Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTG5OS7X)

• DOT Name: Tribbles homolog 3 (TRIB3)
• Synonyms: TRB-3; Neuronal cell death-inducible putative kinase; SINK; p65-interacting inhibitor of NF-kappa-B
• Gene Name: TRIB3
• Related Disease:
  Endometrial cancer
  Endometrial carcinoma
  Myocardial infarction
  Acute myocardial infarction
  Advanced cancer
  Alzheimer disease
  Arteriosclerosis
  Atherosclerosis
  Breast neoplasm
  Cerebral infarction
  Chronic kidney disease
  Colonic neoplasm
  Colorectal carcinoma
  Colorectal neoplasm
  Dilated cardiomyopathy 1A
  Epilepsy
  Gastric cancer
  Hepatitis C virus infection
  Hepatocellular carcinoma
  High blood pressure
  Hyperglycemia
  Lung cancer
  Lung carcinoma
  Metastatic malignant neoplasm
  Myelodysplastic syndrome
  Nephropathy
  Neuroblastoma
  Non-alcoholic fatty liver disease
  Non-alcoholic steatohepatitis
  Non-insulin dependent diabetes
  Non-small-cell lung cancer
  Osteoarthritis
  Parkinson disease
  Polycystic ovarian syndrome
  Pulmonary fibrosis
  Stomach cancer
  Systemic sclerosis
  Triple negative breast cancer
  Type-1/2 diabetes
  Cardiovascular disease
  Diabetic kidney disease
  Lung adenocarcinoma
  Promyelocytic leukaemia
  Type-1 diabetes
  Atrichia with papular lesions
  Cardiomyopathy
  Clear cell renal carcinoma
  Coronary atherosclerosis
  Coronary heart disease
  Melanoma
  Renal cell carcinoma
• UniProt ID: TRIB3_HUMAN
• Pfam ID: PF00069
• Sequence:
  MRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRAT
  AVATASRLGPYVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHV
  ARPTEVLAGTQLLYAFFTRTHGDMHSLVRSRHRIPEPEAAVLFRQMATALAHCHQHGLVL
  RDLKLCRFVFADRERKKLVLENLEDSCVLTGPDDSLWDKHACPAYVGPEILSSRASYSGK
  AADVWSLGVALFTMLAGHYPFQDSEPVLLFGKIRRGAYALPAGLSAPARCLVRCLLRREP
  AERLTATGILLHPWLRQDPMPLAPTRSHLWEAAQVVPDGLGLDEAREEEGDREVVLYG
• Function: Inactive protein kinase which acts as a regulator of the integrated stress response (ISR), a process for adaptation to various stress. Inhibits the transcriptional activity of DDIT3/CHOP and is involved in DDIT3/CHOP-dependent cell death during ER stress. May play a role in programmed neuronal cell death but does not appear to affect non-neuronal cells. Acts as a negative feedback regulator of the ATF4-dependent transcription during the ISR: while TRIB3 expression is promoted by ATF4, TRIB3 protein interacts with ATF4 and inhibits ATF4 transcription activity. Disrupts insulin signaling by binding directly to Akt kinases and blocking their activation. May bind directly to and mask the 'Thr-308' phosphorylation site in AKT1. Interacts with the NF-kappa-B transactivator p65 RELA and inhibits its phosphorylation and thus its transcriptional activation activity. Interacts with MAPK kinases and regulates activation of MAP kinases. Can inhibit APOBEC3A editing of nuclear DNA.
• Tissue Specificity: Highest expression in liver, pancreas, peripheral blood leukocytes and bone marrow. Also highly expressed in a number of primary lung, colon and breast tumors. Expressed in spleen, thymus, and prostate and is undetectable in other examined tissues, including testis, ovary, small intestine, colon, leukocyte, heart, brain, placenta, lung, skeletal muscle, and kidney.
• KEGG Pathway: Insulin resistance (hsa04931)
• Reactome Pathway:
  Activation of AKT2 (R-HSA-165158)
  PPARA activates gene expression (R-HSA-1989781)
  Negative regulation of the PI3K/AKT network (R-HSA-199418)
  CD28 dependent PI3K/Akt signaling (R-HSA-389357)
  VEGFR2 mediated vascular permeability (R-HSA-5218920)
  Response of EIF2AK4 (GCN2) to amino acid deficiency (R-HSA-9633012)
  Response of EIF2AK1 (HRI) to heme deficiency (R-HSA-9648895)
  PIP3 activates AKT signaling (R-HSA-1257604)

Molecular Interaction Atlas (MIA) of This DOT

51 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Endometrial cancer	DISW0LMR	Definitive	Altered Expression	[1]
Endometrial carcinoma	DISXR5CY	Definitive	Altered Expression	[1]
Myocardial infarction	DIS655KI	Definitive	Genetic Variation	[2]
Acute myocardial infarction	DISE3HTG	Strong	Altered Expression	[3]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[4]
Alzheimer disease	DISF8S70	Strong	Biomarker	[5]
Arteriosclerosis	DISK5QGC	Strong	Genetic Variation	[6]
Atherosclerosis	DISMN9J3	Strong	Genetic Variation	[6]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[7]
Cerebral infarction	DISR1WNP	Strong	Altered Expression	[8]
Chronic kidney disease	DISW82R7	Strong	Genetic Variation	[9]
Colonic neoplasm	DISSZ04P	Strong	Biomarker	[10]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[10]
Colorectal neoplasm	DISR1UCN	Strong	Biomarker	[10]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Altered Expression	[11]
Epilepsy	DISBB28L	Strong	Biomarker	[12]
Gastric cancer	DISXGOUK	Strong	Altered Expression	[13]
Hepatitis C virus infection	DISQ0M8R	Strong	Altered Expression	[14]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[15]
High blood pressure	DISY2OHH	Strong	Genetic Variation	[16]
Hyperglycemia	DIS0BZB5	Strong	Altered Expression	[17]
Lung cancer	DISCM4YA	Strong	Biomarker	[18]
Lung carcinoma	DISTR26C	Strong	Biomarker	[18]
Metastatic malignant neoplasm	DIS86UK6	Strong	Altered Expression	[19]
Myelodysplastic syndrome	DISYHNUI	Strong	Biomarker	[20]
Nephropathy	DISXWP4P	Strong	Genetic Variation	[21]
Neuroblastoma	DISVZBI4	Strong	Biomarker	[22]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Biomarker	[23]
Non-alcoholic steatohepatitis	DIST4788	Strong	Biomarker	[23]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Biomarker	[24]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[19]
Osteoarthritis	DIS05URM	Strong	Altered Expression	[25]
Parkinson disease	DISQVHKL	Strong	Altered Expression	[26]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Genetic Variation	[27]
Pulmonary fibrosis	DISQKVLA	Strong	Biomarker	[28]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[13]
Systemic sclerosis	DISF44L6	Strong	Biomarker	[29]
Triple negative breast cancer	DISAMG6N	Strong	Biomarker	[30]
Type-1/2 diabetes	DISIUHAP	Strong	Genetic Variation	[6]
Cardiovascular disease	DIS2IQDX	moderate	Genetic Variation	[9]
Diabetic kidney disease	DISJMWEY	moderate	Genetic Variation	[9]
Lung adenocarcinoma	DISD51WR	moderate	Altered Expression	[31]
Promyelocytic leukaemia	DISYGG13	moderate	Biomarker	[32]
Type-1 diabetes	DIS7HLUB	Disputed	Altered Expression	[33]
Atrichia with papular lesions	DIS80CUB	Limited	Biomarker	[34]
Cardiomyopathy	DISUPZRG	Limited	Autosomal dominant	[35]
Clear cell renal carcinoma	DISBXRFJ	Limited	Altered Expression	[36]
Coronary atherosclerosis	DISKNDYU	Limited	Genetic Variation	[37]
Coronary heart disease	DIS5OIP1	Limited	Genetic Variation	[37]
Melanoma	DIS1RRCY	Limited	Altered Expression	[38]
Renal cell carcinoma	DISQZ2X8	Limited	Altered Expression	[36]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Melphalan	DMOLNHF	Approved	Tribbles homolog 3 (TRIB3) increases the Chromosomal abnormalities and abnormal gene carriers ADR of Melphalan.	[105]

73 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Tribbles homolog 3 (TRIB3).	[39]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Tribbles homolog 3 (TRIB3).	[40]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Tribbles homolog 3 (TRIB3).	[41]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Tribbles homolog 3 (TRIB3).	[42]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Tribbles homolog 3 (TRIB3).	[43]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Tribbles homolog 3 (TRIB3).	[44]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Tribbles homolog 3 (TRIB3).	[45]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Tribbles homolog 3 (TRIB3).	[46]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Tribbles homolog 3 (TRIB3).	[47]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Tribbles homolog 3 (TRIB3).	[48]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Tribbles homolog 3 (TRIB3).	[49]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Tribbles homolog 3 (TRIB3).	[50]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Tribbles homolog 3 (TRIB3).	[51]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Tribbles homolog 3 (TRIB3).	[52]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Tribbles homolog 3 (TRIB3).	[53]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil affects the expression of Tribbles homolog 3 (TRIB3).	[54]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Tribbles homolog 3 (TRIB3).	[55]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Tribbles homolog 3 (TRIB3).	[56]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Tribbles homolog 3 (TRIB3).	[57]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of Tribbles homolog 3 (TRIB3).	[58]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Tribbles homolog 3 (TRIB3).	[59]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Tribbles homolog 3 (TRIB3).	[60]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone decreases the expression of Tribbles homolog 3 (TRIB3).	[59]
Azathioprine	DMMZSXQ	Approved	Azathioprine increases the expression of Tribbles homolog 3 (TRIB3).	[61]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Tribbles homolog 3 (TRIB3).	[62]
Indomethacin	DMSC4A7	Approved	Indomethacin increases the expression of Tribbles homolog 3 (TRIB3).	[63]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol affects the expression of Tribbles homolog 3 (TRIB3).	[64]
Fenofibrate	DMFKXDY	Approved	Fenofibrate decreases the expression of Tribbles homolog 3 (TRIB3).	[65]
Cyclophosphamide	DM4O2Z7	Approved	Cyclophosphamide decreases the expression of Tribbles homolog 3 (TRIB3).	[47]
Capsaicin	DMGMF6V	Approved	Capsaicin increases the expression of Tribbles homolog 3 (TRIB3).	[66]
Methamphetamine	DMPM4SK	Approved	Methamphetamine increases the expression of Tribbles homolog 3 (TRIB3).	[22]
Pioglitazone	DMKJ485	Approved	Pioglitazone decreases the expression of Tribbles homolog 3 (TRIB3).	[65]
Acetic Acid, Glacial	DM4SJ5Y	Approved	Acetic Acid, Glacial increases the expression of Tribbles homolog 3 (TRIB3).	[68]
Thalidomide	DM70BU5	Approved	Thalidomide increases the expression of Tribbles homolog 3 (TRIB3).	[69]
Motexafin gadolinium	DMEJKRF	Approved	Motexafin gadolinium increases the expression of Tribbles homolog 3 (TRIB3).	[68]
Lindane	DMB8CNL	Approved	Lindane increases the expression of Tribbles homolog 3 (TRIB3).	[47]
Bicalutamide	DMZMSPF	Approved	Bicalutamide increases the expression of Tribbles homolog 3 (TRIB3).	[70]
Vitamin C	DMXJ7O8	Approved	Vitamin C decreases the expression of Tribbles homolog 3 (TRIB3).	[71]
Isoniazid	DM5JVS3	Approved	Isoniazid increases the expression of Tribbles homolog 3 (TRIB3).	[72]
Mitotane	DMU1GX0	Approved	Mitotane increases the expression of Tribbles homolog 3 (TRIB3).	[73]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Tribbles homolog 3 (TRIB3).	[74]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Tribbles homolog 3 (TRIB3).	[75]
Curcumin	DMQPH29	Phase 3	Curcumin increases the expression of Tribbles homolog 3 (TRIB3).	[76]
HMPL-004	DM29XGY	Phase 3	HMPL-004 decreases the expression of Tribbles homolog 3 (TRIB3).	[77]
Bardoxolone methyl	DMODA2X	Phase 3	Bardoxolone methyl decreases the expression of Tribbles homolog 3 (TRIB3).	[77]
Chloroquine	DMSI5CB	Phase 3 Trial	Chloroquine increases the expression of Tribbles homolog 3 (TRIB3).	[58]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Tribbles homolog 3 (TRIB3).	[78]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Tribbles homolog 3 (TRIB3).	[79]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol decreases the expression of Tribbles homolog 3 (TRIB3).	[80]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of Tribbles homolog 3 (TRIB3).	[81]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Tribbles homolog 3 (TRIB3).	[83]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Tribbles homolog 3 (TRIB3).	[84]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Tribbles homolog 3 (TRIB3).	[85]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Tribbles homolog 3 (TRIB3).	[87]
MG-132	DMKA2YS	Preclinical	MG-132 decreases the expression of Tribbles homolog 3 (TRIB3).	[88]
Nobiletin	DM7R3B6	Preclinical	Nobiletin increases the expression of Tribbles homolog 3 (TRIB3).	[89]
WIN-55212-2	DMACBIW	Terminated	WIN-55212-2 increases the expression of Tribbles homolog 3 (TRIB3).	[90]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Tribbles homolog 3 (TRIB3).	[91]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Tribbles homolog 3 (TRIB3).	[92]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Tribbles homolog 3 (TRIB3).	[93]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Tribbles homolog 3 (TRIB3).	[94]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Tribbles homolog 3 (TRIB3).	[77]
chloropicrin	DMSGBQA	Investigative	chloropicrin affects the expression of Tribbles homolog 3 (TRIB3).	[95]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Tribbles homolog 3 (TRIB3).	[96]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Tribbles homolog 3 (TRIB3).	[97]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate increases the expression of Tribbles homolog 3 (TRIB3).	[98]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Tribbles homolog 3 (TRIB3).	[99]
Lithium chloride	DMHYLQ2	Investigative	Lithium chloride increases the expression of Tribbles homolog 3 (TRIB3).	[100]
crotylaldehyde	DMTWRQI	Investigative	crotylaldehyde increases the expression of Tribbles homolog 3 (TRIB3).	[101]
CH-223191	DMMJZYC	Investigative	CH-223191 increases the expression of Tribbles homolog 3 (TRIB3).	[102]
Dibutyl phthalate	DMEDGKO	Investigative	Dibutyl phthalate increases the expression of Tribbles homolog 3 (TRIB3).	[103]
AM251	DMTAWHL	Investigative	AM251 increases the expression of Tribbles homolog 3 (TRIB3).	[104]
2-tert-butylbenzene-1,4-diol	DMNXI1E	Investigative	2-tert-butylbenzene-1,4-diol decreases the expression of Tribbles homolog 3 (TRIB3).	[77]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Tribbles homolog 3 (TRIB3).	[82]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Tribbles homolog 3 (TRIB3).	[86]

References

• [1] TRIB3 suppresses proliferation and invasion and promotes apoptosis of endometrial cancer cells by regulating the AKT signaling pathway.Onco Targets Ther. 2019 Mar 27;12:2235-2245. doi: 10.2147/OTT.S189001. eCollection 2019.
• [2] TRIB3 R84 variant is associated with impaired insulin-mediated nitric oxide production in human endothelial cells.Arterioscler Thromb Vasc Biol. 2008 Jul;28(7):1355-60. doi: 10.1161/ATVBAHA.108.162883. Epub 2008 Apr 24.
• [3] Atorvastatin alleviates cardiomyocyte apoptosis by suppressing TRB3 induced by acute myocardial infarction and hypoxia.J Formos Med Assoc. 2017 May;116(5):388-397. doi: 10.1016/j.jfma.2016.07.010. Epub 2016 Sep 17.
• [4] DNA methylation changes involved in the tumor increase in F2 males born to gestationally arsenite-exposed F1 male mice.Cancer Sci. 2019 Aug;110(8):2629-2642. doi: 10.1111/cas.14104. Epub 2019 Jul 25.
• [5] Susceptibility of brain atrophy to TRIB3 in Alzheimer's disease, evidence from functional prioritization in imaging genetics.Proc Natl Acad Sci U S A. 2018 Mar 20;115(12):3162-3167. doi: 10.1073/pnas.1706100115. Epub 2018 Mar 6.
• [6] Tripping on TRIB3 at the junction of health, metabolic dysfunction and cancer.Biochimie. 2016 May;124:34-52. doi: 10.1016/j.biochi.2016.02.005. Epub 2016 Feb 6.
• [7] Tribbles homolog 3 denotes a poor prognosis in breast cancer and is involved in hypoxia response.Breast Cancer Res. 2011 Aug 24;13(4):R82. doi: 10.1186/bcr2934.
• [8] Downregulation of TRB3 protects neurons against apoptosis induced by global cerebral ischemia and reperfusion injury in rats.Neuroscience. 2017 Sep 30;360:118-127. doi: 10.1016/j.neuroscience.2017.07.062. Epub 2017 Aug 4.
• [9] A Drosophila model of insulin resistance associated with the human TRIB3 Q/R polymorphism.Dis Model Mech. 2017 Dec 19;10(12):1453-1464. doi: 10.1242/dmm.030619.
• [10] TRIB3 Interacts With -Catenin and TCF4 to Increase Stem Cell Features of Colorectal Cancer Stem Cells and Tumorigenesis.Gastroenterology. 2019 Feb;156(3):708-721.e15. doi: 10.1053/j.gastro.2018.10.031. Epub 2018 Oct 24.
• [11] Metallothionein Preserves Akt2 Activity and Cardiac Function via Inhibiting TRB3 in Diabetic Hearts.Diabetes. 2018 Mar;67(3):507-517. doi: 10.2337/db17-0219. Epub 2017 Oct 27.
• [12] Inhibition of TRIB3 Protects Against Neurotoxic Injury Induced by Kainic Acid in Rats.Front Pharmacol. 2019 May 22;10:585. doi: 10.3389/fphar.2019.00585. eCollection 2019.
• [13] Overexpression of TRIB3 promotes angiogenesis in human gastric cancer.Oncol Rep. 2016 Oct;36(4):2339-48. doi: 10.3892/or.2016.5017. Epub 2016 Aug 11.
• [14] Nonstructural 3 Protein of Hepatitis C Virus Modulates the Tribbles Homolog 3/Akt Signaling Pathway for Persistent Viral Infection.J Virol. 2016 Jul 27;90(16):7231-7247. doi: 10.1128/JVI.00326-16. Print 2016 Aug 15.
• [15] TRB3 reverses chemotherapy resistance and mediates crosstalk between endoplasmic reticulum stress and AKT signaling pathways in MHCC97H human hepatocellular carcinoma cells.Oncol Lett. 2018 Jan;15(1):1343-1349. doi: 10.3892/ol.2017.7361. Epub 2017 Nov 8.
• [16] Molecular mechanisms in microRNA-mediated TRB3 gene and hypertension left ventricular hypertrophy.Exp Ther Med. 2017 May;13(5):1907-1911. doi: 10.3892/etm.2017.4220. Epub 2017 Mar 10.
• [17] Aberrant hepatic TRIB3 gene expression in insulin-resistant obese humans.Diabetologia. 2010 Sep;53(9):1971-5. doi: 10.1007/s00125-010-1772-2. Epub 2010 May 13.
• [18] TRIB3 promotes lung cancer progression by activating -catenin signaling.Eur J Pharmacol. 2019 Nov 15;863:172697. doi: 10.1016/j.ejphar.2019.172697. Epub 2019 Sep 25.
• [19] Knockdown of TRB3 induces apoptosis in human lung adenocarcinoma cells through regulation of Notch 1 expression.Mol Med Rep. 2013 Jul;8(1):47-52. doi: 10.3892/mmr.2013.1453. Epub 2013 Apr 30.
• [20] From cryptic chromosomal lesions to pathologically relevant genes: integration of SNP-array with gene expression profiling in myelodysplastic syndrome with normal karyotype.Genes Chromosomes Cancer. 2012 May;51(5):419-28. doi: 10.1002/gcc.21927. Epub 2012 Jan 17.
• [21] Silencing of TRB3 Ameliorates Diabetic Tubule Interstitial Nephropathy via PI3K/AKT Signaling in Rats.Med Sci Monit. 2017 Jun 10;23:2816-2824. doi: 10.12659/msm.902581.
• [22] Involvement of C/EBP-related signaling pathway in methamphetamine-induced neuronal autophagy and apoptosis. Toxicol Lett. 2019 Sep 15;312:11-21. doi: 10.1016/j.toxlet.2019.05.003. Epub 2019 May 3.
• [23] Hepatic regulation of VLDL receptor by PPAR/ and FGF21 modulates non-alcoholic fatty liver disease.Mol Metab. 2018 Feb;8:117-131. doi: 10.1016/j.molmet.2017.12.008. Epub 2017 Dec 19.
• [24] Mammalian Pseudokinase TRIB3 in Normal Physiology and Disease: Charting the Progress in Old and New Avenues.Curr Protein Pept Sci. 2017;18(8):819-842. doi: 10.2174/1389203718666170406124547.
• [25] Increased expression of the Akt/PKB inhibitor TRB3 in osteoarthritic chondrocytes inhibits insulin-like growth factor 1-mediated cell survival and proteoglycan synthesis.Arthritis Rheum. 2009 Feb;60(2):492-500. doi: 10.1002/art.24225.
• [26] Autophagy Activation Is Involved in Acidic Fibroblast Growth Factor Ameliorating Parkinson's Disease via Regulating Tribbles Homologue 3.Front Pharmacol. 2019 Dec 2;10:1428. doi: 10.3389/fphar.2019.01428. eCollection 2019.
• [27] Association of TRB3 Q84R polymorphism with polycystic ovary syndrome in Chinese women.Reprod Biol Endocrinol. 2011 Apr 14;9:46. doi: 10.1186/1477-7827-9-46.
• [28] Expression of TRB3 promotes epithelialmesenchymal transition of MLE?2 murine alveolar type II epithelial cells through the TGF?/Smad3 signaling pathway.Mol Med Rep. 2019 Apr;19(4):2869-2875. doi: 10.3892/mmr.2019.9900. Epub 2019 Jan 28.
• [29] Tribbles homologue 3 stimulates canonical TGF- signalling to regulate fibroblast activation and tissue fibrosis.Ann Rheum Dis. 2016 Mar;75(3):609-16. doi: 10.1136/annrheumdis-2014-206234. Epub 2015 Jan 20.
• [30] Tribbles Homolog 3 Involved in Radiation Response of Triple Negative Breast Cancer Cells by Regulating Notch1 Activation.Cancers (Basel). 2019 Jan 22;11(2):127. doi: 10.3390/cancers11020127.
• [31] TRB3 interacts with ERK and JNK and contributes to the proliferation, apoptosis, and migration of lung adenocarcinoma cells.J Cell Physiol. 2020 Jan;235(1):538-547. doi: 10.1002/jcp.28993. Epub 2019 Jun 29.
• [32] Twist of Fate for Acute Promyelocytic Leukemia: TRIB3-TWIST1 Interaction Promotes Resistance.Clin Cancer Res. 2019 Oct 15;25(20):6018-6020. doi: 10.1158/1078-0432.CCR-19-2140. Epub 2019 Aug 12.
• [33] Resveratrol attenuates testicular apoptosis in type 1 diabetic mice: Role of Akt-mediated Nrf2 activation and p62-dependent Keap1 degradation.Redox Biol. 2018 Apr;14:609-617. doi: 10.1016/j.redox.2017.11.007. Epub 2017 Nov 8.
• [34] TRIB3 Promotes APL Progression through Stabilization of the Oncoprotein PML-RAR and Inhibition of p53-Mediated Senescence.Cancer Cell. 2017 May 8;31(5):697-710.e7. doi: 10.1016/j.ccell.2017.04.006.
• [35] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [36] TRIB3 Promotes the Proliferation and Invasion of Renal Cell Carcinoma Cells via Activating MAPK Signaling Pathway.Int J Biol Sci. 2019 Jan 1;15(3):587-597. doi: 10.7150/ijbs.29737. eCollection 2019.
• [37] Infrequent TRIB3 coding variants and coronary artery disease in type 2 diabetes.Atherosclerosis. 2015 Sep;242(1):334-9. doi: 10.1016/j.atherosclerosis.2015.07.030. Epub 2015 Jul 17.
• [38] Metformin reduces TRIB3 expression and restores autophagy flux: an alternative antitumor action.Autophagy. 2018;14(7):1278-1279. doi: 10.1080/15548627.2018.1460022. Epub 2018 Jul 20.
• [39] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [40] Inter-laboratory comparison of human renal proximal tubule (HK-2) transcriptome alterations due to Cyclosporine A exposure and medium exhaustion. Toxicol In Vitro. 2009 Apr;23(3):486-99.
• [41] Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
• [42] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [43] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [44] The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
• [45] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [46] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [47] Transcriptome-based functional classifiers for direct immunotoxicity. Arch Toxicol. 2014 Mar;88(3):673-89.
• [48] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [49] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [50] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [51] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [52] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [53] Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
• [54] Multi-level gene expression profiles affected by thymidylate synthase and 5-fluorouracil in colon cancer. BMC Genomics. 2006 Apr 3;7:68. doi: 10.1186/1471-2164-7-68.
• [55] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [56] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [57] Inhibiting Heat Shock Proteins Can Potentiate the Cytotoxic Effect of Cannabidiol in Human Glioma Cells. Anticancer Res. 2015 Nov;35(11):5827-37.
• [58] Increasing intratumor C/EBP- LIP and nitric oxide levels overcome resistance to doxorubicin in triple negative breast cancer. J Exp Clin Cancer Res. 2018 Nov 27;37(1):286. doi: 10.1186/s13046-018-0967-0.
• [59] Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
• [60] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [61] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [62] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [63] Anti-inflammatory agent indomethacin reduces invasion and alters metabolism in a human breast cancer cell line. Neoplasia. 2007 Mar;9(3):222-35.
• [64] The genomic response of Ishikawa cells to bisphenol A exposure is dose- and time-dependent. Toxicology. 2010 Apr 11;270(2-3):137-49. doi: 10.1016/j.tox.2010.02.008. Epub 2010 Feb 17.
• [65] PML-RAR interaction with TRIB3 impedes PPAR/RXR function and triggers dyslipidemia in acute promyelocytic leukemia. Theranostics. 2020 Aug 15;10(22):10326-10340. doi: 10.7150/thno.45924. eCollection 2020.
• [66] Capsaicin inhibits the migration, invasion and EMT of renal cancer cells by inducing AMPK/mTOR-mediated autophagy. Chem Biol Interact. 2022 Oct 1;366:110043. doi: 10.1016/j.cbi.2022.110043. Epub 2022 Aug 28.
• [67] Involvement of C/EBP-related signaling pathway in methamphetamine-induced neuronal autophagy and apoptosis. Toxicol Lett. 2019 Sep 15;312:11-21. doi: 10.1016/j.toxlet.2019.05.003. Epub 2019 May 3.
• [68] Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
• [69] Polyunsaturated fatty acids synergize with lipid droplet binding thalidomide analogs to induce oxidative stress in cancer cells. Lipids Health Dis. 2010 Jun 2;9:56. doi: 10.1186/1476-511X-9-56.
• [70] Microarray analysis of bicalutamide action on telomerase activity, p53 pathway and viability of prostate carcinoma cell lines. J Pharm Pharmacol. 2005 Jan;57(1):83-92.
• [71] Antiproliferative effect of ascorbic acid is associated with the inhibition of genes necessary to cell cycle progression. PLoS One. 2009;4(2):e4409.
• [72] Comparison of base-line and chemical-induced transcriptomic responses in HepaRG and RPTEC/TERT1 cells using TempO-Seq. Arch Toxicol. 2018 Aug;92(8):2517-2531.
• [73] Effects of mitotane on gene expression in the adrenocortical cell line NCI-H295R: a microarray study. Pharmacogenomics. 2012 Sep;13(12):1351-61. doi: 10.2217/pgs.12.116.
• [74] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [75] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [76] Androgen responsive and refractory prostate cancer cells exhibit distinct curcumin regulated transcriptome. Cancer Biol Ther. 2008 Sep;7(9):1427-35. doi: 10.4161/cbt.7.9.6469. Epub 2008 Sep 4.
• [77] Mapping the dynamics of Nrf2 antioxidant and NFB inflammatory responses by soft electrophilic chemicals in human liver cells defines the transition from adaptive to adverse responses. Toxicol In Vitro. 2022 Oct;84:105419. doi: 10.1016/j.tiv.2022.105419. Epub 2022 Jun 17.
• [78] Dose- and time-dependent transcriptional response of Ishikawa cells exposed to genistein. Toxicol Sci. 2016 May;151(1):71-87.
• [79] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [80] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [81] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [82] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [83] Synergistic effect of JQ1 and rapamycin for treatment of human osteosarcoma. Int J Cancer. 2015 May 1;136(9):2055-64.
• [84] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [85] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [86] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [87] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [88] Proteasome inhibition creates a chromatin landscape favorable to RNA Pol II processivity. J Biol Chem. 2020 Jan 31;295(5):1271-1287. doi: 10.1074/jbc.RA119.011174. Epub 2019 Dec 5.
• [89] Characteristics of nobiletin-mediated alteration of gene expression in cultured cell lines. Biochem Biophys Res Commun. 2013 Feb 15;431(3):530-4.
• [90] Cannabinoids induce apoptosis of pancreatic tumor cells via endoplasmic reticulum stress-related genes. Cancer Res. 2006 Jul 1;66(13):6748-55. doi: 10.1158/0008-5472.CAN-06-0169.
• [91] Genome-wide gene expression profiling of low-dose, long-term exposure of human osteosarcoma cells to bisphenol A and its analogs bisphenols AF and S. Toxicol In Vitro. 2015 Aug;29(5):1060-9.
• [92] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [93] Identification of gene markers for formaldehyde exposure in humans. Environ Health Perspect. 2007 Oct;115(10):1460-6. doi: 10.1289/ehp.10180.
• [94] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [95] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [96] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [97] Linking site-specific loss of histone acetylation to repression of gene expression by the mycotoxin ochratoxin A. Arch Toxicol. 2018 Feb;92(2):995-1014.
• [98] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [99] CD34+ derived macrophage and dendritic cells display differential responses to paraquat. Toxicol In Vitro. 2021 Sep;75:105198. doi: 10.1016/j.tiv.2021.105198. Epub 2021 Jun 9.
• [100] Effects of lithium and valproic acid on gene expression and phenotypic markers in an NT2 neurosphere model of neural development. PLoS One. 2013;8(3):e58822.
• [101] Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.
• [102] Adaptive changes in global gene expression profile of lung carcinoma A549 cells acutely exposed to distinct types of AhR ligands. Toxicol Lett. 2018 Aug;292:162-174.
• [103] In Vitro Exposure of Human Luteinized Mural Granulosa Cells to Dibutyl Phthalate Affects Global Gene Expression. Toxicol Sci. 2017 Nov 1;160(1):180-188. doi: 10.1093/toxsci/kfx170.
• [104] Cannabinoid derivatives induce cell death in pancreatic MIA PaCa-2 cells via a receptor-independent mechanism. FEBS Lett. 2006 Mar 20;580(7):1733-9.
• [105] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.