Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTI862QH)

• DOT Name: Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A)
• Synonyms: CPT1-L; EC 2.3.1.21; Carnitine O-palmitoyltransferase I, liver isoform; CPT I; CPTI-L; Carnitine palmitoyltransferase 1A
• Gene Name: CPT1A
• Related Disease:
  Carnitine palmitoyl transferase 1A deficiency
  Coronary heart disease
  Psoriatic arthritis
  Acute myelogenous leukaemia
  Adult glioblastoma
  Alzheimer disease
  Arrhythmia
  Breast cancer
  Breast carcinoma
  Carcinoma of liver and intrahepatic biliary tract
  Cardiac failure
  Cardiomyopathy
  Colorectal carcinoma
  Congestive heart failure
  Depression
  Dilated cardiomyopathy 1A
  Epilepsy
  Esophageal squamous cell carcinoma
  Gastric cancer
  Glioblastoma multiforme
  Hepatitis C virus infection
  Hypoglycemia
  Inflammatory bowel disease
  Inherited fatty acid metabolism disorder
  Liver cancer
  Liver cirrhosis
  Metabolic disorder
  Multiple sclerosis
  Myocardial infarction
  Neoplasm
  Nervous system inflammation
  Non-alcoholic steatohepatitis
  Non-insulin dependent diabetes
  Osteoporosis
  Prostate cancer
  Prostate carcinoma
  Stomach cancer
  Type-1/2 diabetes
  Very long chain acyl-CoA dehydrogenase deficiency
  Breast neoplasm
  Carcinoma
  Nasopharyngeal carcinoma
  Hyperlipidemia
  Advanced cancer
  Chronic renal failure
  Fatty liver disease
  Hyperglycemia
  Melanoma
  Non-alcoholic fatty liver disease
  Obesity
• UniProt ID: CPT1A_HUMAN
• PDB ID: 2LE3
• EC Number: 2.3.1.21
• Pfam ID: PF00755 ; PF16484
• Sequence:
  MAEAHQAVAFQFTVTPDGIDLRLSHEALRQIYLSGLHSWKKKFIRFKNGIITGVYPASPS
  SWLIVVVGVMTTMYAKIDPSLGIIAKINRTLETANCMSSQTKNVVSGVLFGTGLWVALIV
  TMRYSLKVLLSYHGWMFTEHGKMSRATKIWMGMVKIFSGRKPMLYSFQTSLPRLPVPAVK
  DTVNRYLQSVRPLMKEEDFKRMTALAQDFAVGLGPRLQWYLKLKSWWATNYVSDWWEEYI
  YLRGRGPLMVNSNYYAMDLLYILPTHIQAARAGNAIHAILLYRRKLDREEIKPIRLLGST
  IPLCSAQWERMFNTSRIPGEETDTIQHMRDSKHIVVYHRGRYFKVWLYHDGRLLKPREME
  QQMQRILDNTSEPQPGEARLAALTAGDRVPWARCRQAYFGRGKNKQSLDAVEKAAFFVTL
  DETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPI
  VAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLL
  ANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREG
  RTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCL
  YVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGY
  GVSYILVGENLINFHISSKFSCPETDSHRFGRHLKEAMTDIITLFGLSSNSKK
• Function: Catalyzes the transfer of the acyl group of long-chain fatty acid-CoA conjugates onto carnitine, an essential step for the mitochondrial uptake of long-chain fatty acids and their subsequent beta-oxidation in the mitochondrion. Plays an important role in hepatic triglyceride metabolism.
• Tissue Specificity: Strong expression in kidney and heart, and lower in liver and skeletal muscle.
• KEGG Pathway:
  Fatty acid degradation (hsa00071)
  Fatty acid metabolism (hsa01212)
  PPAR sig.ling pathway (hsa03320)
  Efferocytosis (hsa04148)
  AMPK sig.ling pathway (hsa04152)
  Thermogenesis (hsa04714)
  Adipocytokine sig.ling pathway (hsa04920)
  Glucagon sig.ling pathway (hsa04922)
  Insulin resistance (hsa04931)
  Alcoholic liver disease (hsa04936)
• Reactome Pathway:
  PPARA activates gene expression (R-HSA-1989781)
  Carnitine metabolism (R-HSA-200425)
  Signaling by Retinoic Acid (R-HSA-5362517)
  RORA activates gene expression (R-HSA-1368082)
• BioCyc Pathway: MetaCyc:HS03286-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

50 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Carnitine palmitoyl transferase 1A deficiency	DISIYS04	Definitive	Autosomal recessive	[1]
Coronary heart disease	DIS5OIP1	Definitive	Biomarker	[2]
Psoriatic arthritis	DISLWTG2	Definitive	Biomarker	[3]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[4]
Adult glioblastoma	DISVP4LU	Strong	Altered Expression	[5]
Alzheimer disease	DISF8S70	Strong	Altered Expression	[6]
Arrhythmia	DISFF2NI	Strong	Altered Expression	[7]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[8]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[8]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Strong	Altered Expression	[9]
Cardiac failure	DISDC067	Strong	Biomarker	[10]
Cardiomyopathy	DISUPZRG	Strong	Biomarker	[11]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[12]
Congestive heart failure	DIS32MEA	Strong	Biomarker	[10]
Depression	DIS3XJ69	Strong	Altered Expression	[13]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Altered Expression	[14]
Epilepsy	DISBB28L	Strong	Genetic Variation	[15]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[16]
Gastric cancer	DISXGOUK	Strong	Biomarker	[17]
Glioblastoma multiforme	DISK8246	Strong	Altered Expression	[5]
Hepatitis C virus infection	DISQ0M8R	Strong	Altered Expression	[18]
Hypoglycemia	DISRCKR7	Strong	Genetic Variation	[19]
Inflammatory bowel disease	DISGN23E	Strong	Biomarker	[20]
Inherited fatty acid metabolism disorder	DISOT51Y	Strong	Biomarker	[21]
Liver cancer	DISDE4BI	Strong	Altered Expression	[9]
Liver cirrhosis	DIS4G1GX	Strong	Genetic Variation	[22]
Metabolic disorder	DIS71G5H	Strong	Biomarker	[23]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[24]
Myocardial infarction	DIS655KI	Strong	Biomarker	[25]
Neoplasm	DISZKGEW	Strong	Biomarker	[26]
Nervous system inflammation	DISB3X5A	Strong	Genetic Variation	[24]
Non-alcoholic steatohepatitis	DIST4788	Strong	Biomarker	[27]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Genetic Variation	[28]
Osteoporosis	DISF2JE0	Strong	Genetic Variation	[29]
Prostate cancer	DISF190Y	Strong	Biomarker	[30]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[30]
Stomach cancer	DISKIJSX	Strong	Biomarker	[17]
Type-1/2 diabetes	DISIUHAP	Strong	Biomarker	[31]
Very long chain acyl-CoA dehydrogenase deficiency	DISB7TEQ	Strong	Genetic Variation	[32]
Breast neoplasm	DISNGJLM	moderate	Biomarker	[33]
Carcinoma	DISH9F1N	moderate	Altered Expression	[34]
Nasopharyngeal carcinoma	DISAOTQ0	moderate	Biomarker	[35]
Hyperlipidemia	DIS61J3S	Disputed	Biomarker	[31]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[36]
Chronic renal failure	DISGG7K6	Limited	Altered Expression	[37]
Fatty liver disease	DIS485QZ	Limited	Biomarker	[38]
Hyperglycemia	DIS0BZB5	Limited	Biomarker	[39]
Melanoma	DIS1RRCY	Limited	Genetic Variation	[40]
Non-alcoholic fatty liver disease	DISDG1NL	Limited	Altered Expression	[41]
Obesity	DIS47Y1K	Limited	Biomarker	[42]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A) affects the response to substance of Fluorouracil.	[86]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[43]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[75]

49 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[44]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[45]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[46]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[47]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[48]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[49]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[50]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[51]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[52]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[53]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[54]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[55]
Aspirin	DM672AH	Approved	Aspirin increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[56]
Paclitaxel	DMLB81S	Approved	Paclitaxel decreases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[57]
Diclofenac	DMPIHLS	Approved	Diclofenac increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[53]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[58]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[59]
Fenofibrate	DMFKXDY	Approved	Fenofibrate increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[60]
Capsaicin	DMGMF6V	Approved	Capsaicin increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[61]
Liothyronine	DM6IR3P	Approved	Liothyronine increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[62]
Hydrocortisone	DMGEMB7	Approved	Hydrocortisone decreases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[63]
Bezafibrate	DMZDCS0	Approved	Bezafibrate increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[64]
Orlistat	DMRJSP8	Approved	Orlistat decreases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[57]
Eicosapentaenoic acid/docosa-hexaenoic acid	DMMUCG4	Approved	Eicosapentaenoic acid/docosa-hexaenoic acid increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[65]
Clofibrate	DMPC1J7	Approved	Clofibrate increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[66]
Benzbromarone	DMC3YUA	Approved	Benzbromarone increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[67]
Urea	DMUK75B	Approved	Urea increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[68]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[69]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[62]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[66]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone affects the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[70]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[71]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[47]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[72]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[73]
PIRINIXIC ACID	DM82Y75	Preclinical	PIRINIXIC ACID increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[74]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[76]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid decreases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[77]
D-glucose	DMMG2TO	Investigative	D-glucose decreases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[78]
Arachidonic acid	DMUOQZD	Investigative	Arachidonic acid increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[65]
Daidzein	DMRFTJX	Investigative	Daidzein increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[66]
Oleic acid	DM54O1Z	Investigative	Oleic acid decreases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[79]
GW7647	DM9RD0C	Investigative	GW7647 increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[80]
Benzoquinone	DMNBA0G	Investigative	Benzoquinone decreases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[81]
OXYRESVERATROL	DMN7S4L	Investigative	OXYRESVERATROL increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[82]
Alpha-linolenic acid	DMY64HE	Investigative	Alpha-linolenic acid increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[65]
Fibrates	DMFNTMY	Investigative	Fibrates increases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[83]
GSK-0660	DMNIVOX	Investigative	GSK-0660 decreases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[84]
GSK-3787	DMKDLB7	Investigative	GSK-3787 decreases the expression of Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A).	[85]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Pro-angiogenic Role of Danqi Pill Through Activating Fatty Acids Oxidation Pathway Against Coronary Artery Disease.Front Pharmacol. 2018 Dec 4;9:1414. doi: 10.3389/fphar.2018.01414. eCollection 2018.
• [3] Vitamin D Ameliorates Fat Accumulation with AMPK/SIRT1 Activity in C2C12 Skeletal Muscle Cells.Nutrients. 2019 Nov 17;11(11):2806. doi: 10.3390/nu11112806.
• [4] High Expression of CPT1A Predicts Adverse Outcomes: A Potential Therapeutic Target for Acute Myeloid Leukemia.EBioMedicine. 2016 Dec;14:55-64. doi: 10.1016/j.ebiom.2016.11.025. Epub 2016 Nov 22.
• [5] High grade glioblastoma is associated with aberrant expression of ZFP57, a protein involved in gene imprinting, and of CPT1A and CPT1C that regulate fatty acid metabolism.Cancer Biol Ther. 2014 Jun 1;15(6):735-41. doi: 10.4161/cbt.28408. Epub 2014 Mar 11.
• [6] PPAR/-agonist GW0742 ameliorates dysfunction in fatty acid oxidation in PSEN1E9 astrocytes.Glia. 2019 Jan;67(1):146-159. doi: 10.1002/glia.23534. Epub 2018 Nov 19.
• [7] Vagus nerve stimulation exerts cardioprotection against myocardial ischemia/reperfusion injury predominantly through its efferent vagal fibers.Basic Res Cardiol. 2018 May 9;113(4):22. doi: 10.1007/s00395-018-0683-0.
• [8] Long noncoding RNA nuclear paraspeckle assembly transcript 1 interacts with microRNA?07 to modulate breast cancer growth and metastasis by targeting carnitine palmitoyltransferase?.Int J Oncol. 2019 Nov;55(5):1125-1136. doi: 10.3892/ijo.2019.4869. Epub 2019 Sep 4.
• [9] Rhesus monkey model of liver disease reflecting clinical disease progression and hepatic gene expression analysis.Sci Rep. 2015 Oct 7;5:15019. doi: 10.1038/srep15019.
• [10] Targeting mitochondrial oxidative metabolism as an approach to treat heart failure.Biochim Biophys Acta. 2013 Apr;1833(4):857-65. doi: 10.1016/j.bbamcr.2012.08.014. Epub 2012 Aug 31.
• [11] Clinical and genetic characteristics of patients with fatty acid oxidation disorders identified by newborn screening.BMC Pediatr. 2018 Mar 8;18(1):103. doi: 10.1186/s12887-018-1069-z.
• [12] CPT1A-mediated fatty acid oxidation promotes colorectal cancer cell metastasis by inhibiting anoikis.Oncogene. 2018 Nov;37(46):6025-6040. doi: 10.1038/s41388-018-0384-z. Epub 2018 Jul 11.
• [13] Blocking of carnitine palmitoyl transferase 1 potently reduces stress-induced depression in rat highlighting a pivotal role of lipid metabolism.Sci Rep. 2017 May 19;7(1):2158. doi: 10.1038/s41598-017-02343-6.
• [14] 4-O-methylhonokiol protects against diabetic cardiomyopathy in type 2 diabetic mice by activation of AMPK-mediated cardiac lipid metabolism improvement.J Cell Mol Med. 2019 Aug;23(8):5771-5781. doi: 10.1111/jcmm.14493. Epub 2019 Jun 14.
• [15] Association of CYP2C9, CYP2A6, ACSM2A, and CPT1A gene polymorphisms with adverse effects of valproic acid in Chinese patients with epilepsy.Epilepsy Res. 2017 May;132:64-69. doi: 10.1016/j.eplepsyres.2017.02.015. Epub 2017 Feb 27.
• [16] Genomic alterations with impact on survival in esophageal squamous cell carcinoma identified by array comparative genomic hybridization.Genes Chromosomes Cancer. 2011 Jul;50(7):518-26. doi: 10.1002/gcc.20875. Epub 2011 Apr 11.
• [17] CPT1A-mediated succinylation of S100A10 increases human gastric cancer invasion.J Cell Mol Med. 2019 Jan;23(1):293-305. doi: 10.1111/jcmm.13920. Epub 2018 Nov 5.
• [18] Development of an in vitro model to study hepatitis C virus effects on hepatocellular lipotoxicity and lipid metabolism.Pathol Res Pract. 2018 Oct;214(10):1700-1706. doi: 10.1016/j.prp.2018.08.013. Epub 2018 Aug 19.
• [19] Impaired fasting tolerance among Alaska native children with a common carnitine palmitoyltransferase 1A sequence variant.Mol Genet Metab. 2011 Nov;104(3):261-4. doi: 10.1016/j.ymgme.2011.06.017. Epub 2011 Jun 28.
• [20] Quiescent Endothelial Cells Upregulate Fatty Acid -Oxidation for Vasculoprotection via Redox Homeostasis.Cell Metab. 2018 Dec 4;28(6):881-894.e13. doi: 10.1016/j.cmet.2018.07.016. Epub 2018 Aug 23.
• [21] Homozygous carnitine palmitoyltransferase 1a (liver isoform) deficiency is lethal in the mouse.Mol Genet Metab. 2005 Sep-Oct;86(1-2):179-87. doi: 10.1016/j.ymgme.2005.07.021.
• [22] Identification of two gene variants associated with risk of advanced fibrosis in patients with chronic hepatitis C.Gastroenterology. 2006 May;130(6):1679-87. doi: 10.1053/j.gastro.2006.02.032. Epub 2006 Mar 6.
• [23] Establishing a relationship between prolactin and altered fatty acid -oxidation via carnitine palmitoyl transferase 1 in breast cancer cells.BMC Cancer. 2011 Feb 4;11:56. doi: 10.1186/1471-2407-11-56.
• [24] CPT1A plays a key role in the development and treatment of multiple sclerosis and experimental autoimmune encephalomyelitis.Sci Rep. 2019 Sep 16;9(1):13299. doi: 10.1038/s41598-019-49868-6.
• [25] Qiliqiangxin Attenuates Adverse Cardiac Remodeling after Myocardial Infarction in Ovariectomized Mice via Activation of PPAR.Cell Physiol Biochem. 2017;42(3):876-888. doi: 10.1159/000478641. Epub 2017 Jun 23.
• [26] Dual inhibition of glutaminase and carnitine palmitoyltransferase decreases growth and migration of glutaminase inhibition-resistant triple-negative breast cancer cells. J Biol Chem. 2019 Jun 14;294(24):9342-9357.
• [27] Hepatic regulation of VLDL receptor by PPAR/ and FGF21 modulates non-alcoholic fatty liver disease.Mol Metab. 2018 Feb;8:117-131. doi: 10.1016/j.molmet.2017.12.008. Epub 2017 Dec 19.
• [28] Epigenome-wide association study in whole blood on type 2 diabetes among sub-Saharan African individuals: findings from the RODAM study.Int J Epidemiol. 2019 Feb 1;48(1):58-70. doi: 10.1093/ije/dyy171.
• [29] Functional relevance for associations between osteoporosis and genetic variants.PLoS One. 2017 Apr 3;12(4):e0174808. doi: 10.1371/journal.pone.0174808. eCollection 2017.
• [30] Lipid catabolism inhibition sensitizes prostate cancer cells to antiandrogen blockade.Oncotarget. 2017 Apr 21;8(34):56051-56065. doi: 10.18632/oncotarget.17359. eCollection 2017 Aug 22.
• [31] Lipid-associated metabolic signalling networks in pancreatic beta cell function.Diabetologia. 2020 Jan;63(1):10-20. doi: 10.1007/s00125-019-04976-w. Epub 2019 Aug 19.
• [32] Follow-up of fatty acid -oxidation disorders in expanded newborn screening era.Eur J Pediatr. 2019 Mar;178(3):387-394. doi: 10.1007/s00431-018-03315-2. Epub 2019 Jan 7.
• [33] CPT1A regulates breast cancer-associated lymphangiogenesis via VEGF signaling.Biomed Pharmacother. 2018 Oct;106:1-7. doi: 10.1016/j.biopha.2018.05.112. Epub 2018 Jun 23.
• [34] Carnitine palmitoyltransferase 1A functions to repress FoxO transcription factors to allow cell cycle progression in ovarian cancer.Oncotarget. 2016 Jan 26;7(4):3832-46. doi: 10.18632/oncotarget.6757.
• [35] PGC1/CEBPB/CPT1A axis promotes radiation resistance of nasopharyngeal carcinoma through activating fatty acid oxidation.Cancer Sci. 2019 Jun;110(6):2050-2062. doi: 10.1111/cas.14011. Epub 2019 May 3.
• [36] Effects of carnitine palmitoyltransferases on cancer cellular senescence.J Cell Physiol. 2019 Feb;234(2):1707-1719. doi: 10.1002/jcp.27042. Epub 2018 Aug 2.
• [37] Adiponectin receptor and adiponectin signaling in human tissue among patients with end-stage renal disease.Nephrol Dial Transplant. 2014 Dec;29(12):2268-77. doi: 10.1093/ndt/gfu249. Epub 2014 Jul 21.
• [38] Diet-induced hepatic steatosis activates Ras to promote hepatocarcinogenesis via CPT1.Cancer Lett. 2019 Feb 1;442:40-52. doi: 10.1016/j.canlet.2018.10.024. Epub 2018 Oct 26.
• [39] Regulatory enzymes of mitochondrial beta-oxidation as targets for treatment of the metabolic syndrome.Obes Rev. 2010 May;11(5):380-8. doi: 10.1111/j.1467-789X.2009.00642.x. Epub 2009 Aug 20.
• [40] Targeting CPT1A enhances metabolic therapy in human melanoma cells with the BRAF V600E mutation.Int J Biochem Cell Biol. 2016 Dec;81(Pt A):76-81. doi: 10.1016/j.biocel.2016.10.019. Epub 2016 Oct 25.
• [41] Raw Bowl Tea (Tuocha) Polyphenol Prevention of Nonalcoholic Fatty Liver Disease by Regulating Intestinal Function in Mice.Biomolecules. 2019 Sep 1;9(9):435. doi: 10.3390/biom9090435.
• [42] Lentivirus-mediated CTRP6 silencing ameliorates diet-induced obesity in mice.Exp Cell Res. 2018 Jun 1;367(1):15-23. doi: 10.1016/j.yexcr.2018.01.027. Epub 2018 Jan 31.
• [43] Integrated 'omics analysis reveals new drug-induced mitochondrial perturbations in human hepatocytes. Toxicol Lett. 2018 Jun 1;289:1-13.
• [44] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [45] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [46] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [47] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [48] Chronic occupational exposure to arsenic induces carcinogenic gene signaling networks and neoplastic transformation in human lung epithelial cells. Toxicol Appl Pharmacol. 2012 Jun 1;261(2):204-16.
• [49] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [50] The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
• [51] JunD is involved in the antiproliferative effect of Delta9-tetrahydrocannabinol on human breast cancer cells. Oncogene. 2008 Aug 28;27(37):5033-44.
• [52] Zoledronate dysregulates fatty acid metabolism in renal tubular epithelial cells to induce nephrotoxicity. Arch Toxicol. 2018 Jan;92(1):469-485.
• [53] Species-specific toxicity of diclofenac and troglitazone in primary human and rat hepatocytes. Chem Biol Interact. 2009 Apr 15;179(1):17-24.
• [54] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [55] Dihydroartemisinin protects against alcoholic liver injury through alleviating hepatocyte steatosis in a farnesoid X receptor-dependent manner. Toxicol Appl Pharmacol. 2017 Jan 15;315:23-34. doi: 10.1016/j.taap.2016.12.001. Epub 2016 Dec 6.
• [56] Aspirin regulates hepatocellular lipid metabolism by activating AMPK signaling pathway. J Toxicol Sci. 2015 Feb;40(1):127-36. doi: 10.2131/jts.40.127.
• [57] Orlistat Displays Antitumor Activity and Enhances the Efficacy of Paclitaxel in Human Hepatoma Hep3B Cells. Chem Res Toxicol. 2019 Feb 18;32(2):255-264. doi: 10.1021/acs.chemrestox.8b00269. Epub 2019 Jan 22.
• [58] CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
• [59] Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
• [60] Immunoselection and characterization of a human genomic PPAR binding fragment located within POTE genes. Biochimie. 2007 Mar;89(3):329-36. doi: 10.1016/j.biochi.2006.09.017. Epub 2006 Oct 18.
• [61] Capsaicin attenuates palmitate-induced expression of macrophage inflammatory protein 1 and interleukin 8 by increasing palmitate oxidation and reducing c-Jun activation in THP-1 (human acute monocytic leukemia cell) cells. Nutr Res. 2011 Jun;31(6):468-78. doi: 10.1016/j.nutres.2011.05.007. Epub 2011 Jun 17.
• [62] Role of sirtuin 1 in the regulation of hepatic gene expression by thyroid hormone. J Biol Chem. 2013 Jan 11;288(2):807-18. doi: 10.1074/jbc.M112.437970. Epub 2012 Dec 3.
• [63] Prenatal caffeine exposure increases the susceptibility to non-alcoholic fatty liver disease in female offspring rats via activation of GR-C/EBP-SIRT1 pathway. Toxicology. 2019 Apr 1;417:23-34. doi: 10.1016/j.tox.2019.02.008. Epub 2019 Feb 15.
• [64] Osthole, a potential antidiabetic agent, alleviates hyperglycemia in db/db mice. Chem Biol Interact. 2009 Oct 30;181(3):309-15. doi: 10.1016/j.cbi.2009.08.003. Epub 2009 Aug 12.
• [65] Polyunsaturated fatty acids are FXR ligands and differentially regulate expression of FXR targets. DNA Cell Biol. 2004 Aug;23(8):519-26. doi: 10.1089/1044549041562267.
• [66] Positive regulation of hepatic carnitine palmitoyl transferase 1A (CPT1A) activities by soy isoflavones and L-carnitine. Eur J Nutr. 2006 Mar;45(3):159-64. doi: 10.1007/s00394-005-0576-5. Epub 2005 Dec 20.
• [67] Hepatocellular toxicity of benzbromarone: effects on mitochondrial function and structure. Toxicology. 2014 Oct 3;324:136-46. doi: 10.1016/j.tox.2014.08.002. Epub 2014 Aug 7.
• [68] Activation of peroxisome proliferator-activated receptor alpha by substituted urea-derived soluble epoxide hydrolase inhibitors. J Pharmacol Exp Ther. 2005 Jul;314(1):260-70. doi: 10.1124/jpet.105.085605. Epub 2005 Mar 29.
• [69] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [70] Hepatic cells derived from human skin progenitors show a typical phospholipidotic response upon exposure to amiodarone. Toxicol Lett. 2018 Mar 1;284:184-194. doi: 10.1016/j.toxlet.2017.11.014. Epub 2017 Dec 15.
• [71] Cytoprotective properties of alpha-tocopherol are related to gene regulation in cultured D-galactosamine-treated human hepatocytes. Free Radic Biol Med. 2007 Nov 15;43(10):1439-52.
• [72] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [73] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [74] Activation of sterol regulatory element-binding proteins in mice exposed to perfluorooctanoic acid for 28?days. Arch Toxicol. 2015 Sep;89(9):1569-78. doi: 10.1007/s00204-014-1322-7. Epub 2014 Aug 6.
• [75] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [76] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [77] Exendin-4, a glucagon-like peptide-1 receptor agonist, reduces hepatic steatosis and endoplasmic reticulum stress by inducing nuclear factor erythroid-derived 2-related factor 2 nuclear translocation. Toxicol Appl Pharmacol. 2018 Dec 1;360:18-29.
• [78] Transcriptional Regulation of Human Arylamine N-Acetyltransferase 2 Gene by Glucose and Insulin in Liver Cancer Cell Lines. Toxicol Sci. 2022 Nov 23;190(2):158-172. doi: 10.1093/toxsci/kfac103.
• [79] Sorafenib reduces steatosis-induced fibrogenesis in a human 3D co-culture model of non-alcoholic fatty liver disease. Environ Toxicol. 2021 Feb;36(2):168-176. doi: 10.1002/tox.23021. Epub 2020 Sep 12.
• [80] Hepatic Aryl Hydrocarbon Receptor Attenuates Fibroblast Growth Factor 21 Expression. J Biol Chem. 2016 Jul 15;291(29):15378-87. doi: 10.1074/jbc.M116.715151. Epub 2016 May 25.
• [81] l-Carnitine protects against 1,4-benzoquinone-induced apoptosis and DNA damage by suppressing oxidative stress and promoting fatty acid oxidation in K562 cells. Environ Toxicol. 2020 Oct;35(10):1033-1042. doi: 10.1002/tox.22939. Epub 2020 Jun 1.
• [82] Oxyresveratrol ameliorates nonalcoholic fatty liver disease by regulating hepatic lipogenesis and fatty acid oxidation through liver kinase B1 and AMP-activated protein kinase. Chem Biol Interact. 2018 Jun 1;289:68-74. doi: 10.1016/j.cbi.2018.04.023. Epub 2018 Apr 24.
• [83] Decrease of hepatic stellate cells in rats with enhanced sensitivity to clofibrate-induced hepatocarcinogenesis. Cancer Sci. 2011 Apr;102(4):735-41. doi: 10.1111/j.1349-7006.2011.01856.x. Epub 2011 Feb 10.
• [84] (9)-Tetrahydrocannabinol upregulates fatty acid 2-hydroxylase (FA2H) via PPAR induction: A possible evidence for the cancellation of PPAR/-mediated inhibition of PPAR in MDA-MB-231?cells. Arch Biochem Biophys. 2019 Feb 15;662:219-225. doi: 10.1016/j.abb.2018.12.011. Epub 2018 Dec 13.
• [85] Cellular and pharmacological selectivity of the peroxisome proliferator-activated receptor-beta/delta antagonist GSK3787. Mol Pharmacol. 2010 Sep;78(3):419-30. doi: 10.1124/mol.110.065508. Epub 2010 Jun 1.
• [86] Mechanistic and predictive profiling of 5-Fluorouracil resistance in human cancer cells. Cancer Res. 2004 Nov 15;64(22):8167-76. doi: 10.1158/0008-5472.CAN-04-0970.