Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DEIBDNY)

DME Name Cytochrome P450 3A5 (CYP3A5)
Synonyms Cytochrome P450 family 3 subfamily A member 5; Cytochrome P450-PCN3; CYP3A5; CYPIIIA5
Gene Name CYP3A5
UniProt ID
CP3A5_HUMAN
INTEDE ID
DME0012
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
1577
EC Number EC: 1.14.14.1
Oxidoreductase
Oxygen paired donor oxidoreductase
Flavin/flavoprotein donor oxidoreductase
EC: 1.14.14.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MDLIPNLAVETWLLLAVSLVLLYLYGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGLWKF
DTECYKKYGKMWGTYEGQLPVLAITDPDVIRTVLVKECYSVFTNRRSLGPVGFMKSAISL
AEDEEWKRIRSLLSPTFTSGKLKEMFPIIAQYGDVLVRNLRREAEKGKPVTLKDIFGAYS
MDVITGTSFGVNIDSLNNPQDPFVESTKKFLKFGFLDPLFLSIILFPFLTPVFEALNVSL
FPKDTINFLSKSVNRMKKSRLNDKQKHRLDFLQLMIDSQNSKETESHKALSDLELAAQSI
IFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLPNKAPPTYDAVVQMEYLDMVV
NETLRLFPVAIRLERTCKKDVEINGVFIPKGSMVVIPTYALHHDPKYWTEPEEFRPERFS
KKKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLDTQG
LLQPEKPIVLKVDSRDGTLSGE
Function
This enzyme is involved in the metabolism of steroid hormones and vitamins. It catalyzes the hydroxylation of carbon-hydrogen bonds and exhibits high catalytic activity for the formation of catechol estrogens from 17beta- estradiol (E2) and estrone (E1), namely 2-hydroxy E1 and E2. It also catalyzes 6beta-hydroxylation of the steroid hormones testosterone, progesterone, and androstenedione and the oxidative conversion of all-trans- retinol to all-trans-retinal. It further metabolizes all trans-retinoic acid (atRA) to 4-hydroxyretinoate and may play a role in hepatic atRA clearance. It is also involved in the oxidative metabolism of xenobiotics, including calcium channel blocking drug nifedipine and immunosuppressive drug cyclosporine.
KEGG Pathway
Chemical carcinogenesis (hsa05204 )
Drug metabolism - cytochrome P450 (hsa00982 )
Metabolic pathways (hsa01100 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
Retinol metabolism (hsa00830 )
Steroid hormone biosynthesis (hsa00140 )
Reactome Pathway
Xenobiotics (R-HSA-211981 )
Aflatoxin activation and detoxification (R-HSA-5423646 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
178 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Acalabrutinib DM7GCVW leukaemia 2A60-2B33 Approved [1]
Acetaminophen DMUIE76 Allergic rhinitis CA08.0 Approved [2]
Aldosterone DM9S2JW Hypertension BA00-BA04 Approved [3]
Alfentanil DMVO0UB Anaesthesia 9A78.6 Approved [4]
Alprazolam DMC7XDN Anxiety Approved [5]
Amitriptyline DMK7F9S Depression 6A70-6A7Z Approved [6]
Amprenavir DMLMXE0 Human immunodeficiency virus infection 1C62 Approved [7]
Anastrozole DMNP60F Breast cancer 2C60-2C65 Approved [8]
Apixaban DM89JLN Thrombosis DB61-GB90 Approved [9]
Argatroban DMFI46A Thrombosis DB61-GB90 Approved [10]
Aripiprazole DM3NUMH Bipolar I disorder Approved [11]
Armodafinil DMGB035 Malignant glioma 2A00.0 Approved [12]
Artemether DM48QOT Malaria 1F40-1F45 Approved [13]
Atazanavir DMSYRBX Human immunodeficiency virus infection 1C62 Approved [14]
Atorvastatin DMF28YC Acute coronary syndrome BA41 Approved [15]
Axitinib DMGVH6N Renal cell carcinoma 2C90 Approved [16]
Azelastine DMXTMBJ Allergic conjunctivitis 9A60.02 Approved [17]
Aztreonam DMDNJHG Bacterial infection 1A00-1C4Z Approved [18]
Bimatoprost DMX0E5B Alopecia ED70 Approved [19]
BOCEPREVIR DMBSHMF Hepatitis C virus infection 1E51.1 Approved [20]
Buprenorphine DMPRI8G Opioid dependence 6C43.2Z Approved [21]
Buspirone DMBS632 Anxiety disorder 6B00-6B0Z Approved [22]
Cabazitaxel DMPAZHC Breast cancer 2C60-2C65 Approved [23]
Cannabidiol DM0659E Dravet syndrome 8A61.11 Approved [24]
Carbamazepine DMZOLBI Epilepsy 8A60-8A68 Approved [25]
Cenobamate DM8KLU9 Complex partial seizure 8A68.0 Approved [26]
Cerivastatin DMXCM7H Hyperlipidaemia 5C80 Approved [11]
Chloroquine DMSI5CB Malaria 1F40-1F45 Approved [27]
Chlorpheniramine DM5URA2 Allergic rhinitis CA08.0 Approved [11]
Ciclosporin DMAZJFX Graft-versus-host disease 4B24 Approved [28]
Cilostazol DMZMSCT Intermittent claudication BD40.00 Approved [29]
Cisapride DMY7PED Gastroesophageal reflux disease DA22.Z Approved [30]
Clarithromycin DM4M1SG Acute maxillary sinusitis Approved [11]
Clonidine DM6RZ9Q Attention deficit hyperactivity disorder 6A05.Z Approved [31]
Clopidogrel DMOL54H Acute coronary syndrome BA41 Approved [32]
Cobicistat DM6L4H2 Human immunodeficiency virus infection 1C62 Approved [33]
Cocaine DMSOX7I Anaesthesia 9A78.6 Approved [34]
Cortisone Acetate DMG8K57 Acne vulgaris ED80 Approved [35]
Crizotinib DM4F29C Non-small-cell lung cancer 2C25.Y Approved [36]
Daclatasvir DMSFK9V Hepatitis C virus infection 1E51.1 Approved [37]
Dapsone DM4LT8A Acne vulgaris ED80 Approved [11]
Dasatinib DMJV2EK Blast phase chronic myelogenous leukemia, BCR-ABL1 positive Approved [38]
Delavirdine DM3NF5G Human immunodeficiency virus infection 1C62 Approved [11]
Dexamethasone DMMWZET Acute adrenal insufficiency Approved [39]
Dextromethorphan DMUDJZM Allergic rhinitis CA08.0 Approved [40]
Diazepam DM08E9O Alcohol withdrawal Approved [41]
Diltiazem DMAI7ZV Angina pectoris BA40 Approved [42]
Disulfiram DMCL2OK Alcohol dependence 6C40.2 Approved [43]
Docetaxel DMDI269 Advanced cancer 2A00-2F9Z Approved [11]
Domperidone DMBDPY0 Gastrointestinal disease DE2Z Approved [11]
Doxapram DMCYANK Respiratory disease CB40 Approved [44]
Doxorubicin DMVP5YE Acute myelogenous leukaemia 2A41 Approved [45]
Dronedarone DMA8FS5 Angina pectoris BA40 Approved [46]
Dutasteride DMQ4TJK Benign prostatic hyperplasia GA90 Approved [47]
E-2007 DMJDYNQ Diabetic neuropathy 8C0Z Approved [48]
Eplerenone DMF0NQR Heart failure BD10-BD13 Approved [49]
Erlotinib DMCMBHA Adrenal gland neoplasm Approved [38]
Erythromycin DM4K7GQ Acne vulgaris ED80 Approved [50]
Estradiol DMUNTE3 Acne vulgaris ED80 Approved [11]
Estradiol Acetate DM07U2A Hormone replacement therapy 8E01 Approved [11]
Estradiol Cypionate DM27Z5T Hormone replacement therapy 8E01 Approved [11]
Estradiol Valerate DM8MC6O Hormone replacement therapy 8E01 Approved [11]
Estrone DM5T6US Acne vulgaris ED80 Approved [51]
Ethosuximide DMDZ9LT Epilepsy 8A60-8A68 Approved [52]
Etoposide DMNH3PG Acute myelogenous leukaemia 2A41 Approved [53]
Felodipine DMOSW35 Hypertension BA00-BA04 Approved [11]
Fentanyl DM8WAHT Analgesia MB40.8 Approved [54]
Fexinidazole DMOYE70 African trypanosomiasis 1F51 Approved [55]
Finasteride DMWV3TZ Baldness, male pattern Approved [11]
Fluoxetine DM3PD2C Bipolar depression Approved [56]
Flutamide DMK0O7U Prostate cancer 2C82.0 Approved [57]
Fluticasone DMGCSVF Allergic rhinitis CA08.0 Approved [58]
Fluvastatin DM4MDJY Arteriosclerosis BD40 Approved [59]
Gefitinib DM15F0X Colon adenocarcinoma Approved [60]
Glibenclamide DM8JXPZ Diabetic complication 5A2Y Approved [61]
Granisetron DMIUW25 Malignant glioma 2A00.0 Approved [62]
Halofantrine DMOMK1V Malaria 1F40-1F45 Approved [63]
Haloperidol DM96SE0 Delirium Approved [64]
Hydrocortisone DMGEMB7 Acne vulgaris ED80 Approved [3]
Hydroxyprogesterone DMIKQH5 Solid tumour/cancer 2A00-2F9Z Approved [65]
Hydroxyzine DMF8Y74 Allergic rhinitis CA08.0 Approved [66]
Ibrutinib DMHZCPO Mantle cell lymphoma 2A85.5 Approved [67]
Ifosfamide DMCT3I8 Adult central nervous system germ cell tumor Approved [68]
Iloperidone DM6AUFY Schizophrenia 6A20 Approved [69]
Imatinib DM7RJXL Acute lymphoblastic leukaemia 2A85 Approved [70]
Indinavir DM0T3YH Human immunodeficiency virus infection 1C62 Approved [71]
Irinotecan DMP6SC2 Adenocarcinoma 2D40 Approved [72]
Istradefylline DM20VSK Parkinson disease 8A00.0 Approved [73]
Ivacaftor DMZC1HS Cystic fibrosis CA25 Approved [74]
Lapatinib DM3BH1Y Breast cancer 2C60-2C65 Approved [38]
Lercanidipine DMPWSEM Hypertension BA00-BA04 Approved [11]
Levomethadyl acetate hydrochloride DM429AE N. A. N. A. Approved [11]
Lidocaine DML4ZOT Anaesthesia 9A78.6 Approved [11]
Lonafarnib DMGM2Z6 Hutchinson-Gilford progeria syndrome LD2B Approved [75]
Loratadine DMF3AN7 Allergy 4A80-4A85 Approved [76]
Lorlatinib DMICDLV Non-small-cell lung cancer 2C25.Y Approved [77]
Losartan DM72JXH Diabetic kidney disease GB61.Z Approved [40]
Lumefantrine DM29GAD Malaria 1F40-1F45 Approved []
Mephenytoin DM5UGDK Epilepsy 8A60-8A68 Approved [78]
Metronidazole DMTIVEN Abscess Approved [79]
Midazolam DMXOELT Agitation 6A70.3 Approved [80]
Mifepristone DMGZQEF Cushing disease 5A70 Approved [81]
MK-1439 DM215WE Human immunodeficiency virus infection 1C62 Approved [82]
Mycophenolate mofetil DMPQAGE Hepatosplenic T-cell lymphoma Approved [83]
Nateglinide DMLK2QH Diabetic complication 5A2Y Approved [11]
Nelfinavir mesylate DMFX6G8 N. A. N. A. Approved [84]
Nevirapine DM6HX9B Human immunodeficiency virus infection 1C62 Approved [85]
Nifedipine DMSVOZT Angina pectoris BA40 Approved [80]
Nimodipine DMQ0RKZ Cerebral vasospasm BA85.Z Approved [86]
Nisoldipine DM7ISKJ Hypertension BA00-BA04 Approved [11]
Nitrendipine DM21C09 Hypertension BA00-BA04 Approved [11]
Norethindrone acetate DMDGCQP N. A. N. A. Approved [87]
Nortriptyline DM4KDYJ Depression 6A70-6A7Z Approved [88]
Omeprazole DM471KJ Cystic fibrosis CA25 Approved [89]
Ondansetron DMOTQ1I Chemotherapy-induced nausea MD90 Approved [90]
Ornidazole DM6QHDJ Amoebiasis 1A36 Approved [91]
Oxazepam DMXNZM4 Alcohol withdrawal delirium Approved [92]
Oxybutynin hydrochloride DMF2KLU Urinary incontinence MF50.2 Approved [93]
Paliperidone DM7NPJS Psychotic disorder 6A20-6A25 Approved [94]
Pentamidine DMHZJCG African trypanosomiasis 1F51 Approved [95]
Phenelzine DMHIDUE Depression 6A70-6A7Z Approved [96]
Phenobarbital DMXZOCG Cluster headache 8A81.0 Approved [97]
Phenytoin DMNOKBV Epilepsy 8A60-8A68 Approved [98]
Pimozide DMW83TP Schizophrenia 6A20 Approved [11]
Ponatinib DMYGJQO Acute lymphoblastic leukaemia 2A85 Approved [99]
Pravastatin DM6A0X7 Adult acute monocytic leukemia Approved [100]
Praziquantel DMOU1PK Flatworm infection 1F70-1F86 Approved [101]
Prednisolone DMQ8FR2 Acute adrenal insufficiency Approved [102]
Progesterone DMUY35B Amenorrhea GA20.0 Approved [103]
Propranolol DM79NTF Angina pectoris BA40 Approved [104]
Quetiapine DM1N62C Anorexia nervosa cachexia 6B80 Approved [105]
Quinine DMSWYF5 Malaria 1F40-1F45 Approved [11]
Risperidone DMN6DXL Bipolar I disorder Approved [94]
Ritonavir DMU764S Human immunodeficiency virus infection 1C62 Approved [11]
Rivaroxaban DMQMBZ1 Deep vein thrombosis BD71 Approved [106]
Romidepsin DMT5GNL Cutaneous T-cell lymphoma 2B01 Approved [107]
Salmeterol DMIEU69 Allergic asthma CA23.0 Approved [11]
Saquinavir DMG814N Human immunodeficiency virus infection 1C62 Approved [84]
Saxagliptin DMGXENV Type-2 diabetes 5A11 Approved [108]
Sildenafil citrate DMSWJ5X N. A. N. A. Approved [109]
Simvastatin DM30SGU Arteriosclerosis BD40 Approved [110]
Sirolimus DMGW1ID Advanced cancer 2A00-2F9Z Approved [11]
Sorafenib DMS8IFC Adenocarcinoma 2D40 Approved [11]
Sulfasalazine DMICA9H Irritable bowel syndrome DD91.0 Approved [111]
Sunitinib DMCBJSR Acute undifferentiated leukemia Approved [11]
Tacrolimus DMZ7XNQ Graft-versus-host disease 4B24 Approved [112]
Tadalafil DMJZHT1 Benign prostatic hyperplasia GA90 Approved [113]
Tamoxifen DMLB0EZ Breast cancer 2C60-2C65 Approved [114]
Tegafur DM31ZQM Solid tumour/cancer 2A00-2F9Z Approved [115]
Telithromycin DMZ4P3A Bacterial infection 1A00-1C4Z Approved [116]
Temsirolimus DMS104F Renal cell carcinoma 2C90 Approved [11]
Tenapanor DMCOZJY Irritable bowel syndrome DD91.0 Approved [117]
Teniposide DMLW57T Acute lymphoblastic leukaemia 2A85 Approved [118]
Testosterone cypionate DMC1TEV N. A. N. A. Approved [80]
Testosterone enanthate DMB6871 N. A. N. A. Approved [80]
Testosterone undecanoate DMZO10Y Hypogonadism 5A61.0 Approved [80]
Thalidomide DM70BU5 Adult T-cell leukemia/lymphoma Approved [119]
Trazodone DMK1GBJ Depression 6A70-6A7Z Approved [11]
Tretinoin DM49DUI Acne vulgaris ED80 Approved [120]
Triamcinolone diacetate DM7LRKD N. A. N. A. Approved [121]
Triazolam DMETYK5 Insomnia 7A00-7A0Z Approved [80]
Udenafil DM1IQRP Erectile dysfunction HA01.1 Approved [122]
Valproate DMCFE9I Epilepsy 8A60-8A68 Approved [85]
Vardenafil DMTBGW8 Cystic fibrosis CA25 Approved [109]
Verapamil DMA7PEW Angina pectoris BA40 Approved [123]
Vinblastine DM5TVS3 Advanced cancer 2A00-2F9Z Approved [45]
Vincristine DMINOX3 Acute lymphoblastic leukaemia 2A85 Approved [124]
Vindesine DMVR628 Acute lymphoblastic leukaemia 2A85 Approved [125]
Vortioxetine DM6F1PU Major depressive disorder 6A70.3 Approved [126]
Zalcitabine DMH7MUV Human immunodeficiency virus infection 1C62 Approved [127]
Zaleplon DMGFWSM Insomnia 7A00-7A0Z Approved [11]
Zolpidem DMWOSKJ Insomnia 7A00-7A0Z Approved [128]
Zonisamide DM0DTF7 Alcohol dependence 6C40.2 Approved [129]
ZOTEPINE DMF3VXA Anxiety disorder 6B00-6B0Z Approved [130]
Icotinib hydrochloride DM5GFIK Non-small-cell lung cancer 2C25.Y Registered [131]
Benidipine DMWNP6B N. A. N. A. Phase 4 [132]
Chlorphenamine DM6C4YJ Allergic rhinitis CA08.0 Phase 4 [11]
RUPATADINE DMBPN7T N. A. N. A. Phase 4 [133]
⏷ Show the Full List of 178 Approved Drug(s)
21 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
AL3818 DM3WP0N Alveolar soft part sarcoma 2A60-2C35 Phase 3 [134]
Azimilide DMUIBV8 Atrial fibrillation BC81.3 Phase 3 [135]
Cethromycin DMIGX84 Bacterial infection 1A00-1C4Z Phase 3 [136]
GLYCYRRHIZIN DM8M2N3 Influenza virus infection 1E30-1E32 Phase 3 [137]
Linopirdine DM0ZOGX Cognitive impairment 6D71 Phase 3 [138]
Nabiximols DMHKJ5I Cancer related pain MG30 Phase 3 [24]
Semagacestat DML83IW Parkinson disease 8A00.0 Phase 3 [139]
TAK-875 DMIM5AP Type-2 diabetes 5A11 Phase 3 [140]
Vicriviroc DMMTW9K Human immunodeficiency virus infection 1C62 Phase 3 [85]
VX-661 DMJBXO3 Cystic fibrosis CA25 Phase 3 [141]
AZD2014 DMOEARH Solid tumour/cancer 2A00-2F9Z Phase 2 [142]
BMS 650032 DMQI43G Hepatitis C virus infection 1E51.1 Phase 2 [143]
Dexloxiglumide DM52HUD Pancreatic malfunction DC30-DC3Z Phase 2 [144]
EMIVIRINE DMQH1NV Human immunodeficiency virus infection 1C62 Phase 2 [145]
Famitinib DMSFWT7 Solid tumour/cancer 2A00-2F9Z Phase 2 [146]
Trastuzumab emtansine DMU1LXS HER2-positive breast cancer 2C60-2C65 Phase 2 [147]
Dapivirine DMJPSIL Human immunodeficiency virus infection 1C62 Phase 1/2 [148]
H3B-6545 DMIFCY2 Breast cancer 2C60-2C65 Phase 1/2 [149]
H3B-6527 DMAYTRK Hepatocellular carcinoma 2C12.02 Phase 1 [150]
ITX-5061 DM702MU Human immunodeficiency virus-1 infection 1C62 Phase 1 [151]
Tetrandrine DMAOJBX Sarcoma 2A60-2C35 Phase 1 [152]
⏷ Show the Full List of 21 Clinical Trial Drug(s)
5 Discontinued Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Astemizole DM2HN6Q Allergic rhinitis CA08.0 Withdrawn from market [11]
Terfenadine DM4KLPT Allergy 4A80-4A85 Withdrawn from market [11]
Octopamine DMLQVTJ Thrombosis DB61-GB90 Discontinued in Phase 2a [54]
Ezlopitant DMTUPZ2 Irritable bowel syndrome DD91.0 Discontinued in Phase 2 [153]
FCP-3P1 DMTQLIJ Arteriosclerosis BD40 Discontinued in Phase 2 [154]
1 Preclinical Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Oxycodone hydrochloride DMCA7LN Chronic pain MG30 Application submitted [155]
3 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Erythromycin salnacedin DM0PHEW Discovery agent N.A. Investigative [50]
Mepacrine DMU8L7C Discovery agent N.A. Investigative [156]
PARAOXON DMN4ZKC Discovery agent N.A. Investigative [157]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.69E-01 2.37E-02 2.14E-01
Alopecia ED70 Skin from scalp 3.45E-01 -7.02E-02 -1.65E-01
Alzheimer's disease 8A20 Entorhinal cortex 9.96E-01 -3.17E-03 -1.84E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 1.81E-01 -4.28E-02 -4.55E-01
Aortic stenosis BB70 Calcified aortic valve 6.25E-01 -1.30E-01 -2.70E-01
Apnea 7A40 Hyperplastic tonsil 6.74E-01 1.02E+00 9.58E-01
Arthropathy FA00-FA5Z Peripheral blood 1.39E-01 1.04E-01 7.07E-01
Asthma CA23 Nasal and bronchial airway 3.85E-05 8.08E-01 6.07E-01
Atopic dermatitis EA80 Skin 4.44E-01 1.24E-01 2.44E-01
Autism 6A02 Whole blood 2.44E-01 -1.07E-02 -5.56E-02
Autoimmune uveitis 9A96 Peripheral monocyte 7.19E-01 3.01E-03 2.72E-02
Autosomal dominant monocytopenia 4B04 Whole blood 9.61E-01 3.84E-02 4.15E-01
Bacterial infection of gingival 1C1H Gingival tissue 1.41E-16 -1.05E+00 -1.39E+00
Batten disease 5C56.1 Whole blood 8.42E-01 -1.73E-02 -1.48E-01
Behcet's disease 4A62 Peripheral blood 7.83E-01 -1.88E-02 -1.53E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 2.21E-01 -3.94E-02 -4.05E-01
Bladder cancer 2C94 Bladder tissue 4.33E-04 -2.03E+00 -2.85E+00
Breast cancer 2C60-2C6Z Breast tissue 2.56E-19 -3.06E-01 -6.18E-01
Cardioembolic stroke 8B11.20 Whole blood 5.22E-01 -6.64E-02 -2.91E-01
Cervical cancer 2C77 Cervical tissue 4.22E-09 -1.13E+00 -1.72E+00
Childhood onset rheumatic disease FA20.Z Peripheral blood 2.36E-01 -1.71E-03 -1.84E-02
Chronic hepatitis C 1E51.1 Whole blood 9.32E-01 5.45E-02 3.88E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 6.74E-01 5.99E-02 7.30E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 3.51E-01 1.59E-01 2.09E-01
Chronic rhinosinusitis CA0A Sinus mucosa tissue 5.82E-01 9.87E-02 2.50E-01
Colon cancer 2B90 Colon tissue 2.36E-06 -3.51E-01 -4.31E-01
Coronary artery disease BA80-BA8Z Peripheral blood 2.19E-01 -1.51E-01 -8.04E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 5.42E-01 -8.12E-02 -8.53E-01
Endometriosis GA10 Endometrium tissue 3.74E-03 -6.47E-02 -1.18E-01
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.84E-01 -8.92E-03 -8.92E-02
Familial hypercholesterolemia 5C80.00 Whole blood 3.65E-02 -8.90E-02 -5.58E-01
Gastric cancer 2B72 Gastric tissue 5.90E-01 -1.84E+00 -6.76E-01
Glioblastopma 2A00.00 Nervous tissue 2.80E-10 1.27E-04 4.77E-04
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 7.76E-01 -2.05E-01 -5.72E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 9.78E-01 -1.22E-03 -4.10E-03
Head and neck cancer 2D42 Head and neck tissue 2.45E-13 -2.29E+00 -1.44E+00
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.05E-01 -7.09E-02 -5.40E-01
Huntington's disease 8A01.10 Whole blood 6.47E-01 -7.91E-03 -1.41E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 5.47E-02 -1.30E+00 -1.39E+00
Immunodeficiency 4A00-4A20 Peripheral blood 1.27E-02 -1.53E-01 -1.32E+00
Influenza 1E30 Whole blood 3.55E-02 -8.41E-01 -2.76E+00
Interstitial cystitis GC00.3 Bladder tissue 8.33E-04 -2.94E+00 -5.55E+00
Intracranial aneurysm 8B01.0 Intracranial artery 3.13E-01 -1.95E-01 -5.00E-01
Irritable bowel syndrome DD91.0 Rectal colon tissue 8.83E-03 1.59E-01 4.32E-01
Ischemic stroke 8B11 Peripheral blood 2.55E-02 8.53E-02 9.03E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 2.02E-01 -1.29E-02 -4.99E-02
Lateral sclerosis 8B60.4 Skin 5.16E-01 4.53E-02 3.54E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 2.06E-01 -1.87E-01 -6.20E-01
Liver cancer 2C12.0 Liver tissue 4.87E-05 -5.90E-01 -7.24E-01
Liver failure DB99.7-DB99.8 Liver tissue 1.21E-02 -2.25E+00 -2.30E+00
Lung cancer 2C25 Lung tissue 3.12E-38 -1.81E+00 -2.01E+00
Lupus erythematosus 4A40 Whole blood 7.48E-04 -7.04E-02 -3.44E-01
Major depressive disorder 6A70-6A7Z Hippocampus 5.09E-02 -5.62E-02 -5.19E-01
Major depressive disorder 6A70-6A7Z Whole blood 7.63E-01 -1.01E-01 -2.77E-01
Melanoma 2C30 Skin 1.21E-03 -1.79E+00 -1.23E+00
Multiple myeloma 2A83.1 Peripheral blood 2.26E-02 7.10E-02 1.00E+00
Multiple myeloma 2A83.1 Bone marrow 7.23E-01 -2.28E-02 -3.11E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 5.82E-01 -6.00E-02 -2.69E-01
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.43E-01 -3.46E-02 -2.62E-01
Myelofibrosis 2A20.2 Whole blood 8.26E-04 2.01E-01 1.65E+00
Myocardial infarction BA41-BA50 Peripheral blood 4.64E-01 -1.08E-01 -1.96E-01
Myopathy 8C70.6 Muscle tissue 7.71E-01 -3.83E-02 -2.64E-01
Neonatal sepsis KA60 Whole blood 2.71E-01 -2.86E-02 -1.76E-01
Neuroectodermal tumour 2A00.11 Brain stem tissue 5.16E-06 -7.41E-01 -4.22E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 2.92E-01 2.42E-01 5.16E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 1.96E-01 -4.28E-01 -7.54E-01
Olive pollen allergy CA08.00 Peripheral blood 5.04E-01 -2.01E-01 -2.41E-01
Oral cancer 2B6E Oral tissue 4.58E-05 -1.72E+00 -1.46E+00
Osteoarthritis FA00-FA0Z Synovial tissue 5.31E-01 7.01E-02 1.11E-01
Osteoporosis FB83.1 Bone marrow 1.49E-01 1.04E-01 1.68E+00
Ovarian cancer 2C73 Ovarian tissue 6.08E-01 2.08E-01 1.69E-01
Pancreatic cancer 2C10 Pancreas 3.16E-03 1.91E+00 1.07E+00
Parkinson's disease 8A00.0 Substantia nigra tissue 9.57E-01 9.43E-03 1.29E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 6.84E-02 -6.78E-02 -6.30E-01
Pituitary cancer 2D12 Pituitary tissue 3.97E-02 -6.76E-01 -1.24E+00
Pituitary gonadotrope tumour 2D12 Pituitary tissue 1.17E-03 -7.11E-01 -1.33E+00
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 4.16E-01 -4.95E-02 -6.25E-01
Polycythemia vera 2A20.4 Whole blood 1.11E-09 1.32E-01 1.50E+00
Pompe disease 5C51.3 Biceps muscle 5.17E-03 -2.19E-01 -7.01E-01
Preterm birth KA21.4Z Myometrium 6.54E-01 -1.92E-01 -5.38E-01
Prostate cancer 2C82 Prostate 5.69E-06 -1.53E+00 -1.39E+00
Psoriasis EA90 Skin 5.05E-02 4.52E-01 5.39E-01
Rectal cancer 2B92 Rectal colon tissue 3.78E-02 4.07E-01 1.09E+00
Renal cancer 2C90-2C91 Kidney 3.51E-02 1.53E+00 1.16E+00
Retinoblastoma 2D02.2 Uvea 7.40E-02 -2.10E-02 -1.31E-01
Rheumatoid arthritis FA20 Synovial tissue 1.34E-01 -2.79E-01 -7.05E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 4.31E-01 -5.34E-02 -1.02E-01
Schizophrenia 6A20 Prefrontal cortex 1.17E-01 -3.87E-02 -2.23E-01
Schizophrenia 6A20 Superior temporal cortex 9.74E-01 7.48E-03 1.37E-01
Scleroderma 4A42.Z Whole blood 2.82E-03 1.20E-01 1.40E+00
Seizure 8A60-8A6Z Whole blood 1.67E-03 -1.70E-01 -1.36E+00
Sensitive skin EK0Z Skin 1.50E-01 -1.84E-01 -5.95E-01
Sepsis with septic shock 1G41 Whole blood 2.43E-02 2.35E-02 1.49E-01
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.55E-02 2.64E-01 1.47E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 5.63E-01 3.13E-02 2.23E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 5.57E-01 5.26E-02 5.21E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 7.08E-03 2.15E-01 6.16E+00
Skin cancer 2C30-2C3Z Skin 1.44E-89 -2.17E+00 -2.38E+00
Thrombocythemia 3B63 Whole blood 1.38E-02 1.07E-01 8.83E-01
Thrombocytopenia 3B64 Whole blood 6.38E-01 1.87E-01 4.94E-01
Thyroid cancer 2D10 Thyroid 9.83E-01 3.44E-02 7.14E-02
Tibial muscular dystrophy 8C75 Muscle tissue 1.88E-01 -2.98E-02 -1.92E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 2.85E-02 1.19E-01 3.43E+00
Type 2 diabetes 5A11 Liver tissue 8.58E-01 -3.73E-03 -1.00E-02
Ureter cancer 2C92 Urothelium 4.98E-01 7.83E-02 1.63E-01
Uterine cancer 2C78 Endometrium tissue 5.32E-01 2.09E-01 1.24E-01
Vitiligo ED63.0 Skin 7.99E-01 -2.86E-01 -6.73E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Cytochrome P450 3A5 DTT Info

References

1 FDA label of Acalabrutinib. The 2020 official website of the U.S. Food and Drug Administration.
2 Induction of hepatic CYP2E1 by a subtoxic dose of acetaminophen in rats: increase in dichloromethane metabolism and carboxyhemoglobin elevation. Drug Metab Dispos. 2007 Oct;35(10):1754-8.
3 CYP3A5 genotype is associated with elevated blood pressure. Pharmacogenet Genomics. 2005 Oct;15(10):737-41.
4 Influence of CYP3A5 genotype on the pharmacokinetics and pharmacodynamics of the cytochrome P4503A probes alfentanil and midazolam. Clin Pharmacol Ther. 2007 Oct;82(4):410-26.
5 Identification and phenotype characterization of two CYP3A haplotypes causing different enzymatic capacity in fetal livers. Clin Pharmacol Ther. 2005 Apr;77(4):259-70.
6 Effects of cytochrome b(5) on drug oxidation activities of human cytochrome P450 (CYP) 3As: similarity of CYP3A5 with CYP3A4 but not CYP3A7. Biochem Pharmacol. 2003 Dec 15;66(12):2333-40.
7 Oxidative metabolism of amprenavir in the human liver. Effect of the CYP3A maturation. Drug Metab Dispos. 2003 Mar;31(3):275-81.
8 In vitro and in vivo oxidative metabolism and glucuronidation of anastrozole. Br J Clin Pharmacol. 2010 Dec;70(6):854-69.
9 Apixaban. After hip or knee replacement: LMWH remains the standard treatment. Prescrire Int. 2012 Sep;21(130):201-2, 204.
10 Assessment of the potential pharmacokinetic and pharmacodynamic interactions between erythromycin and argatroban. J Clin Pharmacol. 1999 May;39(5):513-9.
11 Drug Interactions Flockhart Table
12 Clinical pharmacokinetic profile of modafinil. Clin Pharmacokinet. 2003;42(2):123-37.
13 Effect of pharmacogenetics on plasma lumefantrine pharmacokinetics and malaria treatment outcome in pregnant women. Malar J. 2017 Jul 3;16(1):267.
14 Atazanavir: effects on P-glycoprotein transport and CYP3A metabolism in vitro. Drug Metab Dispos. 2005 Jun;33(6):764-70.
15 Effects of acid and lactone forms of eight HMG-CoA reductase inhibitors on CYP-mediated metabolism and MDR1-mediated transport. Pharm Res. 2006 Mar;23(3):506-12.
16 Clinical pharmacology of axitinib. Clin Pharmacokinet. 2013 Sep;52(9):713-25.
17 Azelastine N-demethylation by cytochrome P-450 (CYP)3A4, CYP2D6, and CYP1A2 in human liver microsomes: evaluation of approach to predict the contribution of multiple CYPs. Drug Metab Dispos. 1999 Dec;27(12):1381-91.
18 Aztreonam decreases hepatic microsomal cytochrome P450 in cynomolgus monkeys. Pharmacology. 1994 Mar;48(3):137-42.
19 Product monograph: LUMIGAN RC (Bimatoprost).
20 Direct-acting antiviral agents for hepatitis C virus infection. Annu Rev Pharmacol Toxicol. 2013;53:427-49.
21 Buprenorphine pharmacology review: update on transmucosal and long-acting formulations. J Addict Med. 2019 Mar/Apr;13(2):93-103.
22 Cytochrome P450 3A-mediated metabolism of buspirone in human liver microsomes. Drug Metab Dispos. 2005 Apr;33(4):500-7.
23 DAILYMED.nlm.nih.gov: JEVTANA- cabazitaxel kit.
24 Exogenous cannabinoids as substrates, inhibitors, and inducers of human drug metabolizing enzymes: a systematic review. Drug Metab Rev. 2014 Feb;46(1):86-95.
25 Induction of CYP3As in HepG2 cells by several drugs. Association between induction of CYP3A4 and expression of glucocorticoid receptor. Biol Pharm Bull. 2003 Apr;26(4):510-7.
26 FDA label of Cenobamate. The 2020 official website of the U.S. Food and Drug Administration.
27 Cytochrome P450 2C8 and CYP3A4/5 are involved in chloroquine metabolism in human liver microsomes. Arch Pharm Res. 2003 Aug;26(8):631-7.
28 CYP3A4*18B and CYP3A5*3 polymorphisms contribute to pharmacokinetic variability of cyclosporine among healthy Chinese subjects. Eur J Pharm Sci. 2015 Aug 30;76:238-44.
29 Effects of CYP3A inhibition on the metabolism of cilostazol. Clin Pharmacokinet. 1999;37 Suppl 2:61-8.
30 Interaction of cisapride with the human cytochrome P450 system: metabolism and inhibition studies. Drug Metab Dispos. 2000 Jul;28(7):789-800.
31 CYP2D6 mediates 4-hydroxylation of clonidine in vitro: implication for pregnancy-induced changes in clonidine clearance. Drug Metab Dispos. 2010 Sep;38(9):1393-6.
32 Cytochrome P450 3A inhibition by ketoconazole affects prasugrel and clopidogrel pharmacokinetics and pharmacodynamics differently. Clin Pharmacol Ther. 2007 May;81(5):735-41.
33 Pharmacokinetics and pharmacodynamics of GS-9350: a novel pharmacokinetic enhancer without anti-HIV activity. Clin Pharmacol Ther. 2010 Mar;87(3):322-9.
34 Regenerative changes in hepatic morphology and enhanced expression of CYP2B10 and CYP3A during daily administration of cocaine. Hepatology. 1996 Mar;23(3):515-23.
35 Comparative pharmacokinetics and metabolism studies in lean and diet- induced obese mice: an animal efficacy model for 11beta-hydroxysteroid dehydrogenase type 1 (11beta-HSD1) inhibitors. Drug Metab Lett. 2011 Jan;5(1):55-63.
36 Crizotinib for the treatment of non-small-cell lung cancer. Am J Health Syst Pharm. 2013 Jun 1;70(11):943-7.
37 Daclatasvir: a NS5A replication complex inhibitor for hepatitis C infection. Ann Pharmacother. 2016 Jan;50(1):39-46.
38 Clinical pharmacokinetics of tyrosine kinase inhibitors. Cancer Treat Rev. 2009 Dec;35(8):692-706.
39 Regulation of CYP3A5 by glucocorticoids and cigarette smoke in human lung-derived cells. J Pharmacol Exp Ther. 2003 Feb;304(2):745-52.
40 Summary of information on human CYP enzymes: human P450 metabolism data. Drug Metab Rev. 2002 Feb-May;34(1-2):83-448.
41 Eight inhibitory monoclonal antibodies define the role of individual P-450s in human liver microsomal diazepam, 7-ethoxycoumarin, and imipramine metabolism. Drug Metab Dispos. 1999 Jan;27(1):102-9.
42 Significant impacts of CYP3A4*1G and CYP3A5*3 genetic polymorphisms on the pharmacokinetics of diltiazem and its main metabolites in Chinese adult kidney transplant patients. J Clin Pharm Ther. 2016 Jun;41(3):341-7.
43 Identification of the human P-450 enzymes responsible for the sulfoxidation and thiono-oxidation of diethyldithiocarbamate methyl ester: role of P-450 enzymes in disulfiram bioactivation. Alcohol Clin Exp Res. 1998 Sep;22(6):1212-9.
44 Population pharmacokinetics of doxapram in low-birth-weight Japanese infants with apnea. Eur J Pediatr. 2015 Apr;174(4):509-18.
45 Drug related genetic polymorphisms affecting adverse reactions to methotrexate, vinblastine, doxorubicin and cisplatin in patients with urothelial cancer. J Urol. 2008 Dec;180(6):2389-95.
46 Inactivation of human cytochrome P450 3A4 and 3A5 by dronedarone and N-desbutyl dronedarone. Mol Pharmacol. 2016 Jan;89(1):1-13.
47 Product monograph: Avodart (dutasteride capsules).
48 FDA label of Perampanel. The 2020 official website of the U.S. Food and Drug Administration.
49 The relative role of CYP3A4 and CYP3A5 in eplerenone metabolism. Toxicol Lett. 2019 Oct 15;315:9-13.
50 Differential regulation of CYP3A4 and CYP3A5 and its implication in drug discovery. Curr Drug Metab. 2017;18(12):1095-1105.
51 16Alpha-hydroxylation of estrone by human cytochrome P4503A4/5. Carcinogenesis. 1998 May;19(5):867-72.
52 Characterization of the cytochrome P450 enzymes involved in the in vitro metabolism of ethosuximide by human hepatic microsomal enzymes. Xenobiotica. 2003 Mar;33(3):265-76.
53 Kinetics and regulation of cytochrome P450-mediated etoposide metabolism. Drug Metab Dispos. 2004 Sep;32(9):993-1000.
54 Pharmacogenomics as molecular autopsy for forensic toxicology: genotyping cytochrome P450 3A4*1B and 3A5*3 for 25 fentanyl cases. J Anal Toxicol. 2005 Oct;29(7):590-8.
55 Fexinidazole--a new oral nitroimidazole drug candidate entering clinical development for the treatment of sleeping sickness. PLoS Negl Trop Dis. 2010 Dec 21;4(12):e923.
56 (R)-, (S)-, and racemic fluoxetine N-demethylation by human cytochrome P450 enzymes. Drug Metab Dispos. 2000 Oct;28(10):1187-91.
57 Identification of a novel glutathione conjugate of flutamide in incubations with human liver microsomes. Drug Metab Dispos. 2007 Jul;35(7):1081-8.
58 Regulation of drug-metabolizing cytochrome P450 enzymes by glucocorticoids. Drug Metab Rev. 2010 Nov;42(4):621-35.
59 Lipid-lowering response to statins is affected by CYP3A5 polymorphism. Pharmacogenetics. 2004 Aug;14(8):523-5.
60 Differential metabolism of gefitinib and erlotinib by human cytochrome P450 enzymes. Clin Cancer Res. 2007 Jun 15;13(12):3731-7.
61 Identification of CYP3A7 for glyburide metabolism in human fetal livers. Biochem Pharmacol. 2014 Dec 15;92(4):690-700.
62 Characterisation of the cytochrome P450 enzymes involved in the in vitro metabolism of granisetron. Br J Clin Pharmacol. 1994 Dec;38(6):557-66.
63 Halofantrine metabolism in microsomes in man: major role of CYP 3A4 and CYP 3A5. J Pharm Pharmacol. 1999 Apr;51(4):419-26.
64 Assessment of the contributions of CYP3A4 and CYP3A5 in the metabolism of the antipsychotic agent haloperidol to its potentially neurotoxic pyridinium metabolite and effect of antidepressants on the bioactivation pathway. Drug Metab Dispos. 2003 Mar;31(3):243-9.
65 Prevention of preterm delivery with 17-hydroxyprogesterone caproate: pharmacologic considerations. Semin Perinatol. 2014 Dec;38(8):516-22.
66 Product characteristics of HYDROXYZINE (Hydroxyzine Hydrochloride Capsules).
67 Absorption, metabolism, and excretion of oral 14C radiolabeled ibrutinib: an open-label, phase I, single-dose study in healthy men. Drug Metab Dispos. 2015 Feb;43(2):289-97.
68 Enhanced cyclophosphamide and ifosfamide activation in primary human hepatocyte cultures: response to cytochrome P-450 inducers and autoinduction by oxazaphosphorines. Cancer Res. 1997 May 15;57(10):1946-54.
69 Application of liquid chromatography/mass spectrometry in accelerating the identification of human liver cytochrome P450 isoforms involved in the metabolism of iloperidone. J Pharmacol Exp Ther. 1998 Sep;286(3):1285-93.
70 Clinical pharmacokinetics of imatinib. Clin Pharmacokinet. 2005;44(9):879-94.
71 Enzymes in addition to CYP3A4 and 3A5 mediate N-demethylation of dextromethorphan in human liver microsomes. Biopharm Drug Dispos. 1999 Oct;20(7):341-6.
72 Pharmacogenetics of irinotecan metabolism and transport: an update. Toxicol In Vitro. 2006 Mar;20(2):163-75.
73 Effects of rifampin on the pharmacokinetics of a single dose of istradefylline in healthy subjects. J Clin Pharmacol. 2018 Feb;58(2):193-201.
74 Sensitivity of ivacaftor to drug-drug interactions with rifampin, a cytochrome P450 3A4 inducer. Pediatr Pulmonol. 2018 May;53(5):E6-E8.
75 Identification of human liver cytochrome P450 enzymes responsible for the metabolism of lonafarnib (Sarasar). Drug Metab Dispos. 2006 Apr;34(4):628-35.
76 Metabolism of loratadine and further characterization of its in vitro metabolites. Drug Metab Lett. 2009 Aug;3(3):162-70.
77 FDA label of Lorlatinib. The 2020 official website of the U.S. Food and Drug Administration.
78 Species differences in stereoselective metabolism of mephenytoin by cytochrome P450 (CYP2C and CYP3A). J Pharmacol Exp Ther. 1993 Jan;264(1):89-94.
79 The role of human cytochrome P450 enzymes in the formation of 2-hydroxymetronidazole: CYP2A6 is the high affinity (low Km) catalyst. Drug Metab Dispos. 2013 Sep;41(9):1686-94.
80 In vitro metabolism of midazolam, triazolam, nifedipine, and testosterone by human liver microsomes and recombinant cytochromes p450: role of cyp3a4 and cyp3a5. Drug Metab Dispos. 2003 Jul;31(7):938-44.
81 Comparative analysis of substrate and inhibitor interactions with CYP3A4 and CYP3A5. Xenobiotica. 2006 Apr;36(4):287-99.
82 Characterisation of the absorption, distribution, metabolism, excretion and mass balance of doravirine, a non-nucleoside reverse transcriptase inhibitor in humans. Xenobiotica. 2019 Apr;49(4):422-432.
83 PharmGKB summary: mycophenolic acid pathway. Pharmacogenet Genomics. 2014 Jan;24(1):73-9.
84 Differential inhibition of cytochrome P450 3A4, 3A5 and 3A7 by five human immunodeficiency virus (HIV) protease inhibitors in vitro. Basic Clin Pharmacol Toxicol. 2006 Jan;98(1):79-85.
85 Substrates, inducers, inhibitors and structure-activity relationships of human Cytochrome P450 2C9 and implications in drug development. Curr Med Chem. 2009;16(27):3480-675.
86 Enzyme kinetics and inhibition of nimodipine metabolism in human liver microsomes. Acta Pharmacol Sin. 2000 Aug;21(8):690-4.
87 The interaction between St John's wort and an oral contraceptive. Clin Pharmacol Ther. 2003 Dec;74(6):525-35.
88 Bioactivation of the tricyclic antidepressant amitriptyline and its metabolite nortriptyline to arene oxide intermediates in human liver microsomes and recombinant P450s. Chem Biol Interact. 2008 May 9;173(1):59-67.
89 Impact of intestinal CYP2C19 genotypes on the interaction between tacrolimus and omeprazole, but not lansoprazole, in adult living-donor liver transplant patients. Drug Metab Dispos. 2009 Apr;37(4):821-6.
90 Multiple forms of cytochrome P450 are involved in the metabolism of ondansetron in humans. Drug Metab Dispos. 1995 Nov;23(11):1225-30.
91 Effect of ketoconazole on the pharmacokinetics of ornidazole--a possible role of p-glycoprotein and CYP3A. Drug Metabol Drug Interact. 2006;22(1):67-77.
92 Cytochrome P450 enzyme activity and protein expression in primary porcine enterocyte and hepatocyte cultures. Xenobiotica. 2000 Jan;30(1):27-46.
93 Stereoselective pharmacokinetics of oxybutynin and N-desethyloxybutynin in vitro and in vivo. Xenobiotica. 2007 Jan;37(1):59-73.
94 Different enantioselective 9-hydroxylation of risperidone by the two human CYP2D6 and CYP3A4 enzymes. Drug Metab Dispos. 2001 Oct;29(10):1263-8.
95 Identification of human cytochrome P(450)s that metabolise anti-parasitic drugs and predictions of in vivo drug hepatic clearance from in vitro data. Eur J Clin Pharmacol. 2003 Sep;59(5-6):429-42.
96 An evaluation of potential mechanism-based inactivation of human drug metabolizing cytochromes P450 by monoamine oxidase inhibitors, including isoniazid. Br J Clin Pharmacol. 2006 May;61(5):570-84.
97 Induction and regulation of xenobiotic-metabolizing cytochrome P450s in the human A549 lung adenocarcinoma cell line. Am J Respir Cell Mol Biol. 2000 Mar;22(3):360-6.
98 PharmGKB summary: phenytoin pathway. Pharmacogenet Genomics. 2012 Jun;22(6):466-70.
99 Potential of ponatinib to treat chronic myeloid leukemia and acute lymphoblastic leukemia. Onco Targets Ther. 2013 Aug 20;6:1111-8.
100 Comparison of cytochrome P-450-dependent metabolism and drug interactions of the 3-hydroxy-3-methylglutaryl-CoA reductase inhibitors lovastatin and pravastatin in the liver. Drug Metab Dispos. 1999 Feb;27(2):173-9.
101 Rifampin markedly decreases plasma concentrations of praziquantel in healthy volunteers. Clin Pharmacol Ther. 2002 Nov;72(5):505-13.
102 Pharmacokinetic and pharmacoimmunodynamic interactions between prednisolone and sirolimus in adrenalectomized rats. J Pharmacokinet Biopharm. 1999 Feb;27(1):1-21.
103 Human prostate CYP3A5: identification of a unique 5'-untranslated sequence and characterization of purified recombinant protein. Biochem Biophys Res Commun. 1999 Jul 14;260(3):676-81.
104 The influence of diltiazem versus cimetidine on propranolol metabolism. J Clin Pharmacol. 1992 Dec;32(12):1099-104.
105 Influence of ABCB1 and CYP3A5 genetic polymorphisms on the pharmacokinetics of quetiapine in healthy volunteers. Pharmacogenet Genomics. 2014 Jan;24(1):35-42.
106 Pharmacology of the new target-specific oral anticoagulants. J Thromb Thrombolysis. 2013 Aug;36(2):133-40.
107 Population pharmacokinetics of romidepsin in patients with cutaneous T-cell lymphoma and relapsed peripheral T-cell lymphoma. Clin Cancer Res. 2009 Feb 15;15(4):1496-503.
108 Effect of rifampicin on the pharmacokinetics and pharmacodynamics of saxagliptin, a dipeptidyl peptidase-4 inhibitor, in healthy subjects. Br J Clin Pharmacol. 2011 Jul;72(1):92-102.
109 The contributions of cytochromes P450 3A4 and 3A5 to the metabolism of the phosphodiesterase type 5 inhibitors sildenafil, udenafil, and vardenafil. Drug Metab Dispos. 2008 Jun;36(6):986-90.
110 In vitro metabolism of simvastatin in humans [SBT]identification of metabolizing enzymes and effect of the drug on hepatic P450s. Drug Metab Dispos. 1997 Oct;25(10):1191-9.
111 Urinary 6 beta-hydroxycortisol excretion in rheumatoid arthritis. Br J Rheumatol. 1997 Jan;36(1):54-8.
112 Tacrolimus pharmacokinetics and pharmacogenetics: influence of adenosine triphosphate-binding cassette B1 (ABCB1) and cytochrome (CYP) 3A polymorphisms. Fundam Clin Pharmacol. 2007 Aug;21(4):427-35.
113 Contribution of CYP3A isoforms to dealkylation of PDE5 inhibitors: a comparison between sildenafil N-demethylation and tadalafil demethylenation. Biol Pharm Bull. 2015;38(1):58-65.
114 Polymorphisms in cytochrome P4503A5 (CYP3A5) may be associated with race and tumor characteristics, but not metabolism and side effects of tamoxifen in breast cancer patients. Cancer Lett. 2005 Jan 10;217(1):61-72.
115 Roles of cytochromes P450 1A2, 2A6, and 2C8 in 5-fluorouracil formation from tegafur, an anticancer prodrug, in human liver microsomes. Drug Metab Dispos. 2000 Dec;28(12):1457-63.
116 Verapamil toxicity resulting from a probable interaction with telithromycin. Ann Pharmacother. 2005 Feb;39(2):357-60.
117 FDA label of Tenapanor. The 2020 official website of the U.S. Food and Drug Administration.
118 O-demethylation of epipodophyllotoxins is catalyzed by human cytochrome P450 3A4. Mol Pharmacol. 1994 Feb;45(2):352-8.
119 Human liver microsomal cytochrome P450 3A enzymes involved in thalidomide 5-hydroxylation and formation of a glutathione conjugate. Chem Res Toxicol. 2010 Jun 21;23(6):1018-24.
120 Identification of human cytochrome P450s involved in the formation of all-trans-retinoic acid principal metabolites. Mol Pharmacol. 2000 Dec;58(6):1341-8.
121 Metabolic pathways of inhaled glucocorticoids by the CYP3A enzymes. Drug Metab Dispos. 2013 Feb;41(2):379-89.
122 The disposition of three phosphodiesterase type 5 inhibitors, vardenafil, sildenafil, and udenafil, is differently influenced by the CYP3A5 genotype. Pharmacogenet Genomics. 2011 Dec;21(12):820-8.
123 Differential mechanism-based inhibition of CYP3A4 and CYP3A5 by verapamil. Drug Metab Dispos. 2005 May;33(5):664-71.
124 Association of CYP3A5 expression and vincristine neurotoxicity in pediatric malignancies in Turkish population. J Pediatr Hematol Oncol. 2017 Aug;39(6):458-462.
125 Structural perspectives of the CYP3A family and their small molecule modulators in drug metabolism. 2019, 3(3), 132-142.
126 Identification of the cytochrome P450 and other enzymes involved in the in vitro oxidative metabolism of a novel antidepressant, Lu AA21004. Drug Metab Dispos. 2012 Jul;40(7):1357-65.
127 Protease inhibitors in patients with HIV disease. Clinically important pharmacokinetic considerations. Clin Pharmacokinet. 1997 Mar;32(3):194-209.
128 PharmGKB: A worldwide resource for pharmacogenomic information. Wiley Interdiscip Rev Syst Biol Med. 2018 Jul;10(4):e1417. (ID: PA166170041)
129 Prediction of drug-drug interactions of zonisamide metabolism in humans from in vitro data. Eur J Clin Pharmacol. 1998 Apr;54(2):177-83.
130 Identification of cytochrome P450 enzymes involved in the metabolism of zotepine, an antipsychotic drug, in human liver microsomes. Xenobiotica. 1999 Mar;29(3):217-29.
131 Metabolic pathway of icotinib in vitro: the differential roles of CYP3A4, CYP3A5, and CYP1A2 on potential pharmacokinetic drug-drug interaction. J Pharm Sci. 2018 Apr;107(4):979-983.
132 Characterization of benidipine and its enantiomers' metabolism by human liver cytochrome P450 enzymes. Drug Metab Dispos. 2007 Sep;35(9):1518-24.
133 CYP3A5*3 and MDR1 C3435T are influencing factors of inter-subject variability in rupatadine pharmacokinetics in healthy Chinese volunteers. Eur J Drug Metab Pharmacokinet. 2016 Apr;41(2):117-24.
134 Anlotinib: a novel multi-targeting tyrosine kinase inhibitor in clinical development. J Hematol Oncol. 2018 Sep 19;11(1):120.
135 The metabolic profile of azimilide in man: in vivo and in vitro evaluations. J Pharm Sci. 2005 Sep;94(9):2084-95.
136 CYP3A5 genotype has a dose-dependent effect on ABT-773 plasma levels. Clin Pharmacol Ther. 2004 Jun;75(6):516-28.
137 Effect of glycyrrhizin on the activity of CYP3A enzyme in humans. Eur J Clin Pharmacol. 2010 Aug;66(8):805-810.
138 Induction of cytochromes P-450 2B and 3A in mice following the dietary administration of the novel cognitive enhancer linopirdine. Drug Metab Dispos. 1994 Jan-Feb;22(1):65-73.
139 Disposition and metabolism of semagacestat, a {gamma}-secretase inhibitor, in humans. Drug Metab Dispos. 2010 Apr;38(4):554-65.
140 Disposition and metabolism of the G protein-coupled receptor 40 agonist TAK-875 (fasiglifam) in rats, dogs, and humans. Xenobiotica. 2019 Apr;49(4):433-445.
141 Pharmacokinetic and drug-drug interaction profiles of the combination of Tezacaftor/Ivacaftor. Clin Transl Sci. 2019 May;12(3):267-275.
142 First-in-human pharmacokinetic and pharmacodynamic study of the dual m-TORC 1/2 inhibitor AZD2014. Clin Cancer Res. 2015 Aug 1;21(15):3412-9.
143 Characterization of ADME properties of [(14)C]asunaprevir (BMS-650032) in humans. Xenobiotica. 2016;46(1):52-64.
144 Pharmacokinetic profile of dexloxiglumide. Clin Pharmacokinet. 2006;45(12):1177-88.
145 Safety assessment, in vitro and in vivo, and pharmacokinetics of emivirine, a potent and selective nonnucleoside reverse transcriptase inhibitor of human immunodeficiency virus type 1. Antimicrob Agents Chemother. 2000 Jan;44(1):123-30.
146 Metabolism and bioactivation of famitinib, a novel inhibitor of receptor tyrosine kinase, in cancer patients. Br J Pharmacol. 2013 Apr;168(7):1687-706.
147 Trastuzumab emtansine. An inadequately assessed combination of two cytotoxic drugs. Prescrire Int. 2014 Dec;23(155):289.
148 Metabolism Of Antiretroviral Drugs Used In Hiv Preexposure Prophylaxis
149 Nonclinical pharmacokinetics and in vitro metabolism of H3B-6545, a novel selective ERalpha covalent antagonist (SERCA). Cancer Chemother Pharmacol. 2019 Jan;83(1):151-160.
150 Correlation of the in vitro biotransformation of H3B-6527 in dog and human hepatocytes with the in vivo metabolic profile of 14C-H3B-6527 in a dog mass balance study. Xenobiotica. 2020 Apr;50(4):458-467.
151 ITX 5061 quantitation in human plasma with reverse phase liquid chromatography and mass spectrometry detection. Antivir Ther. 2013;18(3):329-36.
152 CYP3A5 mediates bioactivation and cytotoxicity of tetrandrine. Arch Toxicol. 2016 Jul;90(7):1737-48.
153 Metabolism of ezlopitant, a nonpeptidic substance P receptor antagonist, in liver microsomes: enzyme kinetics, cytochrome P450 isoform identity, and in vitro-in vivo correlation. Drug Metab Dispos. 2000 Sep;28(9):1069-76.
154 Construction and verification of CYP3A5 gene polymorphisms using a Saccharomyces cerevisiae expression system to predict drug metabolism. Mol Med Rep. 2017 Apr;15(4):1593-1600.
155 Quantitative contribution of CYP2D6 and CYP3A to oxycodone metabolism in human liver and intestinal microsomes. Drug Metab Dispos. 2004 Apr;32(4):447-54.
156 Quinacrine is mainly metabolized to mono-desethyl quinacrine by CYP3A4/5 and its brain accumulation is limited by P-glycoprotein. Drug Metab Dispos. 2006 Jul;34(7):1136-44.
157 Diazinon, chlorpyrifos and parathion are metabolised by multiple cytochromes P450 in human liver. Toxicology. 2006 Jul 5;224(1-2):22-32.