Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLLBX48)

DOT Name	Cytochrome P450 1A2 (CYP1A2)
Synonyms	EC 1.14.14.1; CYPIA2; Cholesterol 25-hydroxylase; Cytochrome P(3)450; Cytochrome P450 4; Cytochrome P450-P3; Hydroperoxy icosatetraenoate dehydratase; EC 4.2.1.152
Gene Name	CYP1A2
UniProt ID	CP1A2_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	2HI4
EC Number	1.14.14.1; 4.2.1.152
Pfam ID	PF00067
Sequence	MALSQSVPFSATELLLASAIFCLVFWVLKGLRPRVPKGLKSPPEPWGWPLLGHVLTLGKN PHLALSRMSQRYGDVLQIRIGSTPVLVLSRLDTIRQALVRQGDDFKGRPDLYTSTLITDG QSLTFSTDSGPVWAARRRLAQNALNTFSIASDPASSSSCYLEEHVSKEAKALISRLQELM AGPGHFDPYNQVVVSVANVIGAMCFGQHFPESSDEMLSLVKNTHEFVETASSGNPLDFFP ILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGN LIPQEKIVNLVNDIFGAGFDTVTTAISWSLMYLVTKPEIQRKIQKELDTVIGRERRPRLS DRPQLPYLEAFILETFRHSSFLPFTIPHSTTRDTTLNGFYIPKKCCVFVNQWQVNHDPEL WEDPSEFRPERFLTADGTAINKPLSEKMMLFGMGKRRCIGEVLAKWEIFLFLAILLQQLE FSVPPGVKVDLTPIYGLTMKHARCEHVQARLRFSIN
Function	A cytochrome P450 monooxygenase involved in the metabolism of various endogenous substrates, including fatty acids, steroid hormones and vitamins. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase). Catalyzes the hydroxylation of carbon-hydrogen bonds. Exhibits high catalytic activity for the formation of hydroxyestrogens from estrone (E1) and 17beta-estradiol (E2), namely 2-hydroxy E1 and E2. Metabolizes cholesterol toward 25-hydroxycholesterol, a physiological regulator of cellular cholesterol homeostasis. May act as a major enzyme for all-trans retinoic acid biosynthesis in the liver. Catalyzes two successive oxidative transformation of all-trans retinol to all-trans retinal and then to the active form all-trans retinoic acid. Primarily catalyzes stereoselective epoxidation of the last double bond of polyunsaturated fatty acids (PUFA), displaying a strong preference for the (R,S) stereoisomer. Catalyzes bisallylic hydroxylation and omega-1 hydroxylation of PUFA. May also participate in eicosanoids metabolism by converting hydroperoxide species into oxo metabolites (lipoxygenase-like reaction, NADPH-independent). Plays a role in the oxidative metabolism of xenobiotics. Catalyzes the N-hydroxylation of heterocyclic amines and the O-deethylation of phenacetin. Metabolizes caffeine via N3-demethylation (Probable).
Tissue Specificity	Liver.
KEGG Pathway	Steroid hormone biosynthesis (hsa00140 ) Caffeine metabolism (hsa00232 ) Tryptophan metabolism (hsa00380 ) Linoleic acid metabolism (hsa00591 ) Retinol metabolism (hsa00830 ) Metabolism of xenobiotics by cytochrome P450 (hsa00980 ) Drug metabolism - cytochrome P450 (hsa00982 ) Metabolic pathways (hsa01100 ) Chemical carcinogenesis - D. adducts (hsa05204 ) Chemical carcinogenesis - receptor activation (hsa05207 ) Chemical carcinogenesis - reactive oxygen species (hsa05208 )
Reactome Pathway	Aromatic amines can be N-hydroxylated or N-dealkylated by CYP1A2 (R-HSA-211957 ) Synthesis of epoxy (EET) and dihydroxyeicosatrienoic acids (DHET) (R-HSA-2142670 ) Synthesis of (16-20)-hydroxyeicosatetraenoic acids (HETE) (R-HSA-2142816 ) Aflatoxin activation and detoxification (R-HSA-5423646 ) Biosynthesis of protectins (R-HSA-9018681 ) Biosynthesis of maresin-like SPMs (R-HSA-9027307 ) Methylation (R-HSA-156581 )
BioCyc Pathway	MetaCyc:HS06728-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 14 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Diethylstilbestrol	DMN3UXQ	Approved	Cytochrome P450 1A2 (CYP1A2) affects the response to substance of Diethylstilbestrol.	[73]
Estrone	DM5T6US	Approved	Cytochrome P450 1A2 (CYP1A2) affects the binding of Estrone.	[76]
Docetaxel	DMDI269	Approved	Cytochrome P450 1A2 (CYP1A2) affects the response to substance of Docetaxel.	[77]
Chlorothiazide	DMLHESP	Approved	Cytochrome P450 1A2 (CYP1A2) increases the Myocardial infarction ADR of Chlorothiazide.	[78]
Flutamide	DMK0O7U	Approved	Cytochrome P450 1A2 (CYP1A2) increases the response to substance of Flutamide.	[81]
Sulfasalazine	DMICA9H	Approved	Cytochrome P450 1A2 (CYP1A2) increases the Leukopenias NEC ADR of Sulfasalazine.	[82]
Clonidine	DM6RZ9Q	Approved	Cytochrome P450 1A2 (CYP1A2) increases the Drug level increased ADR of Clonidine.	[82]
Luvox	DMJKROX	Approved	Cytochrome P450 1A2 (CYP1A2) increases the response to substance of Luvox.	[90]
Caffeine	DMKBJWP	Approved	Cytochrome P450 1A2 (CYP1A2) increases the Non-fatal myocardial infarction ADR of Caffeine.	[78]
Dihydralazine	DMZIXU9	Approved	Cytochrome P450 1A2 (CYP1A2) increases the Hepatotoxicity ADR of Dihydralazine.	[82]
Phenol	DM1QSM3	Phase 2/3	Cytochrome P450 1A2 (CYP1A2) affects the response to substance of Phenol.	[73]
Flavonoid derivative 1	DMCQP0B	Patented	Cytochrome P450 1A2 (CYP1A2) increases the response to substance of Flavonoid derivative 1.	[101]
BRN-3548355	DM4KXT0	Investigative	Cytochrome P450 1A2 (CYP1A2) increases the activity of BRN-3548355.	[107]
DIOSMETIN	DM4KXIM	Investigative	Cytochrome P450 1A2 (CYP1A2) increases the response to substance of DIOSMETIN.	[101]
------------------------------------------------------------------------------------


⏷ Show the Full List of 14 Drug(s)

This DOT Affected the Biotransformations of 25 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Ethinyl estradiol	DMODJ40	Approved	Cytochrome P450 1A2 (CYP1A2) increases the hydroxylation of Ethinyl estradiol.	[74]
Melatonin	DMKWFBT	Approved	Cytochrome P450 1A2 (CYP1A2) decreases the methylation of Melatonin.	[79]
Mefenamic acid	DMK7HFI	Approved	Cytochrome P450 1A2 (CYP1A2) increases the glutathionylation of Mefenamic acid.	[83]
Amphetamine	DMSZQAK	Approved	Cytochrome P450 1A2 (CYP1A2) decreases the methylation of Amphetamine.	[84]
Clopidogrel	DMOL54H	Approved	Cytochrome P450 1A2 (CYP1A2) increases the oxidation of Clopidogrel.	[85]
Imiquimod	DM1TMA3	Approved	Cytochrome P450 1A2 (CYP1A2) increases the chemical synthesis of Imiquimod.	[86]
Domperidone	DMBDPY0	Approved	Cytochrome P450 1A2 (CYP1A2) increases the hydroxylation of Domperidone.	[89]
Almogran	DM7I64Z	Approved	Cytochrome P450 1A2 (CYP1A2) decreases the methylation of Almogran.	[91]
Triamterene	DM2HU9I	Approved	Cytochrome P450 1A2 (CYP1A2) increases the hydroxylation of Triamterene.	[93]
Chlorpromazine	DMBGZI3	Phase 3 Trial	Cytochrome P450 1A2 (CYP1A2) decreases the methylation of Chlorpromazine.	[94]
Genistein	DM0JETC	Phase 2/3	Cytochrome P450 1A2 (CYP1A2) increases the chemical synthesis of Genistein.	[95]
N-DESMETHYLCLOZAPINE	DMVIRN3	Phase 2	Cytochrome P450 1A2 (CYP1A2) increases the chemical synthesis of N-DESMETHYLCLOZAPINE.	[90]
Saracatinib	DMBLHGP	Phase 2	Cytochrome P450 1A2 (CYP1A2) increases the oxidation of Saracatinib.	[97]
Vadimezan	DMK7CYX	Phase 2	Cytochrome P450 1A2 (CYP1A2) increases the oxidation of Vadimezan.	[98]
PMID28460551-Compound-2	DM4DOUB	Patented	Cytochrome P450 1A2 (CYP1A2) increases the chemical synthesis of PMID28460551-Compound-2.	[99]
PMID28870136-Compound-48	DMPIM9L	Patented	Cytochrome P450 1A2 (CYP1A2) increases the chemical synthesis of PMID28870136-Compound-48.	[100]
PMID28870136-Compound-50	DM42OYU	Patented	Cytochrome P450 1A2 (CYP1A2) increases the chemical synthesis of PMID28870136-Compound-50.	[100]
Phenacetin	DMRQAM0	Withdrawn from market	Cytochrome P450 1A2 (CYP1A2) decreases the ethylation of Phenacetin.	[102]
EMODIN	DMAEDQG	Terminated	Cytochrome P450 1A2 (CYP1A2) increases the hydroxylation of EMODIN.	[104]
Nimesulide	DMR1NMD	Terminated	Cytochrome P450 1A2 (CYP1A2) increases the glutathionylation of Nimesulide.	[105]
Piceatannol	DMYOP45	Investigative	Cytochrome P450 1A2 (CYP1A2) affects the chemical synthesis of Piceatannol.	[109]
2-hydroxy-17beta-estradiol	DMM9Z0B	Investigative	Cytochrome P450 1A2 (CYP1A2) increases the chemical synthesis of 2-hydroxy-17beta-estradiol.	[111]
ACMC-1AKLT	DMRQ70X	Investigative	Cytochrome P450 1A2 (CYP1A2) increases the chemical synthesis of ACMC-1AKLT.	[54]
Bufuralol	DMJSC07	Investigative	Cytochrome P450 1A2 (CYP1A2) increases the hydroxylation of Bufuralol.	[114]
Chloroben	DMY40UB	Investigative	Cytochrome P450 1A2 (CYP1A2) increases the oxidation of Chloroben.	[115]
------------------------------------------------------------------------------------


⏷ Show the Full List of 25 Drug(s)

This DOT Affected the Regulation of Drug Effects of 16 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Methamphetamine	DMPM4SK	Approved	Cytochrome P450 1A2 (CYP1A2) affects the metabolism of Methamphetamine.	[75]
Tofacitinib	DMBS370	Approved	Cytochrome P450 1A2 (CYP1A2) increases the metabolism of Tofacitinib.	[80]
Bromfenac	DMKB79O	Approved	Cytochrome P450 1A2 (CYP1A2) increases the metabolism of Bromfenac.	[87]
Dextromethorphan	DMUDJZM	Approved	Cytochrome P450 1A2 (CYP1A2) affects the metabolism of Dextromethorphan.	[88]
Selegiline	DM6034S	Approved	Cytochrome P450 1A2 (CYP1A2) affects the metabolism of Selegiline.	[92]
Afimoxifene	DMFORDT	Phase 2	Cytochrome P450 1A2 (CYP1A2) increases the metabolism of Afimoxifene.	[96]
(Z)-endoxifen	DMGDOS2	Phase 2	Cytochrome P450 1A2 (CYP1A2) increases the metabolism of (Z)-endoxifen.	[96]
Nobiletin	DM7R3B6	Preclinical	Cytochrome P450 1A2 (CYP1A2) increases the metabolism of Nobiletin.	[103]
Coumarin	DM0N8ZM	Investigative	Cytochrome P450 1A2 (CYP1A2) increases the metabolism of Coumarin.	[106]
NAPQI	DM8F5LR	Investigative	Cytochrome P450 1A2 (CYP1A2) increases the abundance of NAPQI.	[108]
Ellipticine	DMHPYSM	Investigative	Cytochrome P450 1A2 (CYP1A2) increases the metabolism of Ellipticine.	[110]
9-phenanthrol	DMJFBQ1	Investigative	Cytochrome P450 1A2 (CYP1A2) increases the abundance of 9-phenanthrol.	[112]
Imipramine oxide	DMZKABS	Investigative	Cytochrome P450 1A2 (CYP1A2) increases the abundance of Imipramine oxide.	[113]
2-(1H-indol-3-yl)-N,N-dimethylethanamine	DMR9Q4Y	Investigative	Cytochrome P450 1A2 (CYP1A2) increases the metabolism of 2-(1H-indol-3-yl)-N,N-dimethylethanamine.	[113]
SCUTELLAREIN	DMJD03I	Investigative	Cytochrome P450 1A2 (CYP1A2) affects the metabolism of SCUTELLAREIN.	[116]
Triazine	DM8LYSB	Investigative	Cytochrome P450 1A2 (CYP1A2) increases the metabolism of Triazine.	[117]
------------------------------------------------------------------------------------


⏷ Show the Full List of 16 Drug(s)

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Cytochrome P450 1A2 (CYP1A2).	[1]
------------------------------------------------------------------------------------

98 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Cytochrome P450 1A2 (CYP1A2).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Cytochrome P450 1A2 (CYP1A2).	[3]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Cytochrome P450 1A2 (CYP1A2).	[4]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Cytochrome P450 1A2 (CYP1A2).	[5]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Cytochrome P450 1A2 (CYP1A2).	[6]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Cytochrome P450 1A2 (CYP1A2).	[7]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Cytochrome P450 1A2 (CYP1A2).	[8]
Carbamazepine	DMZOLBI	Approved	Carbamazepine increases the expression of Cytochrome P450 1A2 (CYP1A2).	[9]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Cytochrome P450 1A2 (CYP1A2).	[10]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Cytochrome P450 1A2 (CYP1A2).	[11]
Phenobarbital	DMXZOCG	Approved	Phenobarbital increases the expression of Cytochrome P450 1A2 (CYP1A2).	[12]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[13]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Cytochrome P450 1A2 (CYP1A2).	[14]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[15]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Cytochrome P450 1A2 (CYP1A2).	[16]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of Cytochrome P450 1A2 (CYP1A2).	[17]
Etoposide	DMNH3PG	Approved	Etoposide increases the expression of Cytochrome P450 1A2 (CYP1A2).	[18]
Paclitaxel	DMLB81S	Approved	Paclitaxel decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[19]
Diclofenac	DMPIHLS	Approved	Diclofenac increases the expression of Cytochrome P450 1A2 (CYP1A2).	[20]
Nicotine	DMWX5CO	Approved	Nicotine decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[21]
Malathion	DMXZ84M	Approved	Malathion increases the expression of Cytochrome P450 1A2 (CYP1A2).	[22]
Permethrin	DMZ0Q1G	Approved	Permethrin increases the expression of Cytochrome P450 1A2 (CYP1A2).	[20]
Azacitidine	DMTA5OE	Approved	Azacitidine increases the expression of Cytochrome P450 1A2 (CYP1A2).	[23]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid decreases the expression of Cytochrome P450 1A2 (CYP1A2).	[24]
Rifampicin	DM5DSFZ	Approved	Rifampicin increases the expression of Cytochrome P450 1A2 (CYP1A2).	[25]
Ifosfamide	DMCT3I8	Approved	Ifosfamide increases the expression of Cytochrome P450 1A2 (CYP1A2).	[26]
Clodronate	DM9Y6X7	Approved	Clodronate increases the expression of Cytochrome P450 1A2 (CYP1A2).	[26]
Sulindac	DM2QHZU	Approved	Sulindac increases the expression of Cytochrome P450 1A2 (CYP1A2).	[27]
Capsaicin	DMGMF6V	Approved	Capsaicin decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[28]
Ibuprofen	DM8VCBE	Approved	Ibuprofen decreases the expression of Cytochrome P450 1A2 (CYP1A2).	[26]
Liothyronine	DM6IR3P	Approved	Liothyronine increases the expression of Cytochrome P450 1A2 (CYP1A2).	[29]
Rofecoxib	DM3P5DA	Approved	Rofecoxib decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[30]
Ritonavir	DMU764S	Approved	Ritonavir increases the expression of Cytochrome P450 1A2 (CYP1A2).	[31]
Dihydroartemisinin	DMBXVMZ	Approved	Dihydroartemisinin decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[32]
Chenodiol	DMQ8JIK	Approved	Chenodiol decreases the expression of Cytochrome P450 1A2 (CYP1A2).	[33]
Eicosapentaenoic acid/docosa-hexaenoic acid	DMMUCG4	Approved	Eicosapentaenoic acid/docosa-hexaenoic acid decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[34]
Ciprofloxacin XR	DM2NLS9	Approved	Ciprofloxacin XR decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[35]
Mebendazole	DMO14SG	Approved	Mebendazole increases the expression of Cytochrome P450 1A2 (CYP1A2).	[36]
Hesperetin	DMKER83	Approved	Hesperetin decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[37]
Omeprazole	DM471KJ	Approved	Omeprazole increases the expression of Cytochrome P450 1A2 (CYP1A2).	[38]
Cimetidine	DMH61ZB	Approved	Cimetidine decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[19]
Nifedipine	DMSVOZT	Approved	Nifedipine decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[39]
Prasterone	DM67VKL	Approved	Prasterone decreases the expression of Cytochrome P450 1A2 (CYP1A2).	[40]
Amodiaquine	DME4RA8	Approved	Amodiaquine decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[32]
Etodolac	DM6WJO9	Approved	Etodolac decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[30]
Methoxsalen	DME8FZ9	Approved	Methoxsalen decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[41]
Quinidine	DMLPICK	Approved	Quinidine decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[21]
Lansoprazole	DMXYLQ3	Approved	Lansoprazole increases the expression of Cytochrome P450 1A2 (CYP1A2).	[42]
Polyethylene glycol	DM4I1JP	Approved	Polyethylene glycol increases the activity of Cytochrome P450 1A2 (CYP1A2).	[43]
Cotinine	DMCEZ1B	Approved	Cotinine decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[21]
Gemfibrozil	DMD8Q3J	Approved	Gemfibrozil decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[44]
Felodipine	DMOSW35	Approved	Felodipine increases the expression of Cytochrome P450 1A2 (CYP1A2).	[45]
Primaquine	DMWQ16I	Approved	Primaquine increases the expression of Cytochrome P450 1A2 (CYP1A2).	[46]
Ethambutol	DMR87LC	Approved	Ethambutol decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[47]
Quinine	DMSWYF5	Approved	Quinine increases the expression of Cytochrome P450 1A2 (CYP1A2).	[46]
Dabrafenib	DMX6OE3	Approved	Dabrafenib decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[49]
Albendazole	DMYZ57N	Approved	Albendazole increases the expression of Cytochrome P450 1A2 (CYP1A2).	[46]
Romiplostim	DM3U7SZ	Approved	Romiplostim increases the expression of Cytochrome P450 1A2 (CYP1A2).	[50]
Isradipine	DMA5XGH	Approved	Isradipine increases the expression of Cytochrome P450 1A2 (CYP1A2).	[45]
Artemisinin	DMOY7W3	Approved	Artemisinin decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[32]
Zileuton	DMVRIC2	Approved	Zileuton decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[51]
Thiabendazole	DM7YCK3	Approved	Thiabendazole increases the expression of Cytochrome P450 1A2 (CYP1A2).	[52]
Desogestrel	DM27U4Y	Approved	Desogestrel decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[30]
Nisoldipine	DM7ISKJ	Approved	Nisoldipine decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[39]
Tranylcypromine	DMGB5RE	Approved	Tranylcypromine decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[21]
Etoricoxib	DM6A4NW	Approved	Etoricoxib decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[30]
Trimethoprim	DMM7CHK	Approved	Trimethoprim decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[44]
Stiripentol	DMMSDOY	Approved	Stiripentol decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[53]
Orphenadrine	DMW542E	Approved	Orphenadrine decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[54]
Zolmitriptan	DM1IB4Q	Approved	Zolmitriptan decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[30]
Sulfaphenazole	DMFNAEM	Approved	Sulfaphenazole decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[21]
Atovaquone	DMY4UMW	Approved	Atovaquone increases the activity of Cytochrome P450 1A2 (CYP1A2).	[32]
Enoxacin	DMYTE6L	Approved	Enoxacin decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[55]
Tegaserod	DM3XYD1	Approved	Tegaserod decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[56]
Saphris	DM5VP0F	Approved	Saphris decreases the expression of Cytochrome P450 1A2 (CYP1A2).	[57]
Benidipine	DMWNP6B	Phase 4	Benidipine increases the expression of Cytochrome P450 1A2 (CYP1A2).	[45]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[58]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[59]
HMPL-004	DM29XGY	Phase 3	HMPL-004 decreases the expression of Cytochrome P450 1A2 (CYP1A2).	[60]
I3C	DMIGFOR	Phase 3	I3C increases the expression of Cytochrome P450 1A2 (CYP1A2).	[5]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[61]
PEITC	DMOMN31	Phase 2	PEITC decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[62]
BAICALEIN	DM4C7E6	Phase 2	BAICALEIN decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[63]
Beta-caryophyllene	DM7583A	Phase 2	Beta-caryophyllene decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[64]
Icaritin	DMGHQ37	Phase 2	Icaritin decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[37]
Ibrolipim	DMOPWSX	Phase 2	Ibrolipim increases the expression of Cytochrome P450 1A2 (CYP1A2).	[65]
PINOCEMBRIN	DM96VWD	Phase 2	PINOCEMBRIN decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[37]
GEA-6414	DM8J0MK	Phase 1/2	GEA-6414 decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[66]
APC-100	DM71I53	Phase 1/2	APC-100 increases the expression of Cytochrome P450 1A2 (CYP1A2).	[67]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Cytochrome P450 1A2 (CYP1A2).	[68]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Cytochrome P450 1A2 (CYP1A2).	[69]
SR13668	DMO5760	Phase 1	SR13668 increases the expression of Cytochrome P450 1A2 (CYP1A2).	[67]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[70]
PMID26394986-Compound-22	DM43Z1G	Patented	PMID26394986-Compound-22 decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[30]
CHIR-99021	DMB8MNU	Patented	CHIR-99021 increases the expression of Cytochrome P450 1A2 (CYP1A2).	[71]
PMID28870136-Compound-49	DMTUC9E	Patented	PMID28870136-Compound-49 decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[70]
PMID26560530-Compound-34	DMLGZPO	Patented	PMID26560530-Compound-34 decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[72]
Ferulic Acid	DMJC7NF	Patented	Ferulic Acid decreases the activity of Cytochrome P450 1A2 (CYP1A2).	[59]
------------------------------------------------------------------------------------


⏷ Show the Full List of 98 Drug(s)

1 Drug(s) Affected the Biochemical Pathways of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Nortriptyline	DM4KDYJ	Approved	Nortriptyline increases the metabolism of Cytochrome P450 1A2 (CYP1A2).	[48]
------------------------------------------------------------------------------------

References

1	Integrated 'omics analysis reveals new drug-induced mitochondrial perturbations in human hepatocytes. Toxicol Lett. 2018 Jun 1;289:1-13.
2	Regulation of cutaneous drug-metabolizing enzymes and cytoprotective gene expression by topical drugs in human skin in vivo. Br J Dermatol. 2006 Aug;155(2):275-81.
3	Functionality of primary hepatic non-parenchymal cells in a 3D spheroid model and contribution to acetaminophen hepatotoxicity. Arch Toxicol. 2020 Apr;94(4):1251-1263. doi: 10.1007/s00204-020-02682-w. Epub 2020 Feb 28.
4	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
5	In vitro analysis of factors influencing CYP1A2 expression as potential determinants of interindividual variation. Pharmacol Res Perspect. 2017 Mar 2;5(2):e00299.
6	Bioactive terpenoids and flavonoids from Ginkgo biloba extract induce the expression of hepatic drug-metabolizing enzymes through pregnane X receptor, constitutive androstane receptor, and aryl hydrocarbon receptor-mediated pathways. Pharm Res. 2009 Apr;26(4):872-82.
7	Oxidative stress modulates expression of immune checkpoint genes via activation of AhR signaling. Toxicol Appl Pharmacol. 2022 Dec 15;457:116314. doi: 10.1016/j.taap.2022.116314. Epub 2022 Nov 9.
8	Triclosan treatment decreased the antitumor effect of sorafenib on hepatocellular carcinoma cells. Onco Targets Ther. 2018 May 18;11:2945-2954.
9	Transcriptional profiling of genes induced in the livers of patients treated with carbamazepine. Clin Pharmacol Ther. 2006 Nov;80(5):440-456.
10	Allele-specific expression and gene methylation in the control of CYP1A2 mRNA level in human livers. Pharmacogenomics J. 2009 Jun;9(3):208-17.
11	Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
12	Use of mRNA expression to detect the induction of drug metabolising enzymes in rat and human hepatocytes. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):86-96.
13	Dexamethasone controls aryl hydrocarbon receptor (AhR)-mediated CYP1A1 and CYP1A2 expression and activity in primary cultures of human hepatocytes. Chem Biol Interact. 2009 May 15;179(2-3):288-96.
14	Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
15	Characterization of the structural determinants required for potent mechanism-based inhibition of human cytochrome P450 1A1 by cannabidiol. Chem Biol Interact. 2014 May 25;215:62-8.
16	Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
17	Prenatal ethanol exposure induces dynamic changes of expression and activity of hepatic cytochrome P450 isoforms in male rat offspring. Reprod Toxicol. 2022 Apr;109:101-108. doi: 10.1016/j.reprotox.2022.03.002. Epub 2022 Mar 14.
18	Development of in vitro 3D cell model from hepatocellular carcinoma (HepG2) cell line and its application for genotoxicity testing. Arch Toxicol. 2019 Nov;93(11):3321-3333. doi: 10.1007/s00204-019-02576-6. Epub 2019 Sep 21.
19	Size-dependent effects of nanoparticles on the activity of cytochrome P450 isoenzymes. Toxicol Appl Pharmacol. 2010 Feb 1;242(3):326-32.
20	The inducibility of human cytochrome P450 1A by environmental-relevant xenobiotics in the human hepatoma derived cell line HepG2. Environ Toxicol Pharmacol. 2009 Nov;28(3):370-8.
21	Predictive three-dimensional quantitative structure-activity relationship of cytochrome P450 1A2 inhibitors. J Med Chem. 2005 Jun 2;48(11):3808-15.
22	Characterization of human cytochrome P450 induction by pesticides. Toxicology. 2012 Mar 29;294(1):17-26.
23	Effects of histone deacetylation and DNA methylation on the constitutive and TCDD-inducible expressions of the human CYP1 family in MCF-7 and HeLa cells. Toxicol Lett. 2003 Sep 30;144(2):247-56.
24	Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
25	Effect of silybin and its glycosides on the expression of cytochromes P450 1A2 and 3A4 in primary cultures of human hepatocytes. J Biochem Mol Toxicol. 2005;19(3):149-53.
26	Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
27	Sulindac and its metabolites induce carcinogen metabolizing enzymes in human colon cancer cells. Int J Cancer. 2008 Mar 1;122(5):990-8.
28	Effects of capsaicin and dihydrocapsaicin on human and rat liver microsomal CYP450 enzyme activities in vitro and in vivo. J Asian Nat Prod Res. 2012;14(4):382-95.
29	Activated thyroid hormone receptor modulates dioxin-inducible aryl hydrocarbon receptor-mediated CYP1A1 induction in human hepatocytes but not in human hepatocarcinoma HepG2 cells. Toxicol Lett. 2017 Jun 5;275:77-82.
30	In vitro inhibition of CYP1A2 by model inhibitors, anti-inflammatory analgesics and female sex steroids: predictability of in vivo interactions. Basic Clin Pharmacol Toxicol. 2008 Aug;103(2):157-65.
31	Severe interaction between ritonavir and acenocoumarol. Ann Pharmacother. 2002 Apr;36(4):621-3.
32	Application of higher throughput screening (HTS) inhibition assays to evaluate the interaction of antiparasitic drugs with cytochrome P450s. Drug Metab Dispos. 2001 Jan;29(1):30-5.
33	Chenodeoxycholic acid significantly impacts the expression of miRNAs and genes involved in lipid, bile acid and drug metabolism in human hepatocytes. Life Sci. 2016 Jul 1;156:47-56.
34	The inhibitory effect of polyunsaturated fatty acids on human CYP enzymes. Life Sci. 2006 Nov 25;79(26):2432-40.
35	Methadone, ciprofloxacin, and adverse drug reactions. Lancet. 2000 Dec 16;356(9247):2069-70.
36	The effects of mebendazole on P4501A activity in rat hepatocytes and HepG2 cellsComparison with tiabendazole and omeprazole. J Pharm Pharmacol. 2003 Jun;55(6):773-81.
37	Drug interaction study of flavonoids toward CYP3A4 and their quantitative structure activity relationship (QSAR) analysis for predicting potential effects. Toxicol Lett. 2018 Sep 15;294:27-36.
38	Evaluation of gene induction of drug-metabolizing enzymes and transporters in primary culture of human hepatocytes using high-sensitivity real-time reverse transcription PCR. Yakugaku Zasshi. 2002 May;122(5):339-61.
39	Inhibition of human cytochrome P450 enzymes by 1,4-dihydropyridine calcium antagonists: prediction of in vivo drug-drug interactions. Eur J Clin Pharmacol. 2000 Feb-Mar;55(11-12):843-52.
40	Dehydroepiandrosterone post-transcriptionally modifies CYP1A2 induction involving androgen receptor. Chem Biol Interact. 2013 May 25;203(3):597-603.
41	Specificity of substrate and inhibitor probes for cytochrome P450s: evaluation of in vitro metabolism using cDNA-expressed human P450s and human liver microsomes. Xenobiotica. 1996 Jul;26(7):681-93.
42	Time-dependent transcriptional induction of CYP1A1, CYP1A2 and CYP1B1 mRNAs by H+/K+ -ATPase inhibitors and other xenobiotics. Xenobiotica. 2003 Feb;33(2):107-18.
43	Regulation of epithelial cell morphology and functions approaching to more in vivo-like by modifying polyethylene glycol on polysulfone membranes. PLoS One. 2012;7(4):e36110.
44	Cytochrome P450 inhibition potential of new psychoactive substances of the tryptamine class. Toxicol Lett. 2016 Jan 22;241:82-94.
45	Optical isomers of dihydropyridine calcium channel blockers display enantiospecific effects on the expression and enzyme activities of human xenobiotics-metabolizing cytochromes P450. Toxicol Lett. 2016 Nov 16;262:173-186.
46	Cytochrome P450 1A1/2 induction by antiparasitic drugs: dose-dependent increase in ethoxyresorufin O-deethylase activity and mRNA caused by quinine, primaquine and albendazole in HepG2 cells. Eur J Clin Pharmacol. 2002 Nov;58(8):537-42.
47	Inhibition of cytochrome P450 by ethambutol in human liver microsomes. Toxicol Lett. 2014 Aug 17;229(1):33-40.
48	Bioactivation of the tricyclic antidepressant amitriptyline and its metabolite nortriptyline to arene oxide intermediates in human liver microsomes and recombinant P450s. Chem Biol Interact. 2008 May 9;173(1):59-67.
49	Dabrafenib inhibits ABCG2 and cytochrome P450 isoenzymes; potential implications for combination anticancer therapy. Toxicol Appl Pharmacol. 2022 Jan 1;434:115797. doi: 10.1016/j.taap.2021.115797. Epub 2021 Nov 13.
50	TSU-16, (Z)-3-[(2,4-dimethylpyrrol-5-yl)methylidenyl]-2-indolinone, is a potent activator of aryl hydrocarbon receptor and increases CYP1A1 and CYP1A2 expression in human hepatocytes. Chem Biol Interact. 2010 Apr 15;185(1):33-41.
51	Mechanism-based inhibition of human liver microsomal cytochrome P450 1A2 by zileuton, a 5-lipoxygenase inhibitor. Drug Metab Dispos. 2003 Nov;31(11):1352-60.
52	Effect of butylated hydroxytoluene, curcumin, propyl gallate and thiabendazole on cytochrome P450 forms in cultured human hepatocytes. Xenobiotica. 2008 Jun;38(6):574-86.
53	Stiripentol. Expert Opin Investig Drugs. 2005 Jul;14(7):905-11.
54	Examination of purported probes of human CYP2B6. Pharmacogenetics. 1997 Jun;7(3):165-79.
55	Interaction study between enoxacin and fluvoxamine. Ther Drug Monit. 2005 Jun;27(3):349-53.
56	In vitro metabolism of tegaserod in human liver and intestine: assessment of drug interactions. Drug Metab Dispos. 2001 Oct;29(10):1269-76.
57	Asenapine and iloperidone decrease the expression of major cytochrome P450 enzymes CYP1A2 and CYP3A4 in human hepatocytes. A significance for drug-drug interactions during combined therapy. Toxicol Appl Pharmacol. 2020 Nov 1;406:115239. doi: 10.1016/j.taap.2020.115239. Epub 2020 Sep 14.
58	Differential inhibition and inactivation of human CYP1 enzymes by trans-resveratrol: evidence for mechanism-based inactivation of CYP1A2. J Pharmacol Exp Ther. 2001 Dec;299(3):874-82.
59	Antioxidant and antigenotoxic effects of plant cell wall hydroxycinnamic acids in cultured HT-29 cells. Mol Nutr Food Res. 2005 Jun;49(6):585-93.
60	Effects of Andrographis paniculata extract and Andrographolide on hepatic cytochrome P450 mRNA expression and monooxygenase activities after in vivo administration to rats and in vitro in rat and human hepatocyte cultures. Chem Biol Interact. 2009 May 15;179(2-3):247-55.
61	QT interval prolongation and Torsades de Pointes in a patient receiving zolpidem and amiodarone. Cardiology. 2006;105(3):146-7.
62	Sulforaphane- and phenethyl isothiocyanate-induced inhibition of aflatoxin B1-mediated genotoxicity in human hepatocytes: role of GSTM1 genotype and CYP3A4 gene expression. Toxicol Sci. 2010 Aug;116(2):422-32.
63	Structure-function relationships of inhibition of human cytochromes P450 1A1, 1A2, 1B1, 2C9, and 3A4 by 33 flavonoid derivatives. Chem Res Toxicol. 2010 Dec 20;23(12):1921-35.
64	The inhibitory effects of beta-caryophyllene, beta-caryophyllene oxide and alpha-humulene on the activities of the main drug-metabolizing enzymes in rat and human liver in vitro. Chem Biol Interact. 2017 Dec 25;278:123-128.
65	Effects of NO-1886 (Ibrolipim), a lipoprotein lipase-promoting agent, on gene induction of cytochrome P450s, carboxylesterases, and sulfotransferases in primary cultures of human hepatocytes. Drug Metab Pharmacokinet. 2004 Dec;19(6):422-9.
66	Tolfenamic acid is a potent CYP1A2 inhibitor in vitro but does not interact in vivo: correction for protein binding is needed for data interpretation. Eur J Clin Pharmacol. 2007 Sep;63(9):829-36. doi: 10.1007/s00228-007-0335-z. Epub 2007 Jul 6.
67	In vitro assessment of P450 induction potential of novel chemopreventive agents SR13668, 9-cis-UAB30, and pentamethychromanol in primary cultures of human hepatocytes. Chem Biol Interact. 2009 May 15;179(2-3):263-72.
68	Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
69	Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
70	Inhibition of human CYP1A2 activity in vitro by methylxanthines: potent competitive inhibition by 8-phenyltheophylline. Xenobiotica. 2001 Mar;31(3):135-51.
71	Analysis of glycogen synthase kinase inhibitors that regulate cytochrome P450 expression in primary human hepatocytes by activation of beta-catenin, aryl hydrocarbon receptor and pregnane X receptor signaling. Toxicol Sci. 2015 Nov;148(1):261-75.
72	Inhibition of human cytochrome P450 enzymes by 1,2-dithiole-3-thione, oltipraz and its derivatives, and sulforaphane. Chem Res Toxicol. 2000 Apr;13(4):245-52.
73	Cytochrome P450-mediated metabolism of tumour promoters modifies the inhibition of intercellular communication: a modified assay for tumour promotion. Carcinogenesis. 1993 Nov;14(11):2365-71. doi: 10.1093/carcin/14.11.2365.
74	The involvement of CYP3A4 and CYP2C9 in the metabolism of 17 alpha-ethinylestradiol. Drug Metab Dispos. 2004 Nov;32(11):1209-12.
75	Epoxidation of the methamphetamine pyrolysis product, trans-phenylpropene, to trans-phenylpropylene oxide by CYP enzymes and stereoselective glutathione adduct formation. Toxicol Appl Pharmacol. 2006 Mar 1;211(2):148-56. doi: 10.1016/j.taap.2005.06.017. Epub 2005 Jul 20.
76	Combined Docking and Quantum Chemical Study on CYP-Mediated Metabolism of Estrogens in Man. Chem Res Toxicol. 2017 Feb 20;30(2):583-594. doi: 10.1021/acs.chemrestox.6b00330. Epub 2016 Dec 14.
77	Pharmacogenomics variation in drug metabolizing enzymes and transporters in relation to docetaxel toxicity in Lebanese breast cancer patients: paving the way for OMICs in low and middle income countries. OMICS. 2013 Jul;17(7):353-67. doi: 10.1089/omi.2013.0019. Epub 2013 Jun 11.
78	Coffee, CYP1A2 genotype, and risk of myocardial infarction. JAMA. 2006 Mar 8;295(10):1135-41. doi: 10.1001/jama.295.10.1135.
79	Metabolism of melatonin by human cytochromes p450. Drug Metab Dispos. 2005 Apr;33(4):489-94.
80	Tofacitinib Is a Mechanism-Based Inactivator of Cytochrome P450 3A4. Chem Res Toxicol. 2019 Sep 16;32(9):1791-1800. doi: 10.1021/acs.chemrestox.9b00141. Epub 2019 Aug 26.
81	Customised in vitro model to detect human metabolism-dependent idiosyncratic drug-induced liver injury. Arch Toxicol. 2018 Jan;92(1):383-399. doi: 10.1007/s00204-017-2036-4. Epub 2017 Jul 31.
82	ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
83	Cytochrome P450-mediated bioactivation of mefenamic acid to quinoneimine intermediates and inactivation by human glutathione S-transferases. Chem Res Toxicol. 2014 Dec 15;27(12):2071-81.
84	Human cytochrome P450 kinetic studies on six N-2-methoxybenzyl (NBOMe)-derived new psychoactive substances using the substrate depletion approach. Toxicol Lett. 2018 Mar 15;285:1-8. doi: 10.1016/j.toxlet.2017.12.017. Epub 2017 Dec 23.
85	Identification of the human cytochrome P450 enzymes involved in the two oxidative steps in the bioactivation of clopidogrel to its pharmacologically active metabolite. Drug Metab Dispos. 2010 Jan;38(1):92-9. doi: 10.1124/dmd.109.029132.
86	The Toll-like receptor agonist imiquimod is metabolized by aryl hydrocarbon receptor-regulated cytochrome P450 enzymes in human keratinocytes and mouse liver. Arch Toxicol. 2019 Jul;93(7):1917-1926.
87	Metabolite profiling and reaction phenotyping for the in vitro assessment of the bioactivation of bromfenac. Chem Res Toxicol. 2020 Jan 21;33(1):249-257.
88	Comparison of various urine collection intervals for caffeine and dextromethorphan phenotyping in children. J Clin Pharmacol. 2004 Jul;44(7):708-14. doi: 10.1177/0091270004266624.
89	Characterization of human cytochrome P450 enzymes catalyzing domperidone N-dealkylation and hydroxylation in vitro. Br J Clin Pharmacol. 2004 Sep;58(3):277-87.
90	Interindividual variation in relative CYP1A2/3A4 phenotype influences susceptibility of clozapine oxidation to cytochrome P450-specific inhibition in human hepatic microsomes. Drug Metab Dispos. 2008 Dec;36(12):2547-55. doi: 10.1124/dmd.108.023671. Epub 2008 Sep 22.
91	Identification of the human liver enzymes involved in the metabolism of the antimigraine agent almotriptan. Drug Metab Dispos. 2003 Apr;31(4):404-11.
92	Oral contraceptives containing ethinyl estradiol and gestodene markedly increase plasma concentrations and effects of tizanidine by inhibiting cytochrome P450 1A2. Clin Pharmacol Ther. 2005 Oct;78(4):400-11.
93	Rate-limiting biotransformation of triamterene is mediated by CYP1A2. Int J Clin Pharmacol Ther. 2005 Jul;43(7):327-34.
94	Main contribution of the cytochrome P450 isoenzyme 1A2 (CYP1A2) to N-demethylation and 5-sulfoxidation of the phenothiazine neuroleptic chlorpromazine in human liver--A comparison with other phenothiazines. Biochem Pharmacol. 2010 Oct 15;80(8):1252-9.
95	Identification of CYP1A2 as the main isoform for the phase I hydroxylated metabolism of genistein and a prodrug converting enzyme of methylated isoflavones. Drug Metab Dispos. 2003 Jul;31(7):924-31.
96	The formation of estrogen-like tamoxifen metabolites and their influence on enzyme activity and gene expression of ADME genes. Arch Toxicol. 2018 Mar;92(3):1099-1112.
97	Cytochrome P450 Mediated Bioactivation of Saracatinib. Chem Res Toxicol. 2016 Nov 21;29(11):1835-1842. doi: 10.1021/acs.chemrestox.6b00242. Epub 2016 Nov 3.
98	Inhibition of human CYP1A2 oxidation of 5,6-dimethyl-xanthenone-4-acetic acid by acridines: a molecular modelling study. Clin Exp Pharmacol Physiol. 2005 Aug;32(8):633-9.
99	Cytochromes P450 1A2 and 3A4 Catalyze the Metabolic Activation of Sunitinib. Chem Res Toxicol. 2018 Jul 16;31(7):570-584. doi: 10.1021/acs.chemrestox.8b00005. Epub 2018 Jun 18.
100	Biotransformation of caffeine, paraxanthine, theobromine and theophylline by cDNA-expressed human CYP1A2 and CYP2E1. Pharmacogenetics. 1992 Apr;2(2):73-7.
101	The genotoxicity potential of luteolin is enhanced by CYP1A1 and CYP1A2 in human lymphoblastoid TK6 cells. Toxicol Lett. 2021 Jun 15;344:58-68. doi: 10.1016/j.toxlet.2021.03.006. Epub 2021 Mar 13.
102	A population approach to enzyme characterization and identification: application to phenacetin O-deethylation. Pharm Res. 2000 Dec;17(12):1531-6. doi: 10.1023/a:1007665310830.
103	Bioactivation of the citrus flavonoid nobiletin by CYP1 enzymes in MCF7 breast adenocarcinoma cells. Food Chem Toxicol. 2012 Sep;50(9):3320-8.
104	Chemical Reactivity of Aloe-Emodin and Its Hydroxylation Metabolites to Thiols. Chem Res Toxicol. 2019 Feb 18;32(2):234-244. doi: 10.1021/acs.chemrestox.8b00248. Epub 2019 Feb 6.
105	Chemical and Enzymatic Transformations of Nimesulide to GSH Conjugates through Reductive and Oxidative Mechanisms. Chem Res Toxicol. 2015 Dec 21;28(12):2267-77. doi: 10.1021/acs.chemrestox.5b00290. Epub 2015 Nov 12.
106	Metabolic activation and deactivation of dietary-derived coumarin mediated by cytochrome P450 enzymes in rat and human liver preparations. J Toxicol Sci. 2021;46(8):371-378. doi: 10.2131/jts.46.371.
107	The stimulatory role of human cytochrome b5 in the bioactivation activities of human CYP1A2, 2A6 and 2E1: a new cell expression system to study cytochrome P450 mediated biotransformation. Mutagenesis. 2005 Mar;20(2):93-100. doi: 10.1093/mutage/gei012. Epub 2005 Feb 22.
108	Acetaminophen reactive intermediates target hepatic thioredoxin reductase. Chem Res Toxicol. 2014 May 19;27(5):882-94. doi: 10.1021/tx5000443. Epub 2014 Apr 4.
109	Involvement of cytochrome P450 1A2 in the biotransformation of trans-resveratrol in human liver microsomes. Biochem Pharmacol. 2004 Aug 15;68(4):773-82.
110	Ellipticine oxidation and DNA adduct formation in human hepatocytes is catalyzed by human cytochromes P450 and enhanced by cytochrome b5. Toxicology. 2012 Dec 16;302(2-3):233-41. doi: 10.1016/j.tox.2012.08.004. Epub 2012 Aug 16.
111	Inhibition of the human liver microsomal and human cytochrome P450 1A2 and 3A4 metabolism of estradiol by deployment-related and other chemicals. Drug Metab Dispos. 2006 Sep;34(9):1606-14.
112	Structure-Function Studies of Naphthalene, Phenanthrene, Biphenyl, and Their Derivatives in Interaction with and Oxidation by Cytochromes P450 2A13 and 2A6. Chem Res Toxicol. 2016 Jun 20;29(6):1029-40. doi: 10.1021/acs.chemrestox.6b00083. Epub 2016 May 12.
113	What is the contribution of human FMO3 in the N-oxygenation of selected therapeutic drugs and drugs of abuse?. Toxicol Lett. 2016 Sep 6;258:55-70. doi: 10.1016/j.toxlet.2016.06.013. Epub 2016 Jun 15.
114	A monoclonal antibody inhibitory to human P450 2D6: a paradigm for use in combinatorial determination of individual P450 role in specific drug tissue metabolism. Pharmacogenetics. 1997 Dec;7(6):469-77. doi: 10.1097/00008571-199712000-00005.
115	Human cytochrome P450 enzyme selectivities in the oxidation of chlorinated benzenes. Toxicol Appl Pharmacol. 1995 May;132(1):44-52.
116	CYP1-mediated antiproliferative activity of dietary flavonoids in MDA-MB-468 breast cancer cells. Toxicology. 2009 Oct 29;264(3):162-70. doi: 10.1016/j.tox.2009.07.023. Epub 2009 Aug 8.
117	Identification of enzymes involved in the metabolism of atrazine, terbuthylazine, ametryne, and terbutryne in human liver microsomes. Chem Res Toxicol. 1997 Sep;10(9):1037-44. doi: 10.1021/tx970081l.