Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEJROBO)

DOT Name ATP-dependent translocase ABCB1 (ABCB1)
Synonyms ATP-binding cassette sub-family B member 1; Multidrug resistance protein 1; EC 7.6.2.2; P-glycoprotein 1; Phospholipid transporter ABCB1; EC 7.6.2.1; CD antigen CD243
Gene Name ABCB1
UniProt ID
MDR1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
6C0V; 6FN1; 6FN4; 6QEX; 7A65; 7A69; 7A6C; 7A6E; 7A6F; 7O9W
EC Number
7.6.2.1; 7.6.2.2
Pfam ID
PF00664 ; PF00005
Sequence
MDLEGDRNGGAKKKNFFKLNNKSEKDKKEKKPTVSVFSMFRYSNWLDKLYMVVGTLAAII
HGAGLPLMMLVFGEMTDIFANAGNLEDLMSNITNRSDINDTGFFMNLEEDMTRYAYYYSG
IGAGVLVAAYIQVSFWCLAAGRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTDDVS
KINEGIGDKIGMFFQSMATFFTGFIVGFTRGWKLTLVILAISPVLGLSAAVWAKILSSFT
DKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANISIG
AAFLLIYASYALAFWYGTTLVLSGEYSIGQVLTVFFSVLIGAFSVGQASPSIEAFANARG
AAYEIFKIIDNKPSIDSYSKSGHKPDNIKGNLEFRNVHFSYPSRKEVKILKGLNLKVQSG
QTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEPVLF
ATTIAENIRYGRENVTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIA
IARALVRNPKILLLDEATSALDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADVIAG
FDDGVIVEKGNHDELMKEKGIYFKLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRS
SLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPYFVVGVFCAII
NGGLQPAFAIIFSKIIGVFTRIDDPETKRQNSNLFSLLFLALGIISFITFFLQGFTFGKA
GEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQNI
ANLGTGIIISFIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEA
IENFRTVVSLTQEQKFEHMYAQSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCFRFG
AYLVAHKLMSFEDVLLVFSAVVFGAMAVGQVSSFAPDYAKAKISAAHIIMIIEKTPLIDS
YSTEGLMPNTLEGNVTFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKSTVV
QLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVV
SQEEIVRAAKEANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARALVRQPHILLLD
EATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQL
LAQKGIYFSMVSVQAGTKRQ
Function
Translocates drugs and phospholipids across the membrane. Catalyzes the flop of phospholipids from the cytoplasmic to the exoplasmic leaflet of the apical membrane. Participates mainly to the flop of phosphatidylcholine, phosphatidylethanolamine, beta-D-glucosylceramides and sphingomyelins. Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.
Tissue Specificity Expressed in small intestine . Expressed in liver, kidney and brain.
KEGG Pathway
ABC transporters (hsa02010 )
Bile secretion (hsa04976 )
MicroR.s in cancer (hsa05206 )
Gastric cancer (hsa05226 )
Reactome Pathway
ABC-family proteins mediated transport (R-HSA-382556 )
Atorvastatin ADME (R-HSA-9754706 )
Prednisone ADME (R-HSA-9757110 )
Abacavir transmembrane transport (R-HSA-2161517 )
BioCyc Pathway
MetaCyc:HS01500-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 31 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Doxorubicin DMVP5YE Approved ATP-dependent translocase ABCB1 (ABCB1) decreases the response to substance of Doxorubicin. [76]
Azathioprine DMMZSXQ Approved ATP-dependent translocase ABCB1 (ABCB1) affects the response to substance of Azathioprine. [79]
Irinotecan DMP6SC2 Approved ATP-dependent translocase ABCB1 (ABCB1) decreases the response to substance of Irinotecan. [80]
Paclitaxel DMLB81S Approved ATP-dependent translocase ABCB1 (ABCB1) decreases the response to substance of Paclitaxel. [81]
Vinblastine DM5TVS3 Approved ATP-dependent translocase ABCB1 (ABCB1) decreases the response to substance of Vinblastine. [83]
Dactinomycin DM2YGNW Approved ATP-dependent translocase ABCB1 (ABCB1) decreases the response to substance of Dactinomycin. [85]
Docetaxel DMDI269 Approved ATP-dependent translocase ABCB1 (ABCB1) increases the response to substance of Docetaxel. [86]
Warfarin DMJYCVW Approved ATP-dependent translocase ABCB1 (ABCB1) affects the response to substance of Warfarin. [88]
Morphine DMRMS0L Approved ATP-dependent translocase ABCB1 (ABCB1) increases the response of Morphine. [89]
Tacrolimus DMZ7XNQ Approved ATP-dependent translocase ABCB1 (ABCB1) increases the response to substance of Tacrolimus. [90]
Nilotinib DM7HXWT Approved ATP-dependent translocase ABCB1 (ABCB1) affects the response to substance of Nilotinib. [92]
Nelfinavir mesylate DMFX6G8 Approved ATP-dependent translocase ABCB1 (ABCB1) affects the response to substance of Nelfinavir mesylate. [93]
Citalopram DM2G9AE Approved ATP-dependent translocase ABCB1 (ABCB1) increases the response of Citalopram. [95]
Lansoprazole DMXYLQ3 Approved ATP-dependent translocase ABCB1 (ABCB1) affects the response to substance of Lansoprazole. [97]
Fexofenadine DM17ONX Approved ATP-dependent translocase ABCB1 (ABCB1) affects the response to substance of Fexofenadine. [99]
Paroxetine DM5PVQE Approved ATP-dependent translocase ABCB1 (ABCB1) increases the response of Paroxetine. [95]
Risperidone DMN6DXL Approved ATP-dependent translocase ABCB1 (ABCB1) increases the response to substance of Risperidone. [100]
Nortriptyline DM4KDYJ Approved ATP-dependent translocase ABCB1 (ABCB1) affects the response to substance of Nortriptyline. [101]
Domperidone DMBDPY0 Approved ATP-dependent translocase ABCB1 (ABCB1) affects the response to substance of Domperidone. [105]
Metoclopramide DMFA5MY Approved ATP-dependent translocase ABCB1 (ABCB1) decreases the response of Metoclopramide. [106]
Fluconazole DMOWZ6B Approved ATP-dependent translocase ABCB1 (ABCB1) increases the Hypersensitivity ADR of Fluconazole. [108]
Acenocoumarol DMH75KV Approved ATP-dependent translocase ABCB1 (ABCB1) affects the response to substance of Acenocoumarol. [109]
Amitriptyline DMK7F9S Approved ATP-dependent translocase ABCB1 (ABCB1) increases the Amitriptyline ADR of Amitriptyline. [113]
Venlafaxine DMR6QH0 Approved ATP-dependent translocase ABCB1 (ABCB1) increases the Venlafaxine ADR of Venlafaxine. [113]
Miltefosine DMND304 Approved ATP-dependent translocase ABCB1 (ABCB1) decreases the response to substance of Miltefosine. [83]
Zarnestra DMF30HL Phase 3 ATP-dependent translocase ABCB1 (ABCB1) affects the response to substance of Zarnestra. [117]
Afimoxifene DMFORDT Phase 2 ATP-dependent translocase ABCB1 (ABCB1) decreases the response to substance of Afimoxifene. [118]
Ym155 DM5Q1W4 Phase 2 ATP-dependent translocase ABCB1 (ABCB1) decreases the response to substance of Ym155. [120]
Apicidin DM83WVF Investigative ATP-dependent translocase ABCB1 (ABCB1) decreases the response to substance of Apicidin. [126]
aconitine DMFOZ60 Investigative ATP-dependent translocase ABCB1 (ABCB1) decreases the response to substance of aconitine. [128]
[3H]estradiol-17beta-glucuronide DM3KJ45 Investigative ATP-dependent translocase ABCB1 (ABCB1) affects the response to substance of [3H]estradiol-17beta-glucuronide. [129]
------------------------------------------------------------------------------------
⏷ Show the Full List of 31 Drug(s)
This DOT Affected the Regulation of Drug Effects of 34 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Ivermectin DMDBX5F Approved ATP-dependent translocase ABCB1 (ABCB1) increases the transport of Ivermectin. [77]
Arsenic DMTL2Y1 Approved ATP-dependent translocase ABCB1 (ABCB1) increases the export of Arsenic. [78]
Simvastatin DM30SGU Approved ATP-dependent translocase ABCB1 (ABCB1) increases the transport of Simvastatin. [82]
Phenytoin DMNOKBV Approved ATP-dependent translocase ABCB1 (ABCB1) increases the metabolism of Phenytoin. [84]
Hydrocortisone DMGEMB7 Approved ATP-dependent translocase ABCB1 (ABCB1) increases the secretion of Hydrocortisone. [56]
Lovastatin DM9OZWQ Approved ATP-dependent translocase ABCB1 (ABCB1) increases the transport of Lovastatin. [82]
Atazanavir DMSYRBX Approved ATP-dependent translocase ABCB1 (ABCB1) increases the transport of Atazanavir. [91]
Carvedilol DMHTEAO Approved ATP-dependent translocase ABCB1 (ABCB1) increases the transport of Carvedilol. [94]
Quinidine DMLPICK Approved ATP-dependent translocase ABCB1 (ABCB1) increases the transport of Quinidine. [96]
Prednisone DM2HG4X Approved ATP-dependent translocase ABCB1 (ABCB1) increases the secretion of Prednisone. [56]
Digitoxin DMWVIGP Approved ATP-dependent translocase ABCB1 (ABCB1) increases the transport of Digitoxin. [98]
Fluticasone propionate DMRWLB2 Approved ATP-dependent translocase ABCB1 (ABCB1) increases the secretion of Fluticasone propionate. [56]
Fentanyl DM8WAHT Approved ATP-dependent translocase ABCB1 (ABCB1) increases the transport of Fentanyl. [102]
Quinine DMSWYF5 Approved ATP-dependent translocase ABCB1 (ABCB1) affects the uptake of Quinine. [103]
Pitavastatin DMJH792 Approved ATP-dependent translocase ABCB1 (ABCB1) affects the transport of Pitavastatin. [104]
Paliperidone DM7NPJS Approved ATP-dependent translocase ABCB1 (ABCB1) increases the transport of Paliperidone. [107]
Amprenavir DMLMXE0 Approved ATP-dependent translocase ABCB1 (ABCB1) increases the transport of Amprenavir. [96]
Bisoprolol DM3UZ95 Approved ATP-dependent translocase ABCB1 (ABCB1) increases the transport of Bisoprolol. [94]
Trospium chloride DM32XZT Approved ATP-dependent translocase ABCB1 (ABCB1) increases the transport of Trospium chloride. [110]
Guanfacine extended release DMB1CZ8 Approved ATP-dependent translocase ABCB1 (ABCB1) increases the export of Guanfacine extended release. [111]
Sulpiride DMF54ZG Approved ATP-dependent translocase ABCB1 (ABCB1) increases the transport of Sulpiride. [112]
Omadacycline DMR2J95 Approved ATP-dependent translocase ABCB1 (ABCB1) increases the transport of Omadacycline. [114]
Atorvastatin DMF28YC Phase 3 Trial ATP-dependent translocase ABCB1 (ABCB1) increases the transport of Atorvastatin. [115]
MLN8237 DMO8PT9 Phase 3 ATP-dependent translocase ABCB1 (ABCB1) increases the transport of MLN8237. [116]
GDC0941 DM1YAK6 Phase 2 ATP-dependent translocase ABCB1 (ABCB1) affects the transport of GDC0941. [119]
OX-NLA DMPEHBJ Discontinued in Phase 3 ATP-dependent translocase ABCB1 (ABCB1) increases the export of OX-NLA. [121]
Licarbazepine DMWUS8N Discontinued in Phase 3 ATP-dependent translocase ABCB1 (ABCB1) increases the transport of Licarbazepine. [122]
Rhodamine-123 DMQAK6T Discontinued in Phase 1 ATP-dependent translocase ABCB1 (ABCB1) decreases the uptake of Rhodamine-123. [123]
Puromycin DMDKLB5 Preclinical ATP-dependent translocase ABCB1 (ABCB1) increases the transport of Puromycin. [124]
Rapamycin Immunosuppressant Drug DM678IB Investigative ATP-dependent translocase ABCB1 (ABCB1) affects the metabolism of Rapamycin Immunosuppressant Drug. [125]
Anandamide DMCKH3P Investigative ATP-dependent translocase ABCB1 (ABCB1) increases the export of Anandamide. [111]
Mepacrine DMU8L7C Investigative ATP-dependent translocase ABCB1 (ABCB1) increases the transport of Mepacrine. [127]
N-oleoylethanolamide DMJQ4L7 Investigative ATP-dependent translocase ABCB1 (ABCB1) increases the export of N-oleoylethanolamide. [111]
Diphenyl(piperidin-4-yl)methanol DMO4XUC Investigative ATP-dependent translocase ABCB1 (ABCB1) affects the transport of Diphenyl(piperidin-4-yl)methanol. [130]
------------------------------------------------------------------------------------
⏷ Show the Full List of 34 Drug(s)
This DOT Affected the Biotransformations of 2 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Adenosine triphosphate DM79F6G Approved ATP-dependent translocase ABCB1 (ABCB1) increases the hydrolysis of Adenosine triphosphate. [87]
Guanosine-5'-Triphosphate DMV2OJX Investigative ATP-dependent translocase ABCB1 (ABCB1) increases the hydrolysis of Guanosine-5'-Triphosphate. [64]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of ATP-dependent translocase ABCB1 (ABCB1). [1]
------------------------------------------------------------------------------------
99 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of ATP-dependent translocase ABCB1 (ABCB1). [2]
Tretinoin DM49DUI Approved Tretinoin increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [3]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [4]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of ATP-dependent translocase ABCB1 (ABCB1). [5]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of ATP-dependent translocase ABCB1 (ABCB1). [6]
Quercetin DM3NC4M Approved Quercetin decreases the expression of ATP-dependent translocase ABCB1 (ABCB1). [7]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of ATP-dependent translocase ABCB1 (ABCB1). [8]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of ATP-dependent translocase ABCB1 (ABCB1). [9]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [10]
Triclosan DMZUR4N Approved Triclosan increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [11]
Carbamazepine DMZOLBI Approved Carbamazepine increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [12]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [13]
Decitabine DMQL8XJ Approved Decitabine increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [14]
Phenobarbital DMXZOCG Approved Phenobarbital increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [15]
Progesterone DMUY35B Approved Progesterone increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [16]
Fluorouracil DMUM7HZ Approved Fluorouracil decreases the expression of ATP-dependent translocase ABCB1 (ABCB1). [17]
Fulvestrant DM0YZC6 Approved Fulvestrant increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [18]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [10]
Demecolcine DMCZQGK Approved Demecolcine increases the activity of ATP-dependent translocase ABCB1 (ABCB1). [19]
Bortezomib DMNO38U Approved Bortezomib decreases the expression of ATP-dependent translocase ABCB1 (ABCB1). [20]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol decreases the expression of ATP-dependent translocase ABCB1 (ABCB1). [21]
Rosiglitazone DMILWZR Approved Rosiglitazone increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [22]
Ethanol DMDRQZU Approved Ethanol increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [23]
Cytarabine DMZD5QR Approved Cytarabine increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [24]
Aspirin DM672AH Approved Aspirin increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [25]
Etoposide DMNH3PG Approved Etoposide increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [14]
Clozapine DMFC71L Approved Clozapine decreases the activity of ATP-dependent translocase ABCB1 (ABCB1). [26]
DTI-015 DMXZRW0 Approved DTI-015 increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [27]
Mitomycin DMH0ZJE Approved Mitomycin increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [28]
Ethinyl estradiol DMODJ40 Approved Ethinyl estradiol increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [16]
Topotecan DMP6G8T Approved Topotecan increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [29]
Gemcitabine DMSE3I7 Approved Gemcitabine decreases the expression of ATP-dependent translocase ABCB1 (ABCB1). [30]
Rifampicin DM5DSFZ Approved Rifampicin increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [31]
Mitoxantrone DMM39BF Approved Mitoxantrone increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [27]
Cyclophosphamide DM4O2Z7 Approved Cyclophosphamide increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [32]
Zidovudine DM4KI7O Approved Zidovudine increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [33]
Ifosfamide DMCT3I8 Approved Ifosfamide increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [32]
Capsaicin DMGMF6V Approved Capsaicin increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [34]
Daunorubicin DMQUSBT Approved Daunorubicin decreases the expression of ATP-dependent translocase ABCB1 (ABCB1). [35]
Pioglitazone DMKJ485 Approved Pioglitazone increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [22]
Acocantherin DM7JT24 Approved Acocantherin increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [36]
Haloperidol DM96SE0 Approved Haloperidol decreases the expression of ATP-dependent translocase ABCB1 (ABCB1). [37]
Thalidomide DM70BU5 Approved Thalidomide decreases the expression of ATP-dependent translocase ABCB1 (ABCB1). [38]
Lindane DMB8CNL Approved Lindane increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [39]
Colchicine DM2POTE Approved Colchicine increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [40]
Ursodeoxycholic acid DMCUT21 Approved Ursodeoxycholic acid increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [41]
Imatinib DM7RJXL Approved Imatinib increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [42]
Sertraline DM0FB1J Approved Sertraline increases the activity of ATP-dependent translocase ABCB1 (ABCB1). [43]
Methylprednisolone DM4BDON Approved Methylprednisolone increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [44]
Estrone DM5T6US Approved Estrone increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [16]
Bosentan DMIOGBU Approved Bosentan decreases the expression of ATP-dependent translocase ABCB1 (ABCB1). [45]
Olanzapine DMPFN6Y Approved Olanzapine decreases the activity of ATP-dependent translocase ABCB1 (ABCB1). [26]
Deoxycholic acid DM3GYAL Approved Deoxycholic acid increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [46]
Crizotinib DM4F29C Approved Crizotinib decreases the activity of ATP-dependent translocase ABCB1 (ABCB1). [47]
Mebendazole DMO14SG Approved Mebendazole decreases the expression of ATP-dependent translocase ABCB1 (ABCB1). [48]
Estriol DMOEM2I Approved Estriol increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [16]
Romidepsin DMT5GNL Approved Romidepsin increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [49]
Mitotane DMU1GX0 Approved Mitotane increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [50]
Nifedipine DMSVOZT Approved Nifedipine increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [51]
Clotrimazole DMMFCIH Approved Clotrimazole increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [51]
Chlorambucil DMRKE63 Approved Chlorambucil increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [27]
Propranolol DM79NTF Approved Propranolol increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [52]
Flutamide DMK0O7U Approved Flutamide increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [32]
Epirubicin DMPDW6T Approved Epirubicin increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [53]
LY2835219 DM93VBZ Approved LY2835219 decreases the activity of ATP-dependent translocase ABCB1 (ABCB1). [54]
Naproxen DMZ5RGV Approved Naproxen affects the expression of ATP-dependent translocase ABCB1 (ABCB1). [55]
Budesonide DMJIBAW Approved Budesonide increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [56]
Methoxsalen DME8FZ9 Approved Methoxsalen increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [57]
Aldosterone DM9S2JW Approved Aldosterone increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [10]
Reserpine DM6VM38 Approved Reserpine increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [58]
Clopidogrel DMOL54H Approved Clopidogrel decreases the expression of ATP-dependent translocase ABCB1 (ABCB1). [59]
Lamotrigine DM8SXYG Approved Lamotrigine decreases the activity of ATP-dependent translocase ABCB1 (ABCB1). [60]
Spironolactone DM2AQ5N Approved Spironolactone increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [61]
Stavudine DM6DEK9 Approved Stavudine increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [62]
Gabapentin DM6T924 Approved Gabapentin decreases the activity of ATP-dependent translocase ABCB1 (ABCB1). [60]
Digoxin DMQCTIH Approved Digoxin increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [36]
Methadone DMTW6IU Approved Methadone increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [63]
Magnesium DMU4ORS Approved Magnesium increases the activity of ATP-dependent translocase ABCB1 (ABCB1). [64]
Trifluoperazine DMKBYWI Approved Trifluoperazine increases the activity of ATP-dependent translocase ABCB1 (ABCB1). [64]
Norethindrone DMTY169 Approved Norethindrone increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [16]
Doxycycline DM7ICNU Approved Doxycycline decreases the expression of ATP-dependent translocase ABCB1 (ABCB1). [65]
Tolbutamide DM02AWV Approved Tolbutamide decreases the activity of ATP-dependent translocase ABCB1 (ABCB1). [66]
Levonorgestrel DM1DP7T Approved Levonorgestrel increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [16]
Itraconazole DMCR1MV Approved Itraconazole decreases the activity of ATP-dependent translocase ABCB1 (ABCB1). [67]
Midazolam DMXOELT Approved Midazolam increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [51]
Artemisinin DMOY7W3 Approved Artemisinin increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [68]
Lomustine DMMWSUL Approved Lomustine increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [27]
Cepharanthine DM9Y5JB Approved Cepharanthine decreases the activity of ATP-dependent translocase ABCB1 (ABCB1). [69]
Midostaurin DMI6E0R Approved Midostaurin decreases the activity of ATP-dependent translocase ABCB1 (ABCB1). [70]
Levetiracetam DMTGDN8 Approved Levetiracetam decreases the activity of ATP-dependent translocase ABCB1 (ABCB1). [60]
Flupentixol DM0DJ9O Approved Flupentixol decreases the activity of ATP-dependent translocase ABCB1 (ABCB1). [71]
Macitentan DMP79A1 Approved Macitentan decreases the expression of ATP-dependent translocase ABCB1 (ABCB1). [45]
Rifaximin DMW1TV2 Approved Rifaximin increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [72]
Yohimbine DMJCP1Y Approved Yohimbine increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [58]
Rescinnamine DMG7SQK Approved Rescinnamine increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [58]
Moxidectin DMYGHX5 Approved Moxidectin decreases the expression of ATP-dependent translocase ABCB1 (ABCB1). [73]
Ciclesonide DM2NA4K Approved Ciclesonide increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [56]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [74]
Beclomethasone dipropionate DM5NW1E Phase 4 Beclomethasone dipropionate increases the expression of ATP-dependent translocase ABCB1 (ABCB1). [75]
------------------------------------------------------------------------------------
⏷ Show the Full List of 99 Drug(s)

References

1 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2 [Effect of cyclosporine A, raloxifene and their combination on the reversion of multidrug resistance of K562/A02 line]. Zhongguo Shi Yan Xue Ye Xue Za Zhi. 2006 Oct;14(5):895-9.
3 Up-regulation of MDR1 and induction of doxorubicin resistance by histone deacetylase inhibitor depsipeptide (FK228) and ATRA in acute promyelocytic leukemia cells. Blood. 2006 Feb 15;107(4):1546-54. doi: 10.1182/blood-2004-10-4126. Epub 2005 Oct 13.
4 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
5 Antitumor activity of chloroquine in combination with Cisplatin in human gastric cancer xenografts. Asian Pac J Cancer Prev. 2015;16(9):3907-12. doi: 10.7314/apjcp.2015.16.9.3907.
6 Epidermal growth factor receptor signalling in human breast cancer cells operates parallel to estrogen receptor alpha signalling and results in tamoxifen insensitive proliferation. BMC Cancer. 2014 Apr 23;14:283.
7 The synergistic reversal effect of multidrug resistance by quercetin and hyperthermia in doxorubicin-resistant human myelogenous leukemia cells. Int J Hyperthermia. 2008 Mar;24(2):151-9. doi: 10.1080/02656730701843109.
8 Arsenic trioxide overcomes apoptosis inhibition in K562/ADM cells by regulating vital components in apoptotic pathway. Pharmacol Res. 2005 Nov;52(5):376-85. doi: 10.1016/j.phrs.2005.05.010. Epub 2005 Jun 24.
9 Chronic Oxidative Stress Increases Resistance to Doxorubicin-Induced Cytotoxicity in Renal Carcinoma Cells Potentially Through Epigenetic Mechanism. Mol Pharmacol. 2016 Jan;89(1):27-41. doi: 10.1124/mol.115.100206. Epub 2015 Oct 30.
10 Influence of different chemicals on MDR-1 P-glycoprotein expression and activity in the HK-2 proximal tubular cell line. Toxicol Appl Pharmacol. 2002 Sep 1;183(2):83-91.
11 Triclosan treatment decreased the antitumor effect of sorafenib on hepatocellular carcinoma cells. Onco Targets Ther. 2018 May 18;11:2945-2954.
12 Carbamazepine regulates intestinal P-glycoprotein and multidrug resistance protein MRP2 and influences disposition of talinolol in humans. Clin Pharmacol Ther. 2004 Sep;76(3):192-200.
13 Cobalamin potentiates vinblastine cytotoxicity through downregulation of mdr-1 gene expression in HepG2 cells. Cell Physiol Biochem. 2007;20(6):967-76.
14 Transient resistance to DNA damaging agents is associated with expression of microRNAs-135b and -196b in human leukemia cell lines. Int J Biochem Mol Biol. 2016 Aug 5;7(2):27-47. eCollection 2016.
15 Differential regulation of sinusoidal and canalicular hepatic drug transporter expression by xenobiotics activating drug-sensing receptors in primary human hepatocytes. Drug Metab Dispos. 2006 Oct;34(10):1756-63. doi: 10.1124/dmd.106.010033. Epub 2006 Jul 12.
16 P-glycoprotein (P-gp/MDR1)-mediated efflux of sex-steroid hormones and modulation of P-gp expression in vitro. Pharm Res. 2004 Jul;21(7):1284-93.
17 Schedule-dependent cytotoxicity of 5-fluorouracil and irinotecan in a colon cancer cell line. J Gastroenterol. 2006 Dec;41(12):1149-57.
18 Regulation of expression and activity of multidrug resistance proteins MRP2 and MDR1 by estrogenic compounds in Caco-2 cells. Role in prevention of xenobiotic-induced cytotoxicity. Toxicology. 2014 Jun 5;320:46-55. doi: 10.1016/j.tox.2014.03.007. Epub 2014 Mar 28.
19 Permanent activation of the human P-glycoprotein by covalent modification of a residue in the drug-binding site. J Biol Chem. 2003 Jun 6;278(23):20449-52. doi: 10.1074/jbc.C300154200. Epub 2003 Apr 23.
20 Increasing intratumor C/EBP- LIP and nitric oxide levels overcome resistance to doxorubicin in triple negative breast cancer. J Exp Clin Cancer Res. 2018 Nov 27;37(1):286. doi: 10.1186/s13046-018-0967-0.
21 Estrogen-mediated post transcriptional down-regulation of P-glycoprotein in MDR1-transduced human breast cancer cells. Cancer Sci. 2006 Nov;97(11):1198-204. doi: 10.1111/j.1349-7006.2006.00300.x. Epub 2006 Aug 22.
22 A comprehensive evaluation of anti-diabetic drugs on nuclear receptor PXR platform. Toxicol In Vitro. 2019 Oct;60:347-358.
23 Oxidative stress-mediated up-regulation of ABC transporters in lung cancer cells. J Biochem Mol Toxicol. 2022 Aug;36(8):e23095. doi: 10.1002/jbt.23095. Epub 2022 May 9.
24 [Relationship between the induction of MDR1, a multidrug resistance gene in tumor cells, and apoptosis]. Ontogenez. 2001 Jul-Aug;32(4):295-301.
25 Prolonged use of aspirin alters human and rat intestinal cells and thereby limits the absorption of clopidogrel. Clin Pharmacol Ther. 2011 Oct;90(4):612-9. doi: 10.1038/clpt.2011.163. Epub 2011 Sep 7.
26 Evaluation of antipsychotic drugs as inhibitors of multidrug resistance transporter P-glycoprotein. Psychopharmacology (Berl). 2006 Sep;187(4):415-23. doi: 10.1007/s00213-006-0437-9. Epub 2006 Jun 30.
27 Enhanced in vitro invasiveness and drug resistance with altered gene expression patterns in a human lung carcinoma cell line after pulse selection with anticancer drugs. Int J Cancer. 2004 Sep 10;111(4):484-93. doi: 10.1002/ijc.20230.
28 Mitomycin C induces multidrug resistance in glaucoma surgery. Graefes Arch Clin Exp Ophthalmol. 2008 Feb;246(2):297-304. doi: 10.1007/s00417-007-0695-1. Epub 2007 Oct 13.
29 Chrysin blocks topotecan-induced apoptosis in Caco-2 cells in spite of inhibition of ABC-transporters. Biochem Pharmacol. 2010 Aug 15;80(4):471-9. doi: 10.1016/j.bcp.2010.04.038. Epub 2010 May 8.
30 Deregulation of the CD44-NANOG-MDR1 associated chemoresistance pathways of breast cancer stem cells potentiates the anti-cancer effect of Kaempferol in synergism with Verapamil. Toxicol Appl Pharmacol. 2022 Feb 15;437:115887. doi: 10.1016/j.taap.2022.115887. Epub 2022 Jan 19.
31 Induction of multidrug resistance-1 and cytochrome P450 mRNAs in human mononuclear cells by rifampin. Drug Metab Dispos. 2002 Jan;30(1):20-6. doi: 10.1124/dmd.30.1.20.
32 PXR-mediated induction of P-glycoprotein by anticancer drugs in a human colon adenocarcinoma-derived cell line. Cancer Chemother Pharmacol. 2010 Sep;66(4):765-71. doi: 10.1007/s00280-009-1221-4. Epub 2009 Dec 30.
33 ATP binding cassette multidrug transporters limit the anti-HIV activity of zidovudine and indinavir in infected human macrophages. Antivir Ther. 2004 Aug;9(4):519-28.
34 Effects of capsaicin on P-gp function and expression in Caco-2 cells. Biochem Pharmacol. 2006 Jun 14;71(12):1727-34. doi: 10.1016/j.bcp.2006.03.024. Epub 2006 Apr 18.
35 Reversal of multidrug resistance by magnetic Fe3O4 nanoparticle copolymerizating daunorubicin and MDR1 shRNA expression vector in leukemia cells. Int J Nanomedicine. 2010 Aug 9;5:437-44. doi: 10.2147/ijn.s10083.
36 Digoxin and ouabain induce P-glycoprotein by activating calmodulin kinase II and hypoxia-inducible factor-1alpha in human colon cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):385-92. doi: 10.1016/j.taap.2009.07.026. Epub 2009 Jul 30.
37 Reversal effect of haloperidol on doxorubicin resistance and chloride channel inhibition in erythroleukemic cell K562/Dox. Zhonghua Zhong Liu Za Zhi. 2005 Feb;27(2):81-5.
38 Long-term thalidomide therapy resulted in lack of mdr1 gene expression in a patient with primary resistant multiple myeloma. Leukemia. 2005 Aug;19(8):1497-9. doi: 10.1038/sj.leu.2403811.
39 Regulation of hepatic drug transporter activity and expression by organochlorine pesticides. J Biochem Mol Toxicol. 2014 Mar;28(3):119-28.
40 Analysis of ATP-binding cassette transporter expression in drug-selected cell lines by a microarray dedicated to multidrug resistance. Mol Pharmacol. 2004 Dec;66(6):1397-405. doi: 10.1124/mol.104.005009. Epub 2004 Sep 1.
41 Effects of ursodeoxycholic acid on P-glycoprotein and cytochrome P450 3A4-dependent pharmacokinetics in humans. Clin Pharmacol Ther. 2006 May;79(5):449-60.
42 Chronic imatinib mesylate exposure leads to reduced intracellular drug accumulation by induction of the ABCG2 (BCRP) and ABCB1 (MDR1) drug transport pumps. Cancer Biol Ther. 2005 Jul;4(7):747-52.
43 Michaelis-Menten kinetic analysis of drugs of abuse to estimate their affinity to human P-glycoprotein. Toxicol Lett. 2013 Feb 27;217(2):137-42. doi: 10.1016/j.toxlet.2012.12.012. Epub 2012 Dec 27.
44 Protective effect of methylprednisolone on paraquat-induced A549 cell cytotoxicity via induction of efflux transporter, P-glycoprotein expression. Toxicol Lett. 2012 Jan 25;208(2):101-7. doi: 10.1016/j.toxlet.2011.10.019. Epub 2011 Oct 31.
45 From the Cover: MechanisticInsights in Cytotoxic and Cholestatic Potential of the Endothelial Receptor Antagonists Using HepaRG Cells. Toxicol Sci. 2017 Jun 1;157(2):451-464. doi: 10.1093/toxsci/kfx062.
46 Acetylated deoxycholic (DCA) and cholic (CA) acids are potent ligands of pregnane X (PXR) receptor. Toxicol Lett. 2017 Jan 4;265:86-96.
47 Editor's Highlight: PlacentalDisposition and Effects of Crizotinib: An Ex Vivo Study in the Isolated Dual-Side Perfused Human Cotyledon. Toxicol Sci. 2017 Jun 1;157(2):500-509. doi: 10.1093/toxsci/kfx063.
48 Mebendazole, an antiparasitic drug, inhibits drug transporters expression in preclinical model of gastric peritoneal carcinomatosis. Toxicol In Vitro. 2017 Sep;43:87-91. doi: 10.1016/j.tiv.2017.06.007. Epub 2017 Jun 9.
49 Chemoresistance to depsipeptide FK228 [(E)-(1S,4S,10S,21R)-7-[(Z)-ethylidene]-4,21-diisopropyl-2-oxa-12,13-dithia-5,8,20,23-tetraazabicyclo[8,7,6]-tricos-16-ene-3,6,9,22-pentanone] is mediated by reversible MDR1 induction in human cancer cell lines. J Pharmacol Exp Ther. 2005 Jul;314(1):467-75. doi: 10.1124/jpet.105.083956. Epub 2005 Apr 15.
50 Identification of novel agonists by high-throughput screening and molecular modelling of human constitutive androstane receptor isoform 3. Arch Toxicol. 2019 Aug;93(8):2247-2264. doi: 10.1007/s00204-019-02495-6. Epub 2019 Jul 16.
51 Modulators and substrates of P-glycoprotein and cytochrome P4503A coordinately up-regulate these proteins in human colon carcinoma cells. Mol Pharmacol. 1996 Feb;49(2):311-8.
52 Rapid induction of P-glycoprotein expression by high permeability compounds in colonic cells in vitro: a possible source of transporter mediated drug interactions?. Biochem Pharmacol. 2004 Aug 15;68(4):783-90. doi: 10.1016/j.bcp.2004.05.006.
53 Co-encapsulation of chrysophsin-1 and epirubicin in PEGylated liposomes circumvents multidrug resistance in HeLa cells. Chem Biol Interact. 2015 Dec 5;242:13-23. doi: 10.1016/j.cbi.2015.08.023. Epub 2015 Sep 1.
54 Effect of abemaciclib (LY2835219) on enhancement of chemotherapeutic agents in ABCB1 and ABCG2 overexpressing cells in vitro and in vivo. Biochem Pharmacol. 2017 Jan 15;124:29-42. doi: 10.1016/j.bcp.2016.10.015. Epub 2016 Nov 2.
55 Cyclooxygenase inhibitors down regulate P-glycoprotein in human colorectal Caco-2 cell line. Pharm Res. 2008 Sep;25(9):1991-2001. doi: 10.1007/s11095-008-9596-1. Epub 2008 Jun 26.
56 Oral and inhaled corticosteroids: differences in P-glycoprotein (ABCB1) mediated efflux. Toxicol Appl Pharmacol. 2012 May 1;260(3):294-302. doi: 10.1016/j.taap.2012.03.008. Epub 2012 Mar 23.
57 ABC-transporter blockage mediated by xanthotoxin and bergapten is the major pathway for chemosensitization of multidrug-resistant cancer cells. Toxicol Appl Pharmacol. 2017 Dec 15;337:22-29. doi: 10.1016/j.taap.2017.10.018. Epub 2017 Oct 25.
58 A structure-function relationship among reserpine and yohimbine analogues in their ability to increase expression of mdr1 and P-glycoprotein in a human colon carcinoma cell line. Mol Pharmacol. 1995 Oct;48(4):682-9.
59 Impact of P-glycoprotein on clopidogrel absorption. Clin Pharmacol Ther. 2006 Nov;80(5):486-501.
60 Functional evaluation of polymorphisms in the human ABCB1 gene and the impact on clinical responses of antiepileptic drugs. Pharmacogenet Genomics. 2008 May;18(5):390-402. doi: 10.1097/FPC.0b013e3282f85e36.
61 Pregnane X receptor mediates the induction of P-glycoprotein by spironolactone in HepG2 cells. Toxicology. 2011 Jul 11;285(1-2):18-24. doi: 10.1016/j.tox.2011.03.015. Epub 2011 Apr 1.
62 Longitudinal effects of thymidine analogues on mtDNA, mtRNA and multidrug resistance (MDR-1) induction in cultured cells. J Antimicrob Chemother. 2008 May;61(5):1048-52. doi: 10.1093/jac/dkn067. Epub 2008 Feb 28.
63 Comparative effects of drugs on P-glycoprotein expression and activity using rat and human trophoblast models. Toxicol In Vitro. 2010 Mar;24(2):630-7. doi: 10.1016/j.tiv.2009.10.005. Epub 2009 Oct 17.
64 Characterization of the ATPase activity of the Mr 170,000 to 180,000 membrane glycoprotein (P-glycoprotein) associated with multidrug resistance in K562/ADM cells. Cancer Res. 1988 Sep 1;48(17):4926-32.
65 Functional and histochemical analysis of MDR3 P-glycoprotein in a tetracycline-controlled gene expression system. Eur J Med Res. 2000 Dec 29;5(12):517-22.
66 Interactions between Oroxylin A with the solute carrier transporters and ATP-binding cassette transporters: Drug transporters profile for this flavonoid. Chem Biol Interact. 2020 Jun 1;324:109097. doi: 10.1016/j.cbi.2020.109097. Epub 2020 Apr 16.
67 Clinical pharmacokinetic monitoring of itraconazole is warranted in only a subset of patients. Ther Drug Monit. 2005 Jun;27(3):322-33. doi: 10.1097/01.ftd.0000150135.22645.ea.
68 Antimalarial artemisinin drugs induce cytochrome P450 and MDR1 expression by activation of xenosensors pregnane X receptor and constitutive androstane receptor. Mol Pharmacol. 2005 Jun;67(6):1954-65.
69 Cepharanthine potently enhances the sensitivity of anticancer agents in K562 cells. Cancer Sci. 2005 Jun;96(6):372-6. doi: 10.1111/j.1349-7006.2005.00057.x.
70 Actions of the selective protein kinase C inhibitor PKC412 on B-chronic lymphocytic leukemia cells in vitro. Haematologica. 2002 Feb;87(2):167-76.
71 Characteristics of P388/VMDRC.04, a simple, sensitive model for studying P-glycoprotein antagonists. Cancer Res. 1994 Feb 1;54(3):730-7.
72 Solomonsterols A and B from Theonella swinhoeiThe first example of C-24 and C-23 sulfated sterols from a marine source endowed with a PXR agonistic activity. J Med Chem. 2011 Jan 13;54(1):401-5.
73 Reversal effects of two new milbemycin compounds on multidrug resistance in MCF-7/adr cells in vitro. Eur J Pharmacol. 2011 Jun 1;659(2-3):108-13. doi: 10.1016/j.ejphar.2011.03.023. Epub 2011 Mar 31.
74 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
75 Induction of drug-metabolizing enzymes and transporters in human bronchial epithelial cells by beclomethasone dipropionate. IUBMB Life. 2004 Jun;56(6):355-9.
76 Karyotypic imbalances and differential gene expressions in the acquired doxorubicin resistance of hepatocellular carcinoma cells. Lab Invest. 2005 May;85(5):664-74. doi: 10.1038/labinvest.3700254.
77 Pharmacokinetic interaction of the antiparasitic agents ivermectin and spinosad in dogs. Drug Metab Dispos. 2011 May;39(5):789-95. doi: 10.1124/dmd.110.034827. Epub 2011 Feb 14.
78 Chronic arsenic-exposed human prostate epithelial cells exhibit stable arsenic tolerance: mechanistic implications of altered cellular glutathione and glutathione S-transferase. Toxicol Appl Pharmacol. 2002 Sep 1;183(2):99-107.
79 MDR1 polymorphisms and response to azathioprine therapy in patients with Crohn's disease. Inflamm Bowel Dis. 2007 May;13(5):585-90. doi: 10.1002/ibd.20044.
80 A mechanistic study on reduced toxicity of irinotecan by coadministered thalidomide, a tumor necrosis factor-alpha inhibitor. J Pharmacol Exp Ther. 2006 Oct;319(1):82-104. doi: 10.1124/jpet.106.103606. Epub 2006 Jun 30.
81 cDNA microarray analysis of isogenic paclitaxel- and doxorubicin-resistant breast tumor cell lines reveals distinct drug-specific genetic signatures of resistance. Breast Cancer Res Treat. 2006 Mar;96(1):17-39. doi: 10.1007/s10549-005-9026-6. Epub 2005 Dec 2.
82 Differential interaction of 3-hydroxy-3-methylglutaryl-coa reductase inhibitors with ABCB1, ABCC2, and OATP1B1. Drug Metab Dispos. 2005 Apr;33(4):537-46.
83 MDR1 causes resistance to the antitumour drug miltefosine. Br J Cancer. 2001 May 18;84(10):1405-11. doi: 10.1054/bjoc.2001.1776.
84 CYP2C9, CYP2C19, ABCB1 (MDR1) genetic polymorphisms and phenytoin metabolism in a Black Beninese population. Pharmacogenet Genomics. 2005 Nov;15(11):779-86.
85 Establishment and characterization of new cellular lymphoma model expressing transgenic human MDR1. Leuk Res. 2005 Apr;29(4):407-14. doi: 10.1016/j.leukres.2004.09.001.
86 Concise prediction models of anticancer efficacy of 8 drugs using expression data from 12 selected genes. Int J Cancer. 2004 Sep 10;111(4):617-26. doi: 10.1002/ijc.20289.
87 Lapatinib (Tykerb, GW572016) reverses multidrug resistance in cancer cells by inhibiting the activity of ATP-binding cassette subfamily B member 1 and G member 2. Cancer Res. 2008 Oct 1;68(19):7905-14. doi: 10.1158/0008-5472.CAN-08-0499.
88 Is there a role for MDR1, EPHX1 and protein Z gene variants in modulation of warfarin dosage? a study on a cohort of the Egyptian population. Mol Diagn Ther. 2014 Feb;18(1):73-83. doi: 10.1007/s40291-013-0055-2.
89 Association of ABCB1/MDR1 and OPRM1 gene polymorphisms with morphine pain relief. Clin Pharmacol Ther. 2008 Apr;83(4):559-66.
90 Neurotoxicity induced by tacrolimus after liver transplantation: relation to genetic polymorphisms of the ABCB1 (MDR1) gene. Transplantation. 2002 Aug 27;74(4):571-2. doi: 10.1097/00007890-200208270-00024.
91 Interactions of protease inhibitors atazanavir and ritonavir with ABCB1, ABCG2, and ABCC2 transporters: Effect on transplacental disposition in rats. Reprod Toxicol. 2018 Aug;79:57-65. doi: 10.1016/j.reprotox.2018.05.008. Epub 2018 May 30.
92 Reversal of ABCB1 mediated efflux by imatinib and nilotinib in cells expressing various transporter levels. Chem Biol Interact. 2017 Aug 1;273:171-179. doi: 10.1016/j.cbi.2017.06.012. Epub 2017 Jun 13.
93 Influence of ABCB1, ABCC1, ABCC2, and ABCG2 haplotypes on the cellular exposure of nelfinavir in vivo. Pharmacogenet Genomics. 2005 Sep;15(9):599-608. doi: 10.1097/01.fpc.0000172241.42546.d3.
94 Characterization of beta-adrenoceptor antagonists as substrates and inhibitors of the drug transporter P-glycoprotein. Fundam Clin Pharmacol. 2006 Jun;20(3):273-82. doi: 10.1111/j.1472-8206.2006.00408.x.
95 ABCB1 (MDR1) gene polymorphisms are associated with the clinical response to paroxetine in patients with major depressive disorder. Prog Neuropsychopharmacol Biol Psychiatry. 2008 Feb 15;32(2):398-404. doi: 10.1016/j.pnpbp.2007.09.003. Epub 2007 Sep 15.
96 Transport inhibition of digoxin using several common P-gp expressing cell lines is not necessarily reporting only on inhibitor binding to P-gp. PLoS One. 2013 Aug 16;8(8):e69394. doi: 10.1371/journal.pone.0069394. eCollection 2013.
97 Effect of MDR1 C3435T polymorphism on lansoprazole in healthy Japanese subjects. Eur J Clin Pharmacol. 2009 Jun;65(6):593-600. doi: 10.1007/s00228-009-0625-8. Epub 2009 Feb 24.
98 Heterogeneous transport of digitalis-like compounds by P-glycoprotein in vesicular and cellular assays. Toxicol In Vitro. 2016 Apr;32:138-45. doi: 10.1016/j.tiv.2015.12.009. Epub 2015 Dec 17.
99 A variant 2677A allele of the MDR1 gene affects fexofenadine disposition. Clin Pharmacol Ther. 2004 Nov;76(5):418-27. doi: 10.1016/j.clpt.2004.08.002.
100 Pharmacogenetics of risperidone therapy in autism: association analysis of eight candidate genes with drug efficacy and adverse drug reactions. Pharmacogenomics J. 2010 Oct;10(5):418-30.
101 A common P-glycoprotein polymorphism is associated with nortriptyline-induced postural hypotension in patients treated for major depression. Pharmacogenomics J. 2002;2(3):191-6.
102 P-Glycoprotein on Blood-Brain Barrier Plays a Vital Role in Fentanyl Brain Exposure and Respiratory Toxicity in Rats. Toxicol Sci. 2018 Jul 1;164(1):353-362. doi: 10.1093/toxsci/kfy093.
103 Stereoselective transport of hydrophilic quaternary drugs by human MDR1 and rat Mdr1b P-glycoproteins. Br J Pharmacol. 2002 Apr;135(7):1685-94. doi: 10.1038/sj.bjp.0704620.
104 Involvement of BCRP (ABCG2) in the biliary excretion of pitavastatin. Mol Pharmacol. 2005 Sep;68(3):800-7.
105 Domperidone treatment for gastroparesis: demographic and pharmacogenetic characterization of clinical efficacy and side-effects. Dig Dis Sci. 2011 Jan;56(1):115-24. doi: 10.1007/s10620-010-1472-2. Epub 2010 Nov 10.
106 Association of ABCB1, 5-HT3B receptor and CYP2D6 genetic polymorphisms with ondansetron and metoclopramide antiemetic response in Indonesian cancer patients treated with highly emetogenic chemotherapy. Jpn J Clin Oncol. 2011 Oct;41(10):1168-76. doi: 10.1093/jjco/hyr117. Epub 2011 Aug 11.
107 Blonanserin, a novel atypical antipsychotic agent not actively transported as substrate by P-glycoprotein. Prog Neuropsychopharmacol Biol Psychiatry. 2012 Oct 1;39(1):156-62. doi: 10.1016/j.pnpbp.2012.06.005. Epub 2012 Jun 9.
108 ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
109 Pharmacogenetics of acenocoumarol: CYP2C9, CYP2C19, CYP1A2, CYP3A4, CYP3A5 and ABCB1 gene polymorphisms and dose requirements. J Clin Pharm Ther. 2007 Dec;32(6):641-9.
110 Expression of drug transporters and drug metabolizing enzymes in the bladder urothelium in man and affinity of the bladder spasmolytic trospium chloride to transporters likely involved in its pharmacokinetics. Mol Pharm. 2015 Jan 5;12(1):171-8.
111 Intestinal P-glycoprotein exports endocannabinoids to prevent inflammation and maintain homeostasis. J Clin Invest. 2018 Aug 31;128(9):4044-4056. doi: 10.1172/JCI96817. Epub 2018 Aug 13.
112 Multiple drug transporters mediate the placental transport of sulpiride. Arch Toxicol. 2017 Dec;91(12):3873-3884. doi: 10.1007/s00204-017-2008-8. Epub 2017 Jun 9.
113 ABCB1 gene variants influence tolerance to selective serotonin reuptake inhibitors in a large sample of Dutch cases with major depressive disorder. Pharmacogenomics J. 2013 Aug;13(4):349-53.
114 Clinical disposition, metabolism and in vitro drug-drug interaction properties of omadacycline. Xenobiotica. 2017 Aug;47(8):682-696. doi: 10.1080/00498254.2016.1213465. Epub 2016 Aug 8.
115 Atorvastatin transport in the Caco-2 cell model: contributions of P-glycoprotein and the proton-monocarboxylic acid co-transporter. Pharm Res. 2000 Feb;17(2):209-15. doi: 10.1023/a:1007525616017.
116 Alisertib shows negligible potential for perpetrating pharmacokinetic drug-drug interactions on ABCB1, ABCG2 and cytochromes P450, but acts as dual-activity resistance modulator through the inhibition of ABCC1 transporter. Toxicol Appl Pharmacol. 2022 Jan 1;434:115823. doi: 10.1016/j.taap.2021.115823. Epub 2021 Dec 9.
117 Pharmacogenetics of tipifarnib (R115777) transport and metabolism in cancer patients. Invest New Drugs. 2004 Aug;22(3):285-9.
118 ATF3 Modulates the Resistance of Breast Cancer Cells to Tamoxifen through an N(6)-Methyladenosine-Based Epitranscriptomic Mechanism. Chem Res Toxicol. 2021 Jul 19;34(7):1814-1821. doi: 10.1021/acs.chemrestox.1c00206. Epub 2021 Jul 2.
119 Role of P-glycoprotein and breast cancer resistance protein-1 in the brain penetration and brain pharmacodynamic activity of the novel phosphatidylinositol 3-kinase inhibitor GDC-0941. Drug Metab Dispos. 2010 Sep;38(9):1422-6. doi: 10.1124/dmd.110.034256. Epub 2010 Jun 3.
120 The SMAC mimetic LCL161 is a direct ABCB1/MDR1-ATPase activity modulator and BIRC5/Survivin expression down-regulator in cancer cells. Toxicol Appl Pharmacol. 2020 Aug 15;401:115080. doi: 10.1016/j.taap.2020.115080. Epub 2020 Jun 1.
121 P-glycoprotein limits the brain penetration of nonsedating but not sedating H1-antagonists. Drug Metab Dispos. 2003 Mar;31(3):312-8.
122 A pilot study on brain-to-plasma partition of 10,11-dyhydro-10-hydroxy-5H-dibenzo(b,f)azepine-5-carboxamide and MDR1 brain expression in epilepsy patients not responding to oxcarbazepine. Epilepsia. 2005 Oct;46(10):1613-9. doi: 10.1111/j.1528-1167.2005.00265.x.
123 Structure-activity relationship and mechanism of flavonoids on the inhibitory activity of P-glycoprotein (P-gp)-mediated transport of rhodamine123 and daunorubicin in P-gp overexpressed human mouth epidermal carcinoma (KB/MDR) cells. Food Chem Toxicol. 2021 Sep;155:112381. doi: 10.1016/j.fct.2021.112381. Epub 2021 Jul 1.
124 ATP-binding cassette transporters as pitfalls in selection of transgenic cells. Anal Biochem. 2010 Apr 15;399(2):246-50. doi: 10.1016/j.ab.2009.12.014. Epub 2009 Dec 14.
125 Consequences of genetic polymorphisms for sirolimus requirements after renal transplant in patients on primary sirolimus therapy. Am J Transplant. 2005 Mar;5(3):595-603.
126 Involvement of P-glycoprotein and MRP1 in resistance to cyclic tetrapeptide subfamily of histone deacetylase inhibitors in the drug-resistant osteosarcoma and Ewing's sarcoma cells. Int J Cancer. 2006 Jan 1;118(1):90-7. doi: 10.1002/ijc.21297.
127 Quinacrine is mainly metabolized to mono-desethyl quinacrine by CYP3A4/5 and its brain accumulation is limited by P-glycoprotein. Drug Metab Dispos. 2006 Jul;34(7):1136-44.
128 Transcellular transport of aconitine across human intestinal Caco-2 cells. Food Chem Toxicol. 2013 Jul;57:195-200. doi: 10.1016/j.fct.2013.03.033. Epub 2013 Apr 2.
129 Adenosine triphosphate-dependent transport of estradiol-17beta(beta-D-glucuronide) in membrane vesicles by MDR1 expressed in insect cells. Hepatology. 1998 Nov;28(5):1371-7. doi: 10.1002/hep.510280528.
130 Interplay between CYP3A-mediated metabolism and polarized efflux of terfenadine and its metabolites in intestinal epithelial Caco-2 (TC7) cell monolayers. Pharm Res. 1999 May;16(5):625-32. doi: 10.1023/a:1018851919674.