. doi: 10.1016/j.pharep.2013.10.003. Epub 2014 Mar 4.
2	Heat shock protein 70-hom gene polymorphism and protein expression in multiple sclerosis.J Neuroimmunol. 2016 Sep 15;298:189-93. doi: 10.1016/j.jneuroim.2016.07.011. Epub 2016 Jul 15.
3	Ultrasound targeted microbubble destruction for novel dual targeting of HSP72 and HSC70 in prostate cancer.Asian Pac J Cancer Prev. 2014;15(3):1285-90. doi: 10.7314/apjcp.2014.15.3.1285.
4	Heat shock protein 72 protects kidney proximal tubule cells from injury induced by triptolide by means of activation of the MEK/ERK pathway. Int J Toxicol. 2009 May-Jun;28(3):177-89. doi: 10.1177/1091581809337418.
5	Heat shock protein 72 expression allows permissive replication of oncolytic adenovirus dl1520 (ONYX-015) in rat glioblastoma cells.Mol Cancer. 2005 Mar 11;4(1):12. doi: 10.1186/1476-4598-4-12.
6	Genetic variations of HSPA1A, the heat shock protein levels, and risk of atherosclerosis.Cell Stress Chaperones. 2012 Jul;17(4):507-16. doi: 10.1007/s12192-012-0328-4. Epub 2012 Feb 11.
7	HSP90, HSPA8, HIF-1 alpha and HSP70-2 polymorphisms in breast cancer: a case-control study.Mol Biol Rep. 2012 Dec;39(12):10873-9. doi: 10.1007/s11033-012-1984-2. Epub 2012 Oct 12.
8	HSP72 and gp96 in gastroenterological cancers.Clin Chim Acta. 2013 Feb 18;417:73-9. doi: 10.1016/j.cca.2012.12.017. Epub 2012 Dec 22.
9	Targeting the testis-specific heat-shock protein 70-2 (HSP70-2) reduces cellular growth, migration, and invasion in renal cell carcinoma cells.Tumour Biol. 2014 Dec;35(12):12695-706. doi: 10.1007/s13277-014-2594-5. Epub 2014 Sep 12.
10	Hyperthermia effects on Hsp27 and Hsp72 associations with mismatch repair (MMR) proteins and cisplatin toxicity in MMR-deficient/proficient colon cancer cell lines.Int J Hyperthermia. 2015;31(5):464-75. doi: 10.3109/02656736.2015.1026848. Epub 2015 Jun 4.
11	Heat shock protein 70-2 (HSP70-2) is a novel therapeutic target for colorectal cancer and is associated with tumor growth.BMC Cancer. 2016 Jul 29;16:561. doi: 10.1186/s12885-016-2592-7.
12	Association of heat shock protein70-2 (HSP70-2) gene polymorphism with coronary artery disease in an Iranian population.Gene. 2014 Oct 25;550(2):180-4. doi: 10.1016/j.gene.2014.08.012. Epub 2014 Aug 7.
13	Secretion of cytokines and heat shock protein (HspA1A) by ovarian cancer cells depending on the tumor type and stage of disease.Cytokine. 2017 Jan;89:136-142. doi: 10.1016/j.cyto.2016.01.017. Epub 2016 Feb 8.
14	Impact of hepatic HSP72 on insulin signaling.Am J Physiol Endocrinol Metab. 2019 Feb 1;316(2):E305-E318. doi: 10.1152/ajpendo.00215.2018. Epub 2018 Dec 11.
15	Silencing of Hsp27 and Hsp72 in glioma cells as a tool for programmed cell death induction upon temozolomide and quercetin treatment. Toxicol Appl Pharmacol. 2013 Dec 15;273(3):580-9. doi: 10.1016/j.taap.2013.10.003. Epub 2013 Oct 12.
16	Correlation of Hsp70-1 and Hsp70-2 gene expression with the degree of graft-versus-host reaction in a rat skin explant model.Transplantation. 2008 Jun 27;85(12):1809-16. doi: 10.1097/TP.0b013e31817753f7.
17	Meta-analysis of gene expression profiles indicates genes in spliceosome pathway are up-regulated in hepatocellular carcinoma (HCC).Med Oncol. 2015 Apr;32(4):96. doi: 10.1007/s12032-014-0425-6. Epub 2015 Mar 3.
18	Treatment with Modified Heat Shock Protein Repigments Vitiligo Lesions in Sinclair Swine.J Invest Dermatol. 2018 Dec;138(12):2505-2506. doi: 10.1016/j.jid.2018.08.003.
19	Molecular chaperones in the acquisition of cancer cell chemoresistance with mutated TP53 and MDM2 up-regulation.Oncotarget. 2017 Jun 30;8(47):82123-82143. doi: 10.18632/oncotarget.18899. eCollection 2017 Oct 10.
20	Cardioplegia prevents ischemia-induced transcriptional alterations of cytoprotective genes in rat hearts: a DNA microarray study.J Thorac Cardiovasc Surg. 2005 Oct;130(4):1151. doi: 10.1016/j.jtcvs.2005.06.027.
21	N,N'-dinitrosopiperazine--mediated heat-shock protein 70-2 expression is involved in metastasis of nasopharyngeal carcinoma.PLoS One. 2013 May 7;8(5):e62908. doi: 10.1371/journal.pone.0062908. Print 2013.
22	Membrane Localization of HspA1A, a Stress Inducible 70-kDa Heat-Shock Protein, Depends on Its Interaction with Intracellular Phosphatidylserine.Biomolecules. 2019 Apr 17;9(4):152. doi: 10.3390/biom9040152.
23	Recombinant human Tat-Hsp70-2: A tool for neuroprotection.Protein Expr Purif. 2017 Oct;138:18-24. doi: 10.1016/j.pep.2016.07.005. Epub 2016 Jul 9.
24	Exercise, heat shock proteins and insulin resistance.Philos Trans R Soc Lond B Biol Sci. 2018 Jan 19;373(1738):20160529. doi: 10.1098/rstb.2016.0529.
25	Functional redundancy of HSPA1, HSPA2 and other HSPA proteins in non-small cell lung carcinoma (NSCLC); an implication for NSCLC treatment.Sci Rep. 2019 Oct 7;9(1):14394. doi: 10.1038/s41598-019-50840-7.
26	The effect of exposure time and concentration of airborne PM(2.5) on lung injury in mice: A transcriptome analysis.Redox Biol. 2019 Sep;26:101264. doi: 10.1016/j.redox.2019.101264. Epub 2019 Jul 2.
27	Tumor cell expression of heat shock protein (HSP) 72 is influenced by HSP72 [HSPA1B A(1267)G] polymorphism and predicts survival in small Cell lung cancer (SCLC) patients.Cancer Invest. 2012 May;30(4):317-22. doi: 10.3109/07357907.2012.657815. Epub 2012 Apr 2.
28	Protective role of genetic polymorphism of heat shock protein 70-2 for gastric cancer risk.Dig Dis Sci. 2009 Jan;54(1):70-4. doi: 10.1007/s10620-008-0313-z. Epub 2008 May 14.
29	Effects of polymorphisms of heat shock protein 70 gene on ischemic stroke, and interaction with smoking in China.Clin Chim Acta. 2007 Sep;384(1-2):64-8. doi: 10.1016/j.cca.2007.05.021. Epub 2007 Jun 2.
30	KEGG-expressed genes and pathways in intervertebral disc degeneration: Protocol for a systematic review and data mining.Medicine (Baltimore). 2019 May;98(21):e15796. doi: 10.1097/MD.0000000000015796.
31	Inhibition of inducible heat shock protein-70 (hsp72) enhances bortezomib-induced cell death in human bladder cancer cells.PLoS One. 2013 Jul 18;8(7):e69509. doi: 10.1371/journal.pone.0069509. Print 2013.
32	Association of heat shock protein70-2 (HSP70-2) gene polymorphism with obesity.Ann Hum Biol. 2016 Nov;43(6):542-546. doi: 10.3109/03014460.2015.1119309. Epub 2016 Feb 10.
33	Hsp70 gene transfer by adeno-associated virus inhibits MPTP-induced nigrostriatal degeneration in the mouse model of Parkinson disease.Mol Ther. 2005 Jan;11(1):80-8. doi: 10.1016/j.ymthe.2004.09.007.
34	In silico analyses for molecular genetic mechanism and candidate genes in patients with Alzheimer's disease.Acta Neurol Belg. 2016 Dec;116(4):543-547. doi: 10.1007/s13760-016-0613-6. Epub 2016 Mar 2.
35	Molecular markers of systemic autoimmune disorders: the expression of MHC-located HSP70 genes is significantly associated with autoimmunity development.Clin Exp Rheumatol. 2017 Jan-Feb;35(1):33-42. Epub 2016 Dec 28.
36	Associations of the NRF2/KEAP1 pathway and antioxidant defense gene polymorphisms with chronic obstructive pulmonary disease.Gene. 2019 Apr 15;692:102-112. doi: 10.1016/j.gene.2018.12.061. Epub 2019 Jan 12.
37	Genetic factors determine extent of bone loss in inflammatory bowel disease.Gastroenterology. 2000 Oct;119(4):909-20. doi: 10.1053/gast.2000.18158.
38	HSP70 Inhibition Limits FAK-Dependent Invasion and Enhances the Response to Melanoma Treatment with BRAF Inhibitors. Cancer Res. 2016 May 1;76(9):2720-30. doi: 10.1158/0008-5472.CAN-15-2137. Epub 2016 Mar 16.
39	The 70 kilodalton heat shock protein is an inhibitor of apoptosis in prostate cancer.Int J Hyperthermia. 2004 Dec;20(8):835-49. doi: 10.1080/02656730410001721807.
40	DNAJB3/HSP-40 cochaperone is downregulated in obese humans and is restored by physical exercise.PLoS One. 2013 Jul 24;8(7):e69217. doi: 10.1371/journal.pone.0069217. Print 2013.
41	Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
42	Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
43	Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
44	Expression of copper-responsive genes in HepG2 cells. Mol Cell Biochem. 2005 Nov;279(1-2):141-7.
45	The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
46	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
47	Gene expression profiles in peripheral lymphocytes by arsenic exposure and skin lesion status in a Bangladeshi population. Cancer Epidemiol Biomarkers Prev. 2006 Jul;15(7):1367-75. doi: 10.1158/1055-9965.EPI-06-0106.
48	Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
49	Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
50	Arsenic trioxide induces de novo protein synthesis of annexin-1 in neutrophils: association with a heat shock-like response and not apoptosis. Br J Haematol. 2008 Feb;140(4):454-63. doi: 10.1111/j.1365-2141.2007.06941.x. Epub 2007 Dec 13.
51	Gene expression after treatment with hydrogen peroxide, menadione, or t-butyl hydroperoxide in breast cancer cells. Cancer Res. 2002 Nov 1;62(21):6246-54.
52	The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
53	Gene expression changes in human small airway epithelial cells exposed to Delta9-tetrahydrocannabinol. Toxicol Lett. 2005 Aug 14;158(2):95-107.
54	Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
55	Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
56	Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
57	Dissecting progressive stages of 5-fluorouracil resistance in vitro using RNA expression profiling. Int J Cancer. 2004 Nov 1;112(2):200-12. doi: 10.1002/ijc.20401.
58	Inhibiting Heat Shock Proteins Can Potentiate the Cytotoxic Effect of Cannabidiol in Human Glioma Cells. Anticancer Res. 2015 Nov;35(11):5827-37.
59	Induction of heme oxygenase-1 by cobalt protoporphyrin enhances the antitumour effect of bortezomib in adult T-cell leukaemia cells. Br J Cancer. 2007 Oct 22;97(8):1099-105. doi: 10.1038/sj.bjc.6604003. Epub 2007 Sep 25.
60	Increased sensitivity for troglitazone-induced cytotoxicity using a human in vitro co-culture model. Toxicol In Vitro. 2009 Oct;23(7):1387-95.
61	Effects of aspirin on metastasis-associated gene expression detected by cDNA microarray. Acta Pharmacol Sin. 2004 Oct;25(10):1327-33.
62	Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
63	Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
64	Induction of HSP70 expression and recruitment of HSC70 and HSP70 in the nucleus reduce aggregation of a polyalanine expansion mutant of PABPN1 in HeLa cells. Hum Mol Genet. 2005 Dec 1;14(23):3673-84. doi: 10.1093/hmg/ddi395. Epub 2005 Oct 20.
65	Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
66	Dose- and time-dependent transcriptional response of Ishikawa cells exposed to genistein. Toxicol Sci. 2016 May;151(1):71-87.
67	Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
68	Induction of hsp 70 in HepG2 cells in response to hepatotoxicants. Toxicol Appl Pharmacol. 1996 Nov;141(1):117-23.
69	Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
70	Gap junctional intercellular communication and cellular response to heat stress. Carcinogenesis. 2003 Nov;24(11):1723-8. doi: 10.1093/carcin/bgg135. Epub 2003 Aug 14.
71	Reactive metabolite of gefitinib activates inflammasomes: implications for gefitinib-induced idiosyncratic reaction. J Toxicol Sci. 2020;45(11):673-680. doi: 10.2131/jts.45.673.
72	Gene expression profile analysis of 4-phenylbutyrate treatment of IB3-1 bronchial epithelial cell line demonstrates a major influence on heat-shock proteins. Physiol Genomics. 2004 Jan 15;16(2):204-11.
73	Sertraline induces endoplasmic reticulum stress in hepatic cells. Toxicology. 2014 Aug 1;322:78-88. doi: 10.1016/j.tox.2014.05.007. Epub 2014 May 24.
74	Consequences of the natural retinoid/retinoid X receptor ligands action in human breast cancer MDA-MB-231 cell line: Focus on functional proteomics. Toxicol Lett. 2017 Nov 5;281:26-34. doi: 10.1016/j.toxlet.2017.09.001. Epub 2017 Sep 5.
75	Increased expression of heat shock protein (HSP)72 in a human proximal tubular cell line (HK-2) with gentamicin-induced injury. J Toxicol Sci. 2006 Feb;31(1):61-70. doi: 10.2131/jts.31.61.
76	Proteomic profile of aminoglutethimide-induced apoptosis in HL-60 cells: role of myeloperoxidase and arylamine free radicals. Chem Biol Interact. 2015 Sep 5;239:129-38.
77	The sunless tanning agent dihydroxyacetone induces stress response gene expression and signaling in cultured human keratinocytes and reconstructed epidermis. Redox Biol. 2020 Sep;36:101594. doi: 10.1016/j.redox.2020.101594. Epub 2020 May 29.
78	D-Penicillamine targets metastatic melanoma cells with induction of the unfolded protein response (UPR) and Noxa (PMAIP1)-dependent mitochondrial apoptosis. Apoptosis. 2012 Oct;17(10):1079-94.
79	Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
80	Molecular mechanisms of resveratrol action in lung cancer cells using dual protein and microarray analyses. Cancer Res. 2007 Dec 15;67(24):12007-17. doi: 10.1158/0008-5472.CAN-07-2464.
81	Impact of epigallocatechin gallate on gene expression profiles of human hepatocellular carcinoma cell lines BEL7404/ADM and BEL7402/5-FU. Ai Zheng. 2008 Oct;27(10):1056-64.
82	Cytotoxic effects of curcumin in human retinal pigment epithelial cells. PLoS One. 2013;8(3):e59603. doi: 10.1371/journal.pone.0059603. Epub 2013 Mar 26.
83	Determination of Protein Haptenation by Chemical Sensitizers Within the Complexity of the Human Skin Proteome. Toxicol Sci. 2018 Apr 1;162(2):429-438. doi: 10.1093/toxsci/kfx265.
84	Impact of Heat Shock Protein 90 Inhibition on the Proteomic Profile of Lung Adenocarcinoma as Measured by Two-Dimensional Electrophoresis Coupled with Mass Spectrometry. Cells. 2019 Jul 31;8(8):806. doi: 10.3390/cells8080806.
85	Keratinocyte gene expression profiles discriminate sensitizing and irritating compounds. Toxicol Sci. 2010 Sep;117(1):81-9.
86	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
87	Synergistic effect of JQ1 and rapamycin for treatment of human osteosarcoma. Int J Cancer. 2015 May 1;136(9):2055-64.
88	Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
89	Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
90	Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
91	Antimutagenicity of cinnamaldehyde and vanillin in human cells: Global gene expression and possible role of DNA damage and repair. Mutat Res. 2007 Mar 1;616(1-2):60-9. doi: 10.1016/j.mrfmmm.2006.11.022. Epub 2006 Dec 18.
92	The quinone methide aurin is a heat shock response inducer that causes proteotoxic stress and Noxa-dependent apoptosis in malignant melanoma cells. J Biol Chem. 2015 Jan 16;290(3):1623-38.
93	Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
94	Gene expression signature-based chemical genomic prediction identifies a novel class of HSP90 pathway modulators. Cancer Cell. 2006 Oct;10(4):321-30.
95	Modulation of Akt and ERK1/2 pathways by resveratrol in chronic myelogenous leukemia (CML) cells results in the downregulation of Hsp70. PLoS One. 2010 Jan 14;5(1):e8719. doi: 10.1371/journal.pone.0008719.
96	Gene expression profiling analysis of bisphenol A-induced perturbation in biological processes in ER-negative HEK293 cells. PLoS One. 2014 Jun 5;9(6):e98635.
97	A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
98	Cystathionine metabolic enzymes play a role in the inflammation resolution of human keratinocytes in response to sub-cytotoxic formaldehyde exposure. Toxicol Appl Pharmacol. 2016 Nov 1;310:185-194.
99	Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
100	Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
101	Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
102	Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
103	In vitro gene expression data supporting a DNA non-reactive genotoxic mechanism for ochratoxin A. Toxicol Appl Pharmacol. 2007 Apr 15;220(2):216-24.
104	Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
105	Cytotoxicity and gene array analysis of alveolar epithelial A549 cells exposed to paraquat. Chem Biol Interact. 2010 Dec 5;188(3):427-36.
106	The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
107	Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
108	Identification of protein targets of 4-hydroxynonenal using click chemistry for ex vivo biotinylation of azido and alkynyl derivatives. Chem Res Toxicol. 2008 Feb;21(2):432-44. doi: 10.1021/tx700347w. Epub 2008 Jan 31.
109	A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
110	Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.
111	Transcriptome-based functional classifiers for direct immunotoxicity. Arch Toxicol. 2014 Mar;88(3):673-89.
112	Adaptive changes in global gene expression profile of lung carcinoma A549 cells acutely exposed to distinct types of AhR ligands. Toxicol Lett. 2018 Aug;292:162-174.
113	Cannabinoid derivatives induce cell death in pancreatic MIA PaCa-2 cells via a receptor-independent mechanism. FEBS Lett. 2006 Mar 20;580(7):1733-9.
114	Identification of biomarkers for the initiation of apoptosis in human preneoplastic colonocytes by proteome analysis. Int J Cancer. 2004 Mar 20;109(2):220-9. doi: 10.1002/ijc.11692.
115	Mechanisms of L-Serine Neuroprotection in vitro Include ER Proteostasis Regulation. Neurotox Res. 2018 Jan;33(1):123-132. doi: 10.1007/s12640-017-9829-3. Epub 2017 Nov 2.
116	Serious carbamazepine-induced hypersensitivity reactions associated with the HSP70 gene cluster. Pharmacogenet Genomics. 2006 Apr;16(4):287-96. doi: 10.1097/01.fpc.0000189800.88596.7a.
117	HSP70 Inhibition Limits FAK-Dependent Invasion and Enhances the Response to Melanoma Treatment with BRAF Inhibitors. Cancer Res. 2016 May 1;76(9):2720-30. doi: 10.1158/0008-5472.CAN-15-2137. Epub 2016 Mar 16.
118	Heat shock protein 72 protects kidney proximal tubule cells from injury induced by triptolide by means of activation of the MEK/ERK pathway. Int J Toxicol. 2009 May-Jun;28(3):177-89. doi: 10.1177/1091581809337418.