Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEJGDUW)

DME Name Cytochrome P450 1A2 (CYP1A2)
Synonyms Cytochrome P450 family 1 subfamily A member 2; Cytochrome P450 4; Cytochrome P450-P3; Cytochrome P(3)450; CYP1A2; CYPIA2
Gene Name CYP1A2
UniProt ID
CP1A2_HUMAN
INTEDE ID
DME0003
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
1544
EC Number EC: 1.14.14.1
Oxidoreductase
Oxygen paired donor oxidoreductase
Flavin/flavoprotein donor oxidoreductase
EC: 1.14.14.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MALSQSVPFSATELLLASAIFCLVFWVLKGLRPRVPKGLKSPPEPWGWPLLGHVLTLGKN
PHLALSRMSQRYGDVLQIRIGSTPVLVLSRLDTIRQALVRQGDDFKGRPDLYTSTLITDG
QSLTFSTDSGPVWAARRRLAQNALNTFSIASDPASSSSCYLEEHVSKEAKALISRLQELM
AGPGHFDPYNQVVVSVANVIGAMCFGQHFPESSDEMLSLVKNTHEFVETASSGNPLDFFP
ILRYLPNPALQRFKAFNQRFLWFLQKTVQEHYQDFDKNSVRDITGALFKHSKKGPRASGN
LIPQEKIVNLVNDIFGAGFDTVTTAISWSLMYLVTKPEIQRKIQKELDTVIGRERRPRLS
DRPQLPYLEAFILETFRHSSFLPFTIPHSTTRDTTLNGFYIPKKCCVFVNQWQVNHDPEL
WEDPSEFRPERFLTADGTAINKPLSEKMMLFGMGKRRCIGEVLAKWEIFLFLAILLQQLE
FSVPPGVKVDLTPIYGLTMKHARCEHVQARLRFSIN
Function
This enzyme is involved in the metabolism of various endogenous substrates, including fatty acids, steroid hormones and vitamins. It catalyzes the hydroxylation of carbon-hydrogen bonds and exhibits high catalytic activity for the formation of hydroxyestrogens from estrone (E1) and 17beta- estradiol (E2), namely 2-hydroxy E1 and E2. It metabolizes cholesterol toward 25-hydroxycholesterol, a physiological regulator of cellular cholesterol homeostasis. It also plays a role in the oxidative metabolism of xenobiotics and catalyzes the N-hydroxylation of heterocyclic amines and the O-deethylation of phenacetin. Specificlly, it metabolizes caffeine via N3-demethylation.
KEGG Pathway
Caffeine metabolism (hsa00232 )
Chemical carcinogenesis (hsa05204 )
Drug metabolism - cytochrome P450 (hsa00982 )
Linoleic acid metabolism (hsa00591 )
Metabolic pathways (hsa01100 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Retinol metabolism (hsa00830 )
Steroid hormone biosynthesis (hsa00140 )
Tryptophan metabolism (hsa00380 )
Reactome Pathway
Aromatic amines can be N-hydroxylated or N-dealkylated by CYP1A2 (R-HSA-211957 )
Biosynthesis of maresin-like SPMs (R-HSA-9027307 )
Biosynthesis of protectins (R-HSA-9018681 )
Methylation (R-HSA-156581 )
Synthesis of (16-20)-hydroxyeicosatetraenoic acids (HETE) (R-HSA-2142816 )
Synthesis of epoxy (EET) and dihydroxyeicosatrienoic acids (DHET) (R-HSA-2142670 )
Aflatoxin activation and detoxification (R-HSA-5423646 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
189 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Acenocoumarol DMH75KV Thrombosis DB61-GB90 Approved [1]
Acetaminophen DMUIE76 Pain MG30-MG3Z Approved [2]
Albendazole DMYZ57N Worm infection 1F90.Z Approved [3]
Alosetron DML2A03 Irritable bowel syndrome DD91.0 Approved [4]
Aminophylline DML2NIB Bronchial asthma CA23 Approved [5]
Amiodarone DMUTEX3 Tachyarrhythmias BC71 Approved [6]
Amitriptyline DMK7F9S Depression 6A70-6A7Z Approved [7]
Anagrelide DMSQ8MD Thrombocythemia 3B63 Approved [8]
Apixaban DM89JLN Thrombosis DB61-GB90 Approved [9]
Apremilast DMTWS9E Psoriasis vulgaris EA90 Approved [10]
Aprepitant DM053KT Depression 6A70-6A7Z Approved [11]
Arry-162 DM1P6FR Melanoma 2C30 Approved [12]
Asenapine DMSQZE2 Schizophrenia 6A20 Approved [13]
Axitinib DMGVH6N Renal cell carcinoma 2C90 Approved [14]
Azathioprine DMMZSXQ Organ transplant rejection NE84 Approved [15]
Azelastine DMXTMBJ Allergic conjunctivitis 9A60.02 Approved [16]
Bamifylline DMXLHYN Chronic obstructive pulmonary disease CA22 Approved [17]
Bendamustine hydrochloride DMFH15Z leukaemia 2A60-2B33 Approved [18]
Benzyl alcohol DMBVYDI Head and body lice 1G00.0 Approved [19]
Betaxolol DM6EUL5 Hypertension BA00-BA04 Approved [20]
Bortezomib DMNO38U Mantle cell lymphoma 2A85.5 Approved [21]
Bromazepam DMY9TCW Anxiety disorder 6B00-6B0Z Approved [22]
Caffeine DMKBJWP Orthostatic hypotension BA21 Approved [1]
Capsaicin DMGMF6V Neuropathic pain 8E43.0 Approved [23]
Carbamazepine DMZOLBI Epilepsy 8A60-8A68 Approved [24]
Carvedilol DMHTEAO Congestive heart failure BD10 Approved [25]
Chlorpromazine DMBGZI3 Schizophrenia 6A20 Approved [26]
Chlorzoxazone DMCYVDT Acute pain MG31 Approved [27]
Cilostazol DMZMSCT Intermittent claudication BD40.00 Approved [28]
Cinacalcet DMCX0K3 Hyperparathyroidism 5A51 Approved [28]
Cinnarizine DM7U5QJ Vertigo meniere disease AB31.0 Approved [29]
Clenbuterol DMCKYZ5 Chronic breathing disorder 7A4Z Approved [30]
Clofibrate DMPC1J7 Dysbetalipoproteinemia 5C80.2 Approved [31]
Clonidine DM6RZ9Q Hypertension BA00-BA04 Approved [32]
Clopidogrel DMOL54H Thrombosis DB61-GB90 Approved [33]
Clozapine DMFC71L Schizophrenia 6A20 Approved [34]
Conjugated estrogens DMLT0E1 Menopause symptom GA30.0 Approved [35]
Cyclobenzaprine DM1YBRM Depression 6A70-6A7Z Approved [36]
Dacarbazine DMNPZL4 Melanoma 2C30 Approved [37]
Dapagliflozin DM28UJG Type-2 diabetes 5A11 Approved [38]
Dasatinib DMJV2EK Chronic myelogenous leukaemia 2A20.0 Approved [39]
Daunorubicin DMQUSBT Acute myeloid leukaemia 2A60 Approved [40]
Desipramine DMT2FDC Attention deficit hyperactivity disorder 6A05.Z Approved [41]
Deutetrabenazine DMUPFLI Huntington disease 8A01.10 Approved [42]
Dexmedetomidine DM93L4X Irritability MB24 Approved [43]
Diazepam DM08E9O Epilepsy 8A60-8A68 Approved [44]
Diclofenac DMPIHLS Osteoarthritis FA00-FA05 Approved [45]
Dihydralazine DMZIXU9 Hypertension BA00-BA04 Approved [46]
Dinoprostone DMTYOPD Medical abortion JA00.1Z Approved [47]
Disopyramide DM5SYZP Ventricular arrhythmias BC71 Approved [48]
Domperidone DMBDPY0 Gastrointestinal disease DE2Z Approved [49]
Dopamine DMPGUCF Parkinson disease 8A00.0 Approved [50]
Doxepin DMPI98T Depression 6A70-6A7Z Approved [51]
Doxofylline DMEDKZH Asthma CA23 Approved [17]
DTI-015 DMXZRW0 Brain cancer 2A00 Approved [52]
Duloxetine DM9BI7M Depression 6A70-6A7Z Approved [53]
E-2007 DMJDYNQ Diabetic neuropathy 8C0Z Approved [54]
Efavirenz DMC0GSJ Human immunodeficiency virus infection 1C62 Approved [55]
Eltrombopag DMOGFIX Thrombocytopenia 3B64 Approved [56]
Enasidenib DM8QXOC Acute myeloid leukaemia 2A60 Approved [57]
Ergotamine DMKR3C5 Headache 8A80-8A84 Approved [58]
Erlotinib DMCMBHA Non-small-cell lung cancer 2C25.Y Approved [39]
Erythromycin DM4K7GQ Bacterial infection 1A00-1C4Z Approved [59]
Estradiol DMUNTE3 Breast cancer 2C60-2C65 Approved [60]
Estradiol acetate DM07U2A Hormone replacement therapy 8E01 Approved [61]
Estradiol cypionate DM27Z5T Hormone replacement therapy 8E01 Approved [62]
Estradiol valerate DM8MC6O Hormone replacement therapy 8E01 Approved [62]
Estrone DM5T6US Menopausal and postmenopausal disorder GA30 Approved [63]
Ethanol DMDRQZU Chronic pain MG30 Approved [41]
Etoposide DMNH3PG Solid tumour/cancer 2A00-2F9Z Approved [64]
Etoricoxib DM6A4NW Rheumatoid arthritis FA20 Approved [65]
Flecainide DMSQDLE Tachyarrhythmias BC71 Approved [66]
Flunarizine DMZU5JP Migraine 8A80 Approved [31]
Flunitrazepam DMGR5Z3 Insomnia 7A00-7A0Z Approved [41]
Fluorouracil DMUM7HZ Solid tumour/cancer 2A00-2F9Z Approved [67]
Fluoxetine DM3PD2C Depression 6A70-6A7Z Approved [68]
Flutamide DMK0O7U Prostate cancer 2C82.0 Approved [69]
Frovatriptan DM7RE8P Migraine 8A80 Approved [58]
Granisetron DMIUW25 Nausea and vomiting MD90 Approved [70]
Grepafloxacin DMGLX0T Chronic bronchitis CA20.1 Approved [71]
Griseofulvin DMK54YG Ringworm infection 1F28 Approved [72]
Guanabenz DM5QWEL High blood pressure BA00 Approved [73]
Haloperidol DM96SE0 Schizophrenia 6A20 Approved [74]
Hesperetin DMKER83 High blood cholesterol level 5C80.00 Approved [75]
Hexobarbital DMQ314B Anaesthesia 9A78.6 Approved [76]
Idebenone DMQFDRC Cognitive impairment 6D71 Approved [77]
Imatinib DM7RJXL Acute lymphoblastic leukaemia 2A85 Approved [78]
Imipramine DM2NUH3 Depression 6A70-6A7Z Approved [79]
Imiquimod DM1TMA3 Skin cancer 2C30-2C37 Approved [41]
Ipriflavone DM0IO13 Osteoporosis FB83.0 Approved [80]
Istradefylline DM20VSK Parkinson disease 8A00.0 Approved [81]
Leflunomide DMR8ONJ Arthritis FA20 Approved [73]
Levobupivacaine DM783CH Anaesthesia 9A78.6 Approved [82]
Lidocaine DML4ZOT Anaesthesia 9A78.6 Approved [73]
Lofexidine DM1WXA6 Heroin and opiate withdrawal 6C43 Approved [83]
Lomefloxacin DMVRH9C Bacterial infection 1A00-1C4Z Approved [84]
Loratadine DMF3AN7 Allergy 4A80-4A85 Approved [85]
Lorcaserin DMG6OYJ Obesity 5B81 Approved [86]
Loxapine DM8AI9U Schizophrenia 6A20 Approved [87]
Lumiracoxib DM1S4AG Knee osteoarthritis FA01 Approved [88]
Luvox DMJKROX Anxiety disorder 6B00-6B0Z Approved [89]
Malathion DMXZ84M Pediculus capitis infestation 1G00.0 Approved [90]
Maprotiline DMPWB7T Major depressive disorder 6A70.3 Approved [91]
Melatonin DMKWFBT Insomnia 7A00-7A0Z Approved [92]
Menadione DMSJDTY Vitamin K deficiency 5B59 Approved [93]
Mephenytoin DM5UGDK Epilepsy 8A60-8A68 Approved [94]
Methadone DMTW6IU Dry cough MD12 Approved [95]
Methoxyflurane DML0RAE Anaesthesia 9A78.6 Approved [96]
Methyldopa DM5I621 Hypertension BA00-BA04 Approved [97]
Metoclopramide DMFA5MY Nausea MD90 Approved [98]
Mexiletine DMCTE9R Ventricular tachycardia BC71 Approved [99]
Mianserin DMVKA4O Depression 6A70-6A7Z Approved [100]
Mirtazapine DML53ZJ Depression 6A70-6A7Z Approved [101]
MLN9708 DMCMETN Amyloidosis 5D00 Approved [102]
Nabumetone DMAT2XH Pain MG30-MG3Z Approved [103]
Naproxen DMZ5RGV Osteoarthritis FA00-FA05 Approved [104]
Nicotine DMWX5CO Nicotine dependence 6C4A.2 Approved [105]
Nifedipine DMSVOZT Angina pectoris BA40 Approved [106]
Norethindrone acetate DMDGCQP Menorrhagia GA20.50 Approved [107]
Norfloxacin DMIZ6W2 Bacterial infection 1A00-1C4Z Approved [68]
Nortriptyline DM4KDYJ Depression 6A70-6A7Z Approved [108]
Olanzapine DMPFN6Y Schizophrenia 6A20 Approved [109]
Ondansetron DMOTQ1I Chemotherapy-induced nausea MD90 Approved [110]
Oxaliplatin DMQNWRD Colorectal cancer 2B91.Z Approved [111]
Oxtriphylline DMLHSE3 Cough MD12 Approved [112]
Pantoprazole DMSVOCZ Gastroesophageal reflux disease DA22.Z Approved [41]
Paroxetine DM5PVQE Depression 6A70-6A7Z Approved [113]
Pazopanib DMF57DM Renal cell carcinoma 2C90 Approved [114]
Pentamidine DMHZJCG Fungal infection 1F29-1F2F Approved [115]
Pentoxifylline DMU3DNC Intermittent claudication BD40.00 Approved [116]
Perazine DM2AOTZ Psychotic disorder 6A20-6A25 Approved [117]
Perphenazine DMA4MRX Schizophrenia 6A20 Approved [118]
Pimozide DMW83TP Schizophrenia 6A20 Approved [119]
Pirfenidone DM6VZFQ Idiopathic pulmonary fibrosis CB03.4 Approved [120]
Pomalidomide DMTGBAX Systemic sclerosis 4A42 Approved [121]
Praziquantel DMOU1PK Flatworm infection 1F70-1F86 Approved [115]
Primaquine DMWQ16I Malaria 1F40-1F45 Approved [115]
Procarbazine DMIK367 Hodgkin lymphoma 2B30 Approved [122]
Proguanil DMBL79I Malaria 1F40-1F45 Approved [94]
Promazine DMZAL7W Psychomotor agitation MB23.M Approved [123]
Propafenone DMPIBJK Tachyarrhythmias BC71 Approved [124]
Propentofylline propionate DM6JQ2I Alzheimer disease 8A20 Approved [17]
Propofol DMB4OLE Anaesthesia 9A78.6 Approved [125]
Propranolol DM79NTF Migraine 8A80 Approved [73]
Pyrazinamide DM4IF32 Mycobacterium infection 1B10-1B21 Approved [126]
Quinine DMSWYF5 Malaria 1F40-1F45 Approved [127]
Ramelteon DM7IW9J Insomnia 7A00-7A0Z Approved [128]
Ramosetron DMH7GN8 Nausea and vomiting MD90 Approved [129]
Ranitidine DM0GUSX Peptic ulcer DA61 Approved [130]
Rasagiline DM3WKQ4 Parkinson disease 8A00.0 Approved [131]
Rifampicin DM5DSFZ Osteoporosis FB83.0 Approved [132]
Riluzole DMECBWN Amyotrophic lateral sclerosis 8B60.0 Approved [133]
Rofecoxib DM3P5DA Osteoarthritis FA00-FA05 Approved [134]
Roflumilast DMPGHY8 Asthma CA23 Approved [135]
Ropinirole DMA6S1D Parkinson disease 8A00.0 Approved [136]
Ropivacaine DMSPJG2 Anaesthesia 9A78.6 Approved [137]
Rucaparib DM9PVX8 Ovarian cancer 2C73 Approved [138]
Selegiline hydrochloride DM3VR1L Parkinson disease 8A00.0 Approved [139]
Sertraline DM0FB1J Depression 6A70-6A7Z Approved [140]
Sorafenib DMS8IFC Hepatocellular carcinoma 2C12.02 Approved [141]
Stiripentol DMMSDOY Dravet syndrome 8A61.11 Approved [142]
Tacrine DM51FY6 Alzheimer disease 8A20 Approved [73]
Tamoxifen DMLB0EZ Breast cancer 2C60-2C65 Approved [143]
Tasimelteon DMLOQ1V Insomnia 7A00-7A0Z Approved [144]
Tegafur DM31ZQM Solid tumour/cancer 2A00-2F9Z Approved [41]
Terbinafine DMI6HUW Fungal infection 1F29-1F2F Approved [145]
Theobromine DMM8D3F Asthma CA23 Approved [146]
Theophylline DMRJFN9 Chronic obstructive pulmonary disease CA22 Approved [147]
Thiabendazole DM7YCK3 Dutch elm disease 8D64 Approved [73]
Thiothixene DMDINC4 Schizophrenia 6A20 Approved [148]
Tizanidine DMR2IQ4 Spasm MB47.3 Approved [73]
Tocainide DMYNMDP Ventricular arrhythmias BC71 Approved [149]
Tolperisone DMA2GHJ Muscle spasm MB47.3 Approved [150]
Triamterene DM2HU9I Congestive heart failure BD10 Approved [151]
Triclabendazole DMPWGBR Helminth infection 1F90.0 Approved [152]
Trifluoperazine DMKBYWI Schizophrenia 6A20 Approved [153]
Ulipristal DMBNI20 Contraception QA21 Approved [154]
Verapamil DMA7PEW Hypertension BA00-BA04 Approved [155]
Vincamine DMK1ZOR Cerebrovascular disease 8B2Z Approved [156]
Vitamin A DMJ2AH4 Night blindness 9D45 Approved [157]
Voxilaprevir DMAI83D Hepatitis virus infection 1E50-1E51 Approved [158]
Warfarin DMJYCVW Atrial fibrillation BC81.3 Approved [159]
Zileuton DMVRIC2 Asthma CA23 Approved [73]
Zolmitriptan DM1IB4Q Migraine 8A80 Approved [44]
Zolpidem DMWOSKJ Insomnia 7A00-7A0Z Approved [160]
Zotepine DMF3VXA Anxiety disorder 6B00-6B0Z Approved [161]
Icotinib hydrochloride DM5GFIK Non-small-cell lung cancer 2C25.Y Registered [162]
Aminophenazone DMY2AH1 Anaesthesia 9A78.6 Phase 4 [41]
Pentifylline DMQY873 Dementia 6D80-6D86 Phase 4 [17]
⏷ Show the Full List of 189 Approved Drug(s)
21 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
5-methoxypsoralen DME2A8X Psoriasis vulgaris EA90 Phase 3 [163]
Bicifadine DM42GP9 Chronic low back pain MG30.02 Phase 3 [164]
Momelotinib DMF98Q0 Myelofibrosis 2A20.2 Phase 3 [165]
Pracinostat DMTD7AB Acute myeloid leukaemia 2A60 Phase 3 [166]
Resveratrol DM3RWXL Giant cell arteritis 4A44.2 Phase 3 [167]
Sumanirole DMYHV17 Parkinson disease 8A00.0 Phase 3 [168]
TKI258 DMYLT67 Renal cell carcinoma 2C90 Phase 3 [169]
Fexinidazole DMOYE70 Trypanosomiasis 1D51-1F53 Phase 2/3 [170]
Genistein DM0JETC Menopause symptom GA30.0 Phase 2/3 [171]
Sarizotan DMH7IPW Rett syndrome LD90.4 Phase 2/3 [172]
BCP-13498 DM2BO9W Anaesthesia 9A78.6 Phase 2 [173]
Famitinib DMSFWT7 Solid tumour/cancer 2A00-2F9Z Phase 2 [174]
GTS-21 DMEN5KA Parkinson disease 8A00.0 Phase 2 [175]
Lisofylline DMVU9X1 Type-1 diabetes 5A10 Phase 2 [176]
Pyrazoloacridine DMSOPAU Colorectal cancer 2B91.Z Phase 2 [126]
Vadimezan DMK7CYX Solid tumour/cancer 2A00-2F9Z Phase 2 [177]
H3B-6545 DMIFCY2 Breast cancer 2C60-2C65 Phase 1/2 [178]
TG02 DMZFIGQ Anaplastic astrocytoma 2A00.0 Phase 1/2 [179]
MLN8054 DMUANF3 Solid tumour/cancer 2A00-2F9Z Phase 1 [180]
NSC-38348 DM96RD5 Asthma CA23 Phase 1 [17]
Xanthine DMFBOQ7 Apnea MD11.0 Phase 1 [181]
⏷ Show the Full List of 21 Clinical Trial Drug(s)
9 Discontinued Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Agomelatine DMXYA5K Major depressive disorder 6A70.3 Withdrawn from market [182]
Dexfenfluramine DMJ7YDS Obesity 5B81 Withdrawn from market [183]
Phenacetin DMRQAM0 Analgesia MB40.8 Withdrawn from market [184]
Temafloxacin DM3TON2 Bacterial infection 1A00-1C4Z Withdrawn from market [84]
Bropirimine DMMT1YQ Virus infection 1A24-1D9Z Discontinued in Phase 3 [185]
Benzydamine DMEQL9U Chemotherapy or radiotherapy-induced mucositis DA42-DA60 Discontinued in Phase 2 [41]
Nemifitide DM6VP9U Major depressive disorder 6A70.3 Discontinued in Phase 2 [186]
Mofarotene DMKHEQL Solid tumour/cancer 2A00-2F9Z Discontinued in Phase 1 [187]
VR-776 DMFQWNI Premature ejaculation HA03.0Z Discontinued in Phase 1 [188]
⏷ Show the Full List of 9 Discontinued Drug(s)
12 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
6-Benzyloxy-9H-purin-2-ylamine DMFI7A8 Discovery agent N.A. Investigative [189]
Acefylline DMVTSM8 Discovery agent N.A. Investigative [17]
Acriflavinium chloride DMYZJ5B Trypanosomiasis 1D51-1F53 Investigative [190]
Cyamemazine DMZ6YPV Discovery agent N.A. Investigative [191]
Fenethylline DM34V5W Narcolepsy 7A20 Investigative [17]
Guajazulen DMGYMW4 Allergy 4A80-4A85 Investigative [192]
Hypoxanthine DMLSABI Discovery agent N.A. Investigative [181]
Imipramine oxide DMZKABS Depression 6A70-6A7Z Investigative [193]
NSC-6113 DMX2YH7 Discovery agent N.A. Investigative [194]
Paraoxon DMN4ZKC Discovery agent N.A. Investigative [195]
Phenazone DMCE985 Discovery agent N.A. Investigative [1]
[3H]estrone-3-sulphate DMGPF0N Discovery agent N.A. Investigative [196]
⏷ Show the Full List of 12 Investigative Drug(s)

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 7.09E-03 2.84E-02 1.20E-01
Alopecia ED70 Skin from scalp 2.61E-01 1.30E-02 4.47E-02
Alzheimer's disease 8A20 Entorhinal cortex 7.36E-01 1.62E-02 1.08E-01
Ankylosing spondylitis FA92.0 Pheripheral blood 9.79E-01 -4.52E-03 -4.20E-02
Aortic stenosis BB70 Calcified aortic valve 8.87E-01 2.16E-02 3.19E-02
Apnea 7A40 Hyperplastic tonsil 4.45E-01 -2.01E-01 -9.71E-01
Arthropathy FA00-FA5Z Peripheral blood 1.58E-01 5.31E-02 3.04E-01
Asthma CA23 Nasal and bronchial airway 7.57E-07 -1.95E-01 -4.24E-01
Atopic dermatitis EA80 Skin 3.19E-04 1.36E-01 1.10E+00
Autism 6A02 Whole blood 6.97E-01 -3.00E-02 -1.52E-01
Autoimmune uveitis 9A96 Peripheral monocyte 4.41E-01 -5.06E-02 -3.68E-01
Autosomal dominant monocytopenia 4B04 Whole blood 7.11E-01 4.86E-03 2.07E-02
Bacterial infection of gingival 1C1H Gingival tissue 7.68E-01 7.33E-03 2.32E-02
Batten disease 5C56.1 Whole blood 7.58E-01 -2.44E-02 -2.37E-01
Behcet's disease 4A62 Peripheral blood 2.40E-01 5.14E-02 3.61E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.61E-01 -1.90E-02 -1.45E-01
Bladder cancer 2C94 Bladder tissue 1.80E-03 5.04E-01 1.94E+00
Breast cancer 2C60-2C6Z Breast tissue 4.34E-02 -5.62E-03 -1.44E-02
Cardioembolic stroke 8B11.20 Whole blood 7.40E-01 -5.05E-02 -3.04E-01
Cervical cancer 2C77 Cervical tissue 1.02E-01 -9.34E-02 -4.78E-01
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.84E-01 8.25E-02 5.13E-01
Chronic hepatitis C 1E51.1 Whole blood 1.87E-01 5.65E-02 4.21E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 1.10E-01 1.11E-01 3.52E-01
Chronic obstructive pulmonary disease CA22 Small airway epithelium 9.15E-01 -4.48E-02 -1.91E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 1.58E-01 8.92E-02 6.05E-01
Colon cancer 2B90 Colon tissue 7.40E-09 -1.57E-01 -6.38E-01
Coronary artery disease BA80-BA8Z Peripheral blood 4.37E-01 -1.71E-01 -1.07E+00
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 7.86E-01 -1.05E-01 -5.26E-01
Endometriosis GA10 Endometrium tissue 8.54E-01 -5.96E-03 -1.84E-02
Familial hypercholesterolemia 5C80.00 Peripheral blood 9.47E-01 2.03E-02 1.38E-01
Familial hypercholesterolemia 5C80.00 Whole blood 2.57E-07 -2.91E-01 -1.32E+00
Gastric cancer 2B72 Gastric tissue 2.47E-01 -4.22E-01 -1.43E+00
Glioblastopma 2A00.00 Nervous tissue 5.68E-18 -1.46E-01 -5.75E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 6.80E-01 -3.78E-02 -2.75E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 6.78E-06 -1.01E+00 -3.20E+00
Head and neck cancer 2D42 Head and neck tissue 7.26E-01 -3.16E-02 -1.31E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.83E-02 -8.34E-02 -4.89E-01
Huntington's disease 8A01.10 Whole blood 1.24E-01 8.50E-02 5.05E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.17E-01 -1.52E-01 -5.12E-01
Immunodeficiency 4A00-4A20 Peripheral blood 2.10E-01 3.91E-02 2.93E-01
Influenza 1E30 Whole blood 7.38E-02 4.76E-01 2.31E+00
Interstitial cystitis GC00.3 Bladder tissue 2.89E-01 -1.42E-01 -6.04E-01
Intracranial aneurysm 8B01.0 Intracranial artery 1.95E-01 6.90E-02 3.70E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 7.61E-02 4.91E-02 2.36E-01
Ischemic stroke 8B11 Peripheral blood 9.40E-02 1.42E-01 6.39E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 1.08E-03 8.52E-02 4.34E-01
Lateral sclerosis 8B60.4 Skin 1.78E-01 -1.19E-01 -1.50E+00
Lateral sclerosis 8B60.4 Cervical spinal cord 4.96E-02 5.36E-01 1.70E+00
Liver cancer 2C12.0 Liver tissue 1.81E-28 -4.64E+00 -4.14E+00
Liver failure DB99.7-DB99.8 Liver tissue 1.41E-08 -4.43E+00 -5.74E+00
Lung cancer 2C25 Lung tissue 5.52E-19 -2.25E-01 -5.53E-01
Lupus erythematosus 4A40 Whole blood 7.82E-02 6.06E-02 1.05E-01
Major depressive disorder 6A70-6A7Z Hippocampus 8.68E-01 3.64E-02 2.72E-01
Major depressive disorder 6A70-6A7Z Whole blood 8.16E-01 -3.19E-02 -1.62E-01
Melanoma 2C30 Skin 5.08E-01 4.54E-02 8.43E-02
Multiple myeloma 2A83.1 Peripheral blood 4.57E-01 -2.61E-02 -1.37E-01
Multiple myeloma 2A83.1 Bone marrow 1.91E-02 -2.13E-01 -9.08E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 9.96E-01 -7.53E-02 -5.68E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 8.12E-01 3.88E-03 1.91E-02
Myelofibrosis 2A20.2 Whole blood 9.49E-01 1.64E-02 1.45E-01
Myocardial infarction BA41-BA50 Peripheral blood 1.89E-01 1.87E-01 3.46E-01
Myopathy 8C70.6 Muscle tissue 2.66E-01 -1.64E-01 -9.58E-01
Neonatal sepsis KA60 Whole blood 2.46E-02 -1.52E-01 -6.66E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 6.17E-05 -7.40E-01 -2.38E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 5.12E-01 -4.38E-02 -3.17E-02
Obesity related type 2 diabetes 5A11 Omental adipose tissue 6.35E-02 7.63E-02 7.60E-01
Olive pollen allergy CA08.00 Peripheral blood 1.55E-02 3.24E-01 3.18E+00
Oral cancer 2B6E Oral tissue 2.86E-04 -2.07E-01 -8.44E-01
Osteoarthritis FA00-FA0Z Synovial tissue 6.49E-01 -7.95E-02 -4.15E-01
Osteoporosis FB83.1 Bone marrow 1.54E-02 2.08E-01 1.34E+00
Ovarian cancer 2C73 Ovarian tissue 1.57E-01 -2.01E-01 -6.73E-01
Pancreatic cancer 2C10 Pancreas 8.07E-01 -1.65E-01 -4.62E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 8.46E-01 -6.63E-03 -4.49E-02
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 9.47E-02 4.02E-02 3.91E-01
Pituitary cancer 2D12 Pituitary tissue 1.93E-01 2.93E-01 6.82E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 9.18E-02 4.85E-02 2.43E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 9.40E-01 4.31E-03 3.22E-02
Polycythemia vera 2A20.4 Whole blood 4.17E-01 4.45E-03 3.46E-02
Pompe disease 5C51.3 Biceps muscle 1.21E-01 -1.54E-01 -1.17E+00
Preterm birth KA21.4Z Myometrium 1.65E-01 -5.01E-02 -9.53E-01
Prostate cancer 2C82 Prostate 4.89E-02 -3.74E-01 -6.96E-01
Psoriasis EA90 Skin 4.87E-15 -3.01E-01 -6.41E-01
Rectal cancer 2B92 Rectal colon tissue 2.43E-01 9.13E-02 3.60E-01
Renal cancer 2C90-2C91 Kidney 1.44E-01 -3.59E-01 -1.14E+00
Retinoblastoma 2D02.2 Uvea 1.36E-02 -1.81E-01 -1.54E+00
Rheumatoid arthritis FA20 Synovial tissue 7.68E-02 -2.10E-01 -6.42E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 2.28E-01 -5.04E-02 -5.16E-01
Schizophrenia 6A20 Prefrontal cortex 6.73E-02 6.49E-02 3.07E-01
Schizophrenia 6A20 Superior temporal cortex 6.45E-01 2.07E-02 1.74E-01
Scleroderma 4A42.Z Whole blood 7.03E-01 -3.32E-02 -3.25E-01
Seizure 8A60-8A6Z Whole blood 9.71E-01 2.51E-02 1.55E-01
Sensitive skin EK0Z Skin 3.39E-01 -5.00E-02 -4.71E-01
Sepsis with septic shock 1G41 Whole blood 6.42E-02 4.07E-02 1.50E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.93E-01 3.11E-01 8.10E-01
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.47E-01 1.36E-01 5.68E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 4.54E-01 3.27E-02 5.50E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.58E-01 -1.57E-01 -1.10E+00
Skin cancer 2C30-2C3Z Skin 5.21E-12 -2.23E-01 -4.75E-01
Thrombocythemia 3B63 Whole blood 6.75E-01 4.94E-02 4.06E-01
Thrombocytopenia 3B64 Whole blood 4.45E-01 4.11E-01 1.01E+00
Thyroid cancer 2D10 Thyroid 3.17E-03 -1.33E-01 -4.42E-01
Tibial muscular dystrophy 8C75 Muscle tissue 4.39E-01 -4.78E-02 -2.19E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 3.06E-01 1.61E-01 1.16E+00
Type 2 diabetes 5A11 Liver tissue 5.25E-01 -4.04E-01 -5.29E-01
Ureter cancer 2C92 Urothelium 4.20E-01 -1.49E-01 -4.71E-01
Uterine cancer 2C78 Endometrium tissue 2.25E-08 -1.79E-01 -6.25E-01
Vitiligo ED63.0 Skin 4.27E-01 -1.60E-01 -3.99E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Cholesterol 25-hydroxylase DTT Info

References

1 Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development. Curr Med Chem. 2009;16(27):3480-675.
2 PharmGKB summary: pathways of acetaminophen metabolism at the therapeutic versus toxic doses. Pharmacogenet Genomics. 2015 Aug;25(8):416-26.
3 Cytochrome P450 1A1/2 induction by antiparasitic drugs: dose-dependent increase in ethoxyresorufin O-deethylase activity and mRNA caused by quinine, primaquine and albendazole in HepG2 cells. Eur J Clin Pharmacol. 2002 Nov;58(8):537-42.
4 Optimizing outcomes with alosetron hydrochloride in severe diarrhea-predominant irritable bowel syndrome. Therap Adv Gastroenterol. 2010 May;3(3):165-72.
5 Lack of effect of olanzapine on the pharmacokinetics of a single aminophylline dose in healthy men. Pharmacotherapy. 1998 Nov-Dec;18(6):1237-48.
6 Role of desethylamiodarone in the anticoagulant effect of concurrent amiodarone and warfarin therapy. J Cardiovasc Pharmacol Ther. 2001 Oct;6(4):363-7.
7 The genetic profiles of CYP1A1, CYP1A2 and CYP2E1 enzymes as susceptibility factor in xenobiotic toxicity in Turkish population. Saudi Pharm J. 2017 Feb;25(2):294-297.
8 Open-label, dose-titration and continuation study to assess efficacy, safety, and pharmacokinetics of anagrelide in treatment-nae Japanese patients with essential thrombocythemia. Int J Hematol. 2013 Mar;97(3):360-8.
9 Apixaban. Hosp Pharm. 2013 Jun;48(6):494-509.
10 Apremilast (Otezla): a new oral treatment for adults with psoriasis and psoriatic arthritis. P T. 2015 Aug;40(8):495-500.
11 Cytochrome P450 3A4 is the major enzyme involved in the metabolism of the substance P receptor antagonist aprepitant. Drug Metab Dispos. 2004 Nov;32(11):1287-92.
12 FDA Label of Binimetinib. The 2020 official website of the U.S. Food and Drug Administration.
13 Asenapine review, part I: chemistry, receptor affinity profile, pharmacokinetics and metabolism. Expert Opin Drug Metab Toxicol. 2014 Jun;10(6):893-903.
14 Clinical pharmacology of axitinib. Clin Pharmacokinet. 2013 Sep;52(9):713-25.
15 Brassica vegetables increase and apiaceous vegetables decrease cytochrome P450 1A2 activity in humans: changes in caffeine metabolite ratios in response to controlled vegetable diets. Carcinogenesis. 2000 Jun;21(6):1157-62.
16 In vitro identification of the human cytochrome P-450 enzymes involved in the N-demethylation of azelastine. Drug Metab Dispos. 1999 Aug;27(8):942-6.
17 PharmGKB summary: caffeine pathway. Pharmacogenet Genomics. 2012 May;22(5):389-95.
18 Pharmacokinetic and pharmacodynamic profile of bendamustine and its metabolites. Cancer Chemother Pharmacol. 2015 Jun;75(6):1143-54.
19 Cytochrome P450 isozymes responsible for the metabolism of toluene and styrene in human liver microsomes. Xenobiotica. 1997 Jul;27(7):657-65.
20 Drugs that may have potential CYP1A2 interactions.
21 Human metabolism of the proteasome inhibitor bortezomib: identification of circulating metabolites. Drug Metab Dispos. 2005 Jun;33(6):771-7.
22 Selective serotonin reuptake inhibitors and CNS drug interactions. A critical review of the evidence. Clin Pharmacokinet. 1997 Dec;33(6):454-71.
23 Metabolism of capsaicin by cytochrome P450 produces novel dehydrogenated metabolites and decreases cytotoxicity to lung and liver cells. Chem Res Toxicol. 2003 Mar;16(3):336-49.
24 Interactions between antiepileptics and second-generation antipsychotics. Expert Opin Drug Metab Toxicol. 2012 Mar;8(3):311-34.
25 Pharmacokinetic interactions study between carvedilol and some antidepressants in rat liver microsomes - a comparative study. Med Pharm Rep. 2019 Apr;92(2):158-164.
26 Functional polymorphisms of the cytochrome P450 1A2 (CYP1A2) gene and prolonged QTc interval in schizophrenia. Prog Neuropsychopharmacol Biol Psychiatry. 2007 Aug 15;31(6):1297-302.
27 Inhibitory monoclonal antibodies to human cytochrome P450 1A2: analysis of phenacetin O-deethylation in human liver. Pharmacogenetics. 1998 Oct;8(5):375-82.
28 Effects of CYP3A inhibition on the metabolism of cilostazol. Clin Pharmacokinet. 1999;37 Suppl 2:61-8.
29 Insights into the substrate specificity, inhibitors, regulation, and polymorphisms and the clinical impact of human cytochrome P450 1A2. AAPS J. 2009 Sep;11(3):481-94.
30 Beta-adrenergic receptor modulation of the LPS-mediated depression in CYP1A activity in astrocytes. Biochem Pharmacol. 2005 Mar 1;69(5):741-50.
31 Oxidative metabolism of flunarizine and cinnarizine by microsomes from B-lymphoblastoid cell lines expressing human cytochrome P450 enzymes. Biol Pharm Bull. 1996 Nov;19(11):1511-4.
32 CYP2D6 mediates 4-hydroxylation of clonidine in vitro: implication for pregnancy-induced changes in clonidine clearance. Drug Metab Dispos. 2010 Sep;38(9):1393-6.
33 Clinical pharmacokinetics and pharmacodynamics of clopidogrel. Clin Pharmacokinet. 2015 Feb;54(2):147-66.
34 Metabolic drug interactions with newer antipsychotics: a comparative review. Basic Clin Pharmacol Toxicol. 2007 Jan;100(1):4-22.
35 Effect of conjugated equine estrogens on oxidative metabolism in middle-aged and elderly postmenopausal women. J Clin Pharmacol. 2006 Nov;46(11):1299-307.
36 Identification of human liver cytochrome P450 isoforms involved in the in vitro metabolism of cyclobenzaprine. Drug Metab Dispos. 1996 Jul;24(7):786-91.
37 Study on mesenchymal stem cells mediated enzyme-prodrug gene CYP1A2 targeting anti-tumor effect. Zhonghua Xue Ye Xue Za Zhi. 2009 Oct;30(10):667-71.
38 Clinical pharmacokinetics and pharmacodynamics of dapagliflozin, a selective inhibitor of sodium-glucose co-transporter type 2. Clin Pharmacokinet. 2014 Jan;53(1):17-27.
39 Clinical pharmacokinetics of tyrosine kinase inhibitors. Cancer Treat Rev. 2009 Dec;35(8):692-706.
40 The effect of new lipophilic chelators on the activities of cytosolic reductases and P450 cytochromes involved in the metabolism of anthracycline antibiotics: studies in vitro. Physiol Res. 2004;53(6):683-91.
41 Summary of information on human CYP enzymes: human P450 metabolism data. Drug Metab Rev. 2002 Feb-May;34(1-2):83-448.
42 FDA Label of Deutetrabenazine. The 2020 official website of the U.S. Food and Drug Administration.
43 Predominant role of peripheral catecholamines in the stress-induced modulation of CYP1A2 inducibility by benzo(alpha)pyrene. Basic Clin Pharmacol Toxicol. 2008 Jan;102(1):35-44.
44 In vitro metabolism of zolmitriptan in rat cytochromes induced with beta-naphthoflavone and the interaction between six drugs and zolmitriptan. Chem Biol Interact. 2003 Dec 15;146(3):263-72.
45 Metabolism and metabolic inhibition of xanthotoxol in human liver microsomes. Evid Based Complement Alternat Med. 2016;2016:5416509.
46 Mechanism-based inactivation of cytochrome P450s 1A2 and 3A4 by dihydralazine in human liver microsomes. Chem Res Toxicol. 1999 Oct;12(10):1028-32.
47 Effects of polyunsaturated fatty acids on prostaglandin synthesis and cyclooxygenase-mediated DNA adduct formation by heterocyclic aromatic amines in human adenocarcinoma colon cells. Mol Carcinog. 2004 Jul;40(3):180-8.
48 Species difference in stereoselective involvement of CYP3A in the mono-N-dealkylation of disopyramide. Xenobiotica. 2001 Feb;31(2):73-83.
49 Characterization of human cytochrome P450 enzymes catalyzing domperidone N-dealkylation and hydroxylation in vitro. Br J Clin Pharmacol. 2004 Sep;58(3):277-87.
50 Modulation of CYP1A2 enzyme activity by indoleamines: inhibition by serotonin and tryptamine. Pharmacogenetics. 1998 Jun;8(3):251-8.
51 The N-demethylation of the doxepin isomers is mainly catalyzed by the polymorphic CYP2C19. Pharm Res. 2002 Jul;19(7):1034-7.
52 Principal drug-metabolizing enzyme systems in L1210 leukemia sensitive or resistant to BCNU in vivo. Leuk Res. 1994 Nov;18(11):829-35.
53 Duloxetine: clinical pharmacokinetics and drug interactions. Clin Pharmacokinet. 2011 May;50(5):281-94.
54 Perampanel (Fycompa): a review of clinical efficacy and safety in epilepsy. P T. 2016 Nov;41(11):683-698.
55 CYP2B6 genotype-dependent inhibition of CYP1A2 and induction of CYP2A6 by the antiretroviral drug efavirenz in healthy volunteers. Clin Transl Sci. 2019 Nov;12(6):657-666.
56 Eltrombopag for use in children with immune thrombocytopenia. Blood Adv. 2018 Feb 27;2(4):454-461.
57 FDA Label of Enasidenib. The 2020 official website of the U.S. Food and Drug Administration.
58 Frovatriptan: a review of drug-drug interactions. Headache. 2002 Apr;42 Suppl 2:S63-73.
59 Comparative studies of in vitro inhibition of cytochrome P450 3A4-dependent testosterone 6beta-hydroxylation by roxithromycin and its metabolites, troleandomycin, and erythromycin. Drug Metab Dispos. 1998 Nov;26(11):1053-7.
60 Cytochrome P450 1A2 (CYP1A2) activity and risk factors for breast cancer: a cross-sectional study. Breast Cancer Res. 2004;6(4):R352-65.
61 Characterization of the oxidative metabolites of 17beta-estradiol and estrone formed by 15 selectively expressed human cytochrome p450 isoforms. Endocrinology. 2003 Aug;144(8):3382-98.
62 Inhibition of the human liver microsomal and human cytochrome P450 1A2 and 3A4 metabolism of estradiol by deployment-related and other chemicals. Drug Metab Dispos. 2006 Sep;34(9):1606-14.
63 A transgenic mouse expressing human CYP1A2 in the pancreas. Biochem Pharmacol. 2000 Sep 15;60(6):857-63.
64 Effects of morin on the pharmacokinetics of etoposide in rats. Biopharm Drug Dispos. 2007 Apr;28(3):151-6.
65 Role of human liver cytochrome P4503A in the metabolism of etoricoxib, a novel cyclooxygenase-2 selective inhibitor. Drug Metab Dispos. 2001 Jun;29(6):813-20.
66 Flecainide: current status and perspectives in arrhythmia management. World J Cardiol. 2015 Feb 26;7(2):76-85.
67 Roles of cytochromes P450 1A2, 2A6, and 2C8 in 5-fluorouracil formation from tegafur, an anticancer prodrug, in human liver microsomes. Drug Metab Dispos. 2000 Dec;28(12):1457-63.
68 Clinically significant psychotropic drug-drug interactions in the primary care setting. Curr Psychiatry Rep. 2012 Aug;14(4):376-90.
69 Metabolism of the antiandrogenic drug (Flutamide) by human CYP1A2. Drug Metab Dispos. 1997 Nov;25(11):1298-303.
70 Heterogeneity in systemic availability of ondansetron and granisetron following oral administration. Drug Metab Dispos. 1999 Jan;27(1):110-2.
71 Quantitative prediction of drug interactions caused by CYP1A2 inhibitors and inducers. Clin Pharmacokinet. 2016 Aug;55(8):977-90.
72 Kinetic mechanism of the activation of human plasminogen by streptokinase. Biochemistry. 1975 Oct 7;14(20):4459-65.
73 Synthetic and natural compounds that interact with human cytochrome P450 1A2 and implications in drug development. Curr Med Chem. 2009;16(31):4066-218.
74 In vitro characterization of the metabolism of haloperidol using recombinant cytochrome p450 enzymes and human liver microsomes. Drug Metab Dispos. 2001 Dec;29(12):1638-43.
75 In vitro investigation of cytochrome P450-mediated metabolism of dietary flavonoids. Food Chem Toxicol. 2002 May;40(5):609-16.
76 Cytochrome P450 isozymes involved in propranolol metabolism in human liver microsomes. The role of CYP2D6 as ring-hydroxylase and CYP1A2 as N-desisopropylase. Drug Metab Dispos. 1994 Nov-Dec;22(6):909-15.
77 Pharmacokinetic evaluation of idebenone. Expert Opin Drug Metab Toxicol. 2010 Nov;6(11):1437-44.
78 The effect of apigenin on pharmacokinetics of imatinib and its metabolite N-desmethyl imatinib in rats. Biomed Res Int. 2013;2013:789184.
79 Reappraisal of human CYP isoforms involved in imipramine N-demethylation and 2-hydroxylation: a study using microsomes obtained from putative extensive and poor metabolizers of S-mephenytoin and eleven recombinant human CYPs. J Pharmacol Exp Ther. 1997 Jun;281(3):1199-210.
80 Characterization of cytochrome P450s mediating ipriflavone metabolism in human liver microsomes. Xenobiotica. 2007 Mar;37(3):246-59.
81 Effects of rifampin on the pharmacokinetics of a single dose of istradefylline in healthy subjects. J Clin Pharmacol. 2018 Feb;58(2):193-201.
82 Pharmacokinetics of levobupivacaine after caudal epidural administration in infants less than 3 months of age. Br J Anaesth. 2005 Oct;95(4):524-9.
83 The Drugs.com International Drug Name Database: Lofexidine
84 Inhibitory potency of quinolone antibacterial agents against cytochrome P450IA2 activity in vivo and in vitro. Antimicrob Agents Chemother. 1992 May;36(5):942-8.
85 Metabolism of loratadine and further characterization of its in vitro metabolites. Drug Metab Lett. 2009 Aug;3(3):162-70.
86 Identification of human cytochrome P450 and flavin-containing monooxygenase enzymes involved in the metabolism of lorcaserin, a novel selective human 5-hydroxytryptamine 2C agonist. Drug Metab Dispos. 2012 Apr;40(4):761-71.
87 In vitro identification of the human cytochrome p450 enzymes involved in the oxidative metabolism of loxapine. Biopharm Drug Dispos. 2011 Oct;32(7):398-407.
88 Clinical pharmacology of lumiracoxib: a selective cyclo-oxygenase-2 inhibitor. Clin Pharmacokinet. 2005;44(12):1247-66.
89 Effect of fluvoxamine on the pharmacokinetics of roflumilast and roflumilast N-oxide. Clin Pharmacokinet. 2007;46(7):613-22.
90 Malathion bioactivation in the human liver: the contribution of different cytochrome p450 isoforms. Drug Metab Dispos. 2005 Mar;33(3):295-302.
91 Cytochrome P450 enzymes contributing to demethylation of maprotiline in man. Pharmacol Toxicol. 2002 Mar;90(3):144-9.
92 Multiple P450 substrates in a single run: rapid and comprehensive in vitro interaction assay. Eur J Pharm Sci. 2005 Jan;24(1):123-32.
93 Rat hepatic CYP1A1 and CYP1A2 induction by menadione. Toxicol Lett. 2005 Feb 15;155(2):253-8.
94 Comparison of (S)-mephenytoin and proguanil oxidation in vitro: contribution of several CYP isoforms. Br J Clin Pharmacol. 1999 Aug;48(2):158-67.
95 Methadone--metabolism, pharmacokinetics and interactions. Pharmacol Res. 2004 Dec;50(6):551-9.
96 Identification of cytochrome P450 2E1 as the predominant enzyme catalyzing human liver microsomal defluorination of sevoflurane, isoflurane, and methoxyflurane. Anesthesiology. 1993 Oct;79(4):795-807.
97 Lack of interaction between amiodarone and mexiletine in cardiac arrhythmia patients. J Clin Pharmacol. 2002 Mar;42(3):342-6.
98 Metoclopramide is metabolized by CYP2D6 and is a reversible inhibitor, but not inactivator, of CYP2D6. Xenobiotica. 2014 Apr;44(4):309-319.
99 Inhibition of human liver cytochrome P-450 1A2 by the class IB antiarrhythmics mexiletine, lidocaine, and tocainide. J Pharmacol Exp Ther. 1999 May;289(2):853-8.
100 Identification of human cytochrome P450 isoforms involved in the stereoselective metabolism of mianserin enantiomers. J Pharmacol Exp Ther. 1996 Jul;278(1):21-30.
101 Impact of the CYP2D6 ultrarapid metabolizer genotype on mirtazapine pharmacokinetics and adverse events in healthy volunteers. J Clin Psychopharmacol. 2004 Dec;24(6):647-52.
102 Phase 1/2 trial of ixazomib, cyclophosphamide and dexamethasone in patients with previously untreated symptomatic multiple myeloma. Blood Cancer J. 2018 Jul 30;8(8):70.
103 A predominate role of CYP1A2 for the metabolism of nabumetone to the active metabolite, 6-methoxy-2-naphthylacetic acid, in human liver microsomes. Drug Metab Dispos. 2009 May;37(5):1017-24.
104 Involvement of multiple cytochrome P450 isoforms in naproxen O-demethylation. Eur J Clin Pharmacol. 1997;52(4):293-8.
105 Roles of CYP2A6 and CYP2B6 in nicotine C-oxidation by human liver microsomes. Arch Toxicol. 1999 Mar;73(2):65-70.
106 Inhibition of human cytochrome P450 enzymes by 1,4-dihydropyridine calcium antagonists: prediction of in vivo drug-drug interactions. Eur J Clin Pharmacol. 2000 Feb-Mar;55(11-12):843-52.
107 Identification of the human cytochrome P450 enzymes involved in the in vitro biotransformation of lynestrenol and norethindrone. J Steroid Biochem Mol Biol. 2008 May;110(1-2):56-66.
108 Hydroxylation and demethylation of the tricyclic antidepressant nortriptyline by cDNA-expressed human cytochrome P-450 isozymes. Drug Metab Dispos. 1997 Jun;25(6):740-4.
109 Interactions between the cytochrome P450 system and the second-generation antipsychotics. J Psychiatry Neurosci. 2003 Mar;28(2):99-112.
110 Effects of serotonin-3 receptor antagonists on cytochrome P450 activities in human liver microsomes. Biol Pharm Bull. 2006 Sep;29(9):1931-5.
111 The influence of metabolic gene polymorphisms on urinary 1-hydroxypyrene concentrations in Chinese coke oven workers. Sci Total Environ. 2007 Aug 1;381(1-3):38-46.
112 PharmGKB summary: very important pharmacogene information for CYP1A2. Pharmacogenet Genomics. 2012 Jan;22(1):73-7.
113 CYP1A2 genetic polymorphisms are associated with treatment response to the antidepressant paroxetine. Pharmacogenomics. 2010 Nov;11(11):1535-43.
114 Pazopanib, a new therapy for metastatic soft tissue sarcoma. Expert Opin Pharmacother. 2013 May;14(7):929-35.
115 Identification of human cytochrome P(450)s that metabolise anti-parasitic drugs and predictions of in vivo drug hepatic clearance from in vitro data. Eur J Clin Pharmacol. 2003 Sep;59(5-6):429-42.
116 Cytochrome P450 isozymes involved in lisofylline metabolism to pentoxifylline in human liver microsomes. Drug Metab Dispos. 1997 Dec;25(12):1354-8.
117 Perazine as a potent inhibitor of human CYP1A2 but not CYP3A4. Pol J Pharmacol. 2002 Jul-Aug;54(4):407-10.
118 Effect of antipsychotic drugs on human liver cytochrome P-450 (CYP) isoforms in vitro: preferential inhibition of CYP2D6. Drug Metab Dispos. 1999 Sep;27(9):1078-84.
119 Identification and characterization of human cytochrome P450 isoforms interacting with pimozide. J Pharmacol Exp Ther. 1998 May;285(2):428-37.
120 Risk of clinically relevant pharmacokinetic-based drug-drug interactions with drugs approved by the U.S. Food and Drug Administration between 2013 and 2016. Drug Metab Dispos. 2018 Jun;46(6):835-845.
121 Population pharmacokinetics of pomalidomide. J Clin Pharmacol. 2015 May;55(5):563-72.
122 In vitro and in vivo evidence for the formation of methyl radical from procarbazine: a spin-trapping study. Carcinogenesis. 1992 May;13(5):799-805.
123 Contribution of human cytochrome p-450 isoforms to the metabolism of the simplest phenothiazine neuroleptic promazine. Br J Pharmacol. 2003 Apr;138(8):1465-74.
124 Inhibitory effects of antiarrhythmic drugs on phenacetin O-deethylation catalysed by human CYP1A2. Br J Clin Pharmacol. 1998 Apr;45(4):361-8.
125 Inhibition of cytochrome P450 2E1 by propofol in human and porcine liver microsomes. Biochem Pharmacol. 2002 Oct 1;64(7):1151-6.
126 The metabolism of pyrazoloacridine (NSC 366140) by cytochromes p450 and flavin monooxygenase in human liver microsomes. Clin Cancer Res. 2004 Feb 15;10(4):1471-80.
127 The roles of cytochrome P450 3A4 and 1A2 in the 3-hydroxylation of quinine in vivo. Clin Pharmacol Ther. 1999 Nov;66(5):454-60.
128 Metabolism of ramelteon in human liver microsomes and correlation with the effect of fluvoxamine on ramelteon pharmacokinetics. Drug Metab Dispos. 2010 Aug;38(8):1381-91.
129 Ondansetron, ramosetron, or palonosetron: which is a better choice of antiemetic to prevent postoperative nausea and vomiting in patients undergoing laparoscopic cholecystectomy? Anesth Essays Res. 2011 Jul-Dec;5(2):182-6.
130 Comparative in vitro and in vivo inhibition of cytochrome P450 CYP1A2, CYP2D6, and CYP3A by H2-receptor antagonists. Clin Pharmacol Ther. 1999 Apr;65(4):369-76.
131 Rasagiline (TVP-1012): a new selective monoamine oxidase inhibitor for Parkinson's disease. Am J Geriatr Pharmacother. 2006 Dec;4(4):330-46.
132 Effects of prototypical microsomal enzyme inducers on cytochrome P450 expression in cultured human hepatocytes. Drug Metab Dispos. 2003 Apr;31(4):421-31.
133 Association between CYP1A2 activity and riluzole clearance in patients with amyotrophic lateral sclerosis. Br J Clin Pharmacol. 2005 Mar;59(3):310-3.
134 Rofecoxib is a potent inhibitor of cytochrome P450 1A2: studies with tizanidine and caffeine in healthy subjects. Br J Clin Pharmacol. 2006 Sep;62(3):345-57.
135 Effect of steady-state enoxacin on single-dose pharmacokinetics of roflumilast and roflumilast N-oxide. J Clin Pharmacol. 2011 Apr;51(4):586-93.
136 Receptor-binding and pharmacokinetic properties of dopaminergic agonists. Curr Top Med Chem. 2008;8(12):1049-67.
137 Metabolism of ropivacaine in humans is mediated by CYP1A2 and to a minor extent by CYP3A4: an interaction study with fluvoxamine and ketoconazole as in vivo inhibitors. Clin Pharmacol Ther. 1998 Nov;64(5):484-91.
138 Rucaparib: the past, present, and future of a newly approved PARP inhibitor for ovarian cancer. Onco Targets Ther. 2017 Jun 19;10:3029-3037.
139 Comparative studies on the cytochrome p450-associated metabolism and interaction potential of selegiline between human liver-derived in vitro systems. Drug Metab Dispos. 2003 Sep;31(9):1093-102.
140 The selective serotonin reuptake inhibitor sertraline: its profile and use in psychiatric disorders. CNS Drug Rev. 2001 Spring;7(1):1-24.
141 Ontogeny and sorafenib metabolism. Clin Cancer Res. 2012 Oct 15;18(20):5788-95.
142 Stiripentol. Expert Opin Investig Drugs. 2005 Jul;14(7):905-11.
143 Endoxifen and other metabolites of tamoxifen inhibit human hydroxysteroid sulfotransferase 2A1 (hSULT2A1). Drug Metab Dispos. 2014 Nov;42(11):1843-50.
144 Clinical assessment of drug-drug interactions of tasimelteon, a novel dual melatonin receptor agonist. J Clin Pharmacol. 2015 Sep;55(9):1004-11.
145 Multiple cytochrome P-450s involved in the metabolism of terbinafine suggest a limited potential for drug-drug interactions. Drug Metab Dispos. 1999 Sep;27(9):1029-38.
146 Cytochrome P450 isoform selectivity in human hepatic theobromine metabolism. Br J Clin Pharmacol. 1999 Mar;47(3):299-305.
147 Association between common CYP1A2 polymorphisms and theophylline metabolism in non-smoking healthy volunteers. Basic Clin Pharmacol Toxicol. 2013 Apr;112(4):257-63.
148 In vitro analysis of factors influencing CYP1A2 expression as potential determinants of interindividual variation. Pharmacol Res Perspect. 2017 Mar 2;5(2):e00299.
149 The effect of tocainide on theophylline metabolism. Br J Clin Pharmacol. 1993 Apr;35(4):437-40.
150 Identification of metabolic pathways involved in the biotransformation of tolperisone by human microsomal enzymes. Drug Metab Dispos. 2003 May;31(5):631-6.
151 Rate-limiting biotransformation of triamterene is mediated by CYP1A2. Int J Clin Pharmacol Ther. 2005 Jul;43(7):327-34.
152 In vitro drug-drug interaction potential of sulfoxide and/or sulfone metabolites of albendazole, triclabendazole, aldicarb, methiocarb, montelukast and ziprasidone. Drug Metab Lett. 2018;12(2):101-116.
153 Psychotropic Medications Metabolized by Cytochromes P450 (CYP) 1A2 Enzyme and Relevant Drug Interactions: Review of Articles
154 The clinical pharmacology and pharmacokinetics of ulipristal acetate for the treatment of uterine fibroids. Reprod Sci. 2015 Apr;22(4):476-83.
155 Identification of P450 enzymes involved in metabolism of verapamil in humans. Naunyn Schmiedebergs Arch Pharmacol. 1993 Sep;348(3):332-7.
156 Characterization of human cytochrome P450 isoenzymes involved in the metabolism of vinorelbine. Fundam Clin Pharmacol. 2005 Oct;19(5):545-53.
157 Carotenoids as regulators for inter-species difference in cytochrome P450 1A expression and activity in ungulates and rats. Food Chem Toxicol. 2010 Nov;48(11):3201-8.
158 Management of Unique Populations with HCV Infection
159 Metabolism of R- and S-warfarin by CYP2C19 into four hydroxywarfarins. Drug Metab Lett. 2012 Sep 1;6(3):157-64.
160 Adverse reactions to zolpidem: case reports and a review of the literature. Prim Care Companion J Clin Psychiatry. 2010;12(6). pii: PCC.09r00849.
161 Identification of cytochrome P450 enzymes involved in the metabolism of zotepine, an antipsychotic drug, in human liver microsomes. Xenobiotica. 1999 Mar;29(3):217-29.
162 Metabolic pathway of icotinib in vitro: the differential roles of CYP3A4, CYP3A5, and CYP1A2 on potential pharmacokinetic drug-drug interaction. J Pharm Sci. 2018 Apr;107(4):979-983.
163 Cytochrome P450 CYP1B1 interacts with 8-methoxypsoralen (8-MOP) and influences psoralen-ultraviolet A (PUVA) sensitivity. PLoS One. 2013 Sep 23;8(9):e75494.
164 In vitro metabolism of the analgesic bicifadine in the mouse, rat, monkey, and human. Drug Metab Dispos. 2007 Dec;35(12):2232-41.
165 Pharmacokinetics and disposition of momelotinib revealed a disproportionate human metabolite-resolution for clinical development. Drug Metab Dispos. 2018 Mar;46(3):237-247.
166 Preclinical metabolism and disposition of SB939 (Pracinostat), an orally active histone deacetylase inhibitor, and prediction of human pharmacokinetics. Drug Metab Dispos. 2011 Dec;39(12):2219-32.
167 Involvement of cytochrome P450 1A2 in the biotransformation of trans-resveratrol in human liver microsomes. Biochem Pharmacol. 2004 Aug 15;68(4):773-82.
168 Psychological effects of dopamine agonist treatment in patients with hyperprolactinemia and prolactin-secreting adenomas. Eur J Endocrinol. 2019 Jan 1;180(1):31-40.
169 A drug-drug interaction study to assess the effect of the CYP1A2 inhibitor fluvoxamine on the pharmacokinetics of dovitinib (TKI258) in patients with advanced solid tumors. Cancer Chemother Pharmacol. 2018 Jan;81(1):73-80.
170 Fexinidazole--a new oral nitroimidazole drug candidate entering clinical development for the treatment of sleeping sickness. PLoS Negl Trop Dis. 2010 Dec 21;4(12):e923.
171 Differential mechanisms for the inhibition of human cytochrome P450 1A2 by apigenin and genistein. J Biochem Mol Toxicol. 2010 Jul-Aug;24(4):230-4.
172 In vitro characterization of sarizotan metabolism: hepatic clearance, identification and characterization of metabolites, drug-metabolizing enzyme identification, and evaluation of cytochrome p450 inhibition. Drug Metab Dispos. 2010 Jun;38(6):905-16.
173 Acetaminophen activation by human liver cytochromes P450IIE1 and P450IA2. Arch Biochem Biophys. 1989 Jun;271(2):270-83.
174 Metabolism and bioactivation of famitinib, a novel inhibitor of receptor tyrosine kinase, in cancer patients. Br J Pharmacol. 2013 Apr;168(7):1687-706.
175 Metabolism and disposition of GTS-21, a novel drug for Alzheimer's disease. Xenobiotica. 1999 Jul;29(7):747-62.
176 Physiologically based modeling of lisofylline pharmacokinetics following intravenous administration in mice. Eur J Drug Metab Pharmacokinet. 2016 Aug;41(4):403-12.
177 Preclinical factors affecting the interindividual variability in the clearance of the investigational anti-cancer drug 5,6-dimethylxanthenone-4-acetic acid. Biochem Pharmacol. 2003 Jun 1;65(11):1853-65.
178 Nonclinical pharmacokinetics and in vitro metabolism of H3B-6545, a novel selective ERalpha covalent antagonist (SERCA). Cancer Chemother Pharmacol. 2019 Jan;83(1):151-160.
179 Preclinical metabolism and pharmacokinetics of SB1317 (TG02), a potent CDK/JAK2/FLT3 inhibitor. Drug Metab Lett. 2012 Mar;6(1):33-42.
180 MLN8054 and Alisertib (MLN8237): discovery of selective oral aurora A inhibitors. ACS Med Chem Lett. 2015 Apr 22;6(6):630-4.
181 Rapid determination of five probe drugs and their metabolites in human plasma and urine by liquid chromatography/tandem mass spectrometry: application to cytochrome P450 phenotyping studies. Rapid Commun Mass Spectrom. 2004;18(23):2921-33.
182 Does celecoxib inhibit agomelatine metabolism via CYP2C9 or CYP1A2? Drug Des Devel Ther. 2018 Jul 11;12:2169-2172.
183 Appetite suppressant drugs as inhibitors of human cytochromes P450: in vitro inhibition of P450-2D6 by D- and L-fenfluramine, but not phentermine. J Clin Psychopharmacol. 1998 Aug;18(4):338-41.
184 CYP2A13 metabolizes the substrates of human CYP1A2, phenacetin, and theophylline. Drug Metab Dispos. 2007 Mar;35(3):335-9.
185 Human biotransformation of bropirimine. Characterization of the major bropirimine oxidative metabolites formed in vitro. Drug Metab Dispos. 1998 Oct;26(10):1048-51.
186 Antidepressants: Past, Present and Future. Edited by Sheldon H. Preskorn Christina Y. Stanga John P. Feighner Ruth Ross. Page: 574.
187 Metabolism of mofarotene in hepatocytes and liver microsomes from different species. Comparison with in vivo data and evaluation of the cytochrome P450 isoenzymes involved in human biotransformation. Drug Metab Dispos. 1995 Oct;23(10):1051-7.
188 Erythromycin interaction with risperidone or clomipramine in an adolescent. J Child Adolesc Psychopharmacol. 1996 Summer;6(2):133-8.
189 Human liver oxidative metabolism of O6-benzylguanine. Biochem Pharmacol. 1995 Oct 26;50(9):1385-9.
190 Activation of the antitumor agent aminoflavone (NSC 686288) is mediated by induction of tumor cell cytochrome P450 1A1/1A2. Mol Pharmacol. 2002 Jul;62(1):143-53.
191 Characterization of human cytochrome P450 enzymes involved in the metabolism of cyamemazine. Eur J Pharm Sci. 2007 Dec;32(4-5):357-66.
192 The influence of the sparteine/debrisoquine genetic polymorphism on the disposition of dexfenfluramine. Br J Clin Pharmacol. 1996 Apr;41(4):311-7.
193 Major pathway of imipramine metabolism is catalyzed by cytochromes P-450 1A2 and P-450 3A4 in human liver. Mol Pharmacol. 1993 May;43(5):827-32.
194 Coleman J., Cox A. and Cowley N. (2011). Side Effects of Drugs Annual. Elsevier.
195 Diazinon, chlorpyrifos and parathion are metabolised by multiple cytochromes P450 in human liver. Toxicology. 2006 Jul 5;224(1-2):22-32.
196 Role of polymorphic human cytochrome P450 enzymes in estrone oxidation. Cancer Epidemiol Biomarkers Prev. 2006 Mar;15(3):551-8.