Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQGYY83)

DOT Name	Cytochrome P450 3A4 (CYP3A4)
Synonyms	EC 1.14.14.1; 1,4-cineole 2-exo-monooxygenase; 1,8-cineole 2-exo-monooxygenase; EC 1.14.14.56; Albendazole monooxygenase (sulfoxide-forming); EC 1.14.14.73; Albendazole sulfoxidase; CYPIIIA3; CYPIIIA4; Cholesterol 25-hydroxylase; Cytochrome P450 3A3; Cytochrome P450 HLp; Cytochrome P450 NF-25; Cytochrome P450-PCN1; Nifedipine oxidase; Quinine 3-monooxygenase; EC 1.14.14.55
Gene Name	CYP3A4
Related Disease	Vitamin D-dependent rickets, type 3 ( )
UniProt ID	CP3A4_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	1TQN ; 1W0E ; 1W0F ; 1W0G ; 2J0D ; 2V0M ; 3NXU ; 3TJS ; 3UA1 ; 4D6Z ; 4D75 ; 4D78 ; 4D7D ; 4I3Q ; 4I4G ; 4I4H ; 4K9T ; 4K9U ; 4K9V ; 4K9W ; 4K9X ; 4NY4 ; 5A1P ; 5A1R ; 5G5J ; 5TE8 ; 5VC0 ; 5VCC ; 5VCD ; 5VCE ; 5VCG ; 6BCZ ; 6BD5 ; 6BD6 ; 6BD7 ; 6BD8 ; 6BDH ; 6BDI ; 6BDK ; 6BDM ; 6OO9 ; 6OOA ; 6OOB ; 7KS8 ; 7KSA ; 7KVH ; 7KVI ; 7KVJ ; 7KVK ; 7KVM ; 7KVN ; 7KVO ; 7KVP ; 7KVQ ; 7KVS ; 7LXL ; 7UAY ; 7UAZ ; 7UF9 ; 7UFA ; 7UFB ; 7UFC ; 7UFD ; 7UFE ; 7UFF ; 8DYC ; 8EWD ; 8EWE ; 8EWL ; 8EWM ; 8EWN ; 8EWP ; 8EWQ ; 8EWR ; 8EWS ; 8EXB ; 8SO1 ; 8SO2
EC Number	1.14.14.1; 1.14.14.55; 1.14.14.56; 1.14.14.73
Pfam ID	PF00067
Sequence	MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMF DMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISI AEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYS MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICV FPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI IFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVV NETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFS KKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLG GLLQPEKPVVLKVESRDGTVSGA
Function	A cytochrome P450 monooxygenase involved in the metabolism of sterols, steroid hormones, retinoids and fatty acids. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase). Catalyzes the hydroxylation of carbon-hydrogen bonds. Exhibits high catalytic activity for the formation of hydroxyestrogens from estrone (E1) and 17beta-estradiol (E2), namely 2-hydroxy E1 and E2, as well as D-ring hydroxylated E1 and E2 at the C-16 position. Plays a role in the metabolism of androgens, particularly in oxidative deactivation of testosterone. Metabolizes testosterone to less biologically active 2beta- and 6beta-hydroxytestosterones. Contributes to the formation of hydroxycholesterols (oxysterols), particularly A-ring hydroxylated cholesterol at the C-4beta position, and side chain hydroxylated cholesterol at the C-25 position, likely contributing to cholesterol degradation and bile acid biosynthesis. Catalyzes bisallylic hydroxylation of polyunsaturated fatty acids (PUFA). Catalyzes the epoxidation of double bonds of PUFA with a preference for the last double bond. Metabolizes endocannabinoid arachidonoylethanolamide (anandamide) to 8,9-, 11,12-, and 14,15-epoxyeicosatrienoic acid ethanolamides (EpETrE-EAs), potentially modulating endocannabinoid system signaling. Plays a role in the metabolism of retinoids. Displays high catalytic activity for oxidation of all-trans-retinol to all-trans-retinal, a rate-limiting step for the biosynthesis of all-trans-retinoic acid (atRA). Further metabolizes atRA toward 4-hydroxyretinoate and may play a role in hepatic atRA clearance. Responsible for oxidative metabolism of xenobiotics. Acts as a 2-exo-monooxygenase for plant lipid 1,8-cineole (eucalyptol). Metabolizes the majority of the administered drugs. Catalyzes sulfoxidation of the anthelmintics albendazole and fenbendazole. Hydroxylates antimalarial drug quinine. Acts as a 1,4-cineole 2-exo-monooxygenase. Also involved in vitamin D catabolism and calcium homeostasis. Catalyzes the inactivation of the active hormone calcitriol (1-alpha,25-dihydroxyvitamin D(3)).
Tissue Specificity	Expressed in prostate and liver. According to some authors, it is not expressed in brain . According to others, weak levels of expression are measured in some brain locations . Also expressed in epithelium of the small intestine and large intestine, bile duct, nasal mucosa, kidney, adrenal cortex, epithelium of the gastric mucosa with intestinal metaplasia, gallbladder, intercalated ducts of the pancreas, chief cells of the parathyroid and the corpus luteum of the ovary (at protein level).
KEGG Pathway	Steroid hormone biosynthesis (hsa00140 ) Linoleic acid metabolism (hsa00591 ) Retinol metabolism (hsa00830 ) Metabolism of xenobiotics by cytochrome P450 (hsa00980 ) Drug metabolism - cytochrome P450 (hsa00982 ) Drug metabolism - other enzymes (hsa00983 ) Metabolic pathways (hsa01100 ) Bile secretion (hsa04976 ) Chemical carcinogenesis - D. adducts (hsa05204 ) Chemical carcinogenesis - receptor activation (hsa05207 )
Reactome Pathway	Xenobiotics (R-HSA-211981 ) Aflatoxin activation and detoxification (R-HSA-5423646 ) Biosynthesis of maresin-like SPMs (R-HSA-9027307 ) Aspirin ADME (R-HSA-9749641 ) Atorvastatin ADME (R-HSA-9754706 ) Prednisone ADME (R-HSA-9757110 ) Phase I - Functionalization of compounds (R-HSA-211945 )
BioCyc Pathway	MetaCyc:HS08544-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Vitamin D-dependent rickets, type 3	DISKB93L	Limited	Unknown	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Regulation of Drug Effects of 28 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Testosterone	DM7HUNW	Approved	Cytochrome P450 3A4 (CYP3A4) increases the metabolism of Testosterone.	[75]
Methamphetamine	DMPM4SK	Approved	Cytochrome P450 3A4 (CYP3A4) affects the metabolism of Methamphetamine.	[79]
Amodiaquine	DME4RA8	Approved	Cytochrome P450 3A4 (CYP3A4) increases the metabolism of Amodiaquine.	[87]
Thiotepa	DMIZKOP	Approved	Cytochrome P450 3A4 (CYP3A4) affects the export of Thiotepa.	[95]
Bromfenac	DMKB79O	Approved	Cytochrome P450 3A4 (CYP3A4) increases the metabolism of Bromfenac.	[99]
Dehydroepiandrosterone sulfate	DM4Q80H	Approved	Cytochrome P450 3A4 (CYP3A4) affects the metabolism of Dehydroepiandrosterone sulfate.	[102]
Oxycodone	DMXLKHV	Approved	Cytochrome P450 3A4 (CYP3A4) affects the metabolism of Oxycodone.	[105]
Eplerenone	DMF0NQR	Approved	Cytochrome P450 3A4 (CYP3A4) increases the abundance of Eplerenone.	[108]
LAROPIPRANT	DM5FABJ	Phase 4	Cytochrome P450 3A4 (CYP3A4) increases the metabolism of LAROPIPRANT.	[113]
Masitinib	DMRSNEU	Phase 3	Cytochrome P450 3A4 (CYP3A4) increases the metabolism of Masitinib.	[114]
ED-71	DMRLXAI	Phase 3	Cytochrome P450 3A4 (CYP3A4) increases the metabolism of ED-71.	[115]
CQA 206-291	DM60TVK	Phase 3	Cytochrome P450 3A4 (CYP3A4) increases the metabolism of CQA 206-291.	[116]
(Z)-endoxifen	DMGDOS2	Phase 2	Cytochrome P450 3A4 (CYP3A4) increases the metabolism of (Z)-endoxifen.	[117]
Icaritin	DMGHQ37	Phase 2	Cytochrome P450 3A4 (CYP3A4) increases the metabolism of Icaritin.	[119]
Acalabrutinib	DM7GCVW	Phase 2 Trial	Cytochrome P450 3A4 (CYP3A4) increases the metabolism of Acalabrutinib.	[121]
PMID28460551-Compound-2	DM4DOUB	Patented	Cytochrome P450 3A4 (CYP3A4) increases the metabolism of PMID28460551-Compound-2.	[123]
Astemizole	DM2HN6Q	Withdrawn from market	Cytochrome P450 3A4 (CYP3A4) increases the degradation of Astemizole.	[124]
Vanoxerine	DMBQPA5	Discontinued in Phase 1	Cytochrome P450 3A4 (CYP3A4) decreases the degradation of Vanoxerine.	[126]
Nemorubicin	DMX7Q3H	Preclinical	Cytochrome P450 3A4 (CYP3A4) increases the metabolism of Nemorubicin.	[128]
Phencyclidine	DMQBEYX	Investigative	Cytochrome P450 3A4 (CYP3A4) affects the metabolism of Phencyclidine.	[132]
Rapamycin Immunosuppressant Drug	DM678IB	Investigative	Cytochrome P450 3A4 (CYP3A4) affects the metabolism of Rapamycin Immunosuppressant Drug.	[134]
BRN-3548355	DM4KXT0	Investigative	Cytochrome P450 3A4 (CYP3A4) increases the metabolism of BRN-3548355.	[136]
NAPQI	DM8F5LR	Investigative	Cytochrome P450 3A4 (CYP3A4) increases the abundance of NAPQI.	[137]
Ellipticine	DMHPYSM	Investigative	Cytochrome P450 3A4 (CYP3A4) increases the metabolism of Ellipticine.	[140]
Fenthion	DMKEG49	Investigative	Cytochrome P450 3A4 (CYP3A4) affects the metabolism of Fenthion.	[141]
TEPA (possesses cytotoxic activity)	DMROS5K	Investigative	Cytochrome P450 3A4 (CYP3A4) affects the export of TEPA (possesses cytotoxic activity).	[95]
LM-4108	DMWLMTD	Investigative	Cytochrome P450 3A4 (CYP3A4) increases the metabolism of LM-4108.	[146]
Alpha-Hydroxy-Midazolam	DMAQBKX	Investigative	Cytochrome P450 3A4 (CYP3A4) increases the abundance of Alpha-Hydroxy-Midazolam.	[148]
------------------------------------------------------------------------------------


⏷ Show the Full List of 28 Drug(s)

This DOT Affected the Drug Response of 22 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Irinotecan	DMP6SC2	Approved	Cytochrome P450 3A4 (CYP3A4) increases the response to substance of Irinotecan.	[76]
Estrone	DM5T6US	Approved	Cytochrome P450 3A4 (CYP3A4) affects the binding of Estrone.	[81]
Docetaxel	DMDI269	Approved	Cytochrome P450 3A4 (CYP3A4) increases the response to substance of Docetaxel.	[76]
Olanzapine	DMPFN6Y	Approved	Cytochrome P450 3A4 (CYP3A4) increases the Drug level changed ADR of Olanzapine.	[82]
Isoniazid	DM5JVS3	Approved	Cytochrome P450 3A4 (CYP3A4) increases the response to substance of Isoniazid.	[83]
Clonidine	DM6RZ9Q	Approved	Cytochrome P450 3A4 (CYP3A4) increases the Drug level changed ADR of Clonidine.	[82]
Tolcapone	DM8MNVO	Approved	Cytochrome P450 3A4 (CYP3A4) increases the response to substance of Tolcapone.	[83]
Dronedarone	DMA8FS5	Approved	Cytochrome P450 3A4 (CYP3A4) decreases the response to substance of Dronedarone.	[94]
Indinavir	DM0T3YH	Approved	Cytochrome P450 3A4 (CYP3A4) increases the Therapeutic and nontherapeutic responses ADR of Indinavir.	[82]
Risperidone	DMN6DXL	Approved	Cytochrome P450 3A4 (CYP3A4) affects the response to substance of Risperidone.	[97]
Enalapril	DMNFUZR	Approved	Cytochrome P450 3A4 (CYP3A4) increases the Hepatotoxicity ADR of Enalapril.	[82]
Desipramine	DMT2FDC	Approved	Cytochrome P450 3A4 (CYP3A4) increases the response to substance of Desipramine.	[83]
Tacrine	DM51FY6	Approved	Cytochrome P450 3A4 (CYP3A4) increases the response to substance of Tacrine.	[83]
Felbamate	DM1V5ZS	Approved	Cytochrome P450 3A4 (CYP3A4) increases the Hepatotoxicity ADR of Felbamate.	[82]
Amitriptyline	DMK7F9S	Approved	Cytochrome P450 3A4 (CYP3A4) increases the Atrioventricular block ADR of Amitriptyline.	[82]
Alogliptin	DM8WI3R	Approved	Cytochrome P450 3A4 (CYP3A4) increases the Hypoglycaemia ADR of Alogliptin.	[82]
Sunitinib	DMCBJSR	Approved	Cytochrome P450 3A4 (CYP3A4) increases the Hypertension ADR of Sunitinib.	[109]
BMS-201038	DMQTAGO	Approved	Cytochrome P450 3A4 (CYP3A4) increases the Teratogenicity ADR of BMS-201038.	[82]
Ketoconazole	DMPZI3Q	Approved	Cytochrome P450 3A4 (CYP3A4) increases the Adverse drug reaction ADR of Ketoconazole.	[82]
Disulfiram	DMCL2OK	Phase 2 Trial	Cytochrome P450 3A4 (CYP3A4) increases the response to substance of Disulfiram.	[83]
Leflunomide	DMR8ONJ	Phase 1 Trial	Cytochrome P450 3A4 (CYP3A4) increases the response to substance of Leflunomide.	[83]
Okadaic acid	DM47CO1	Investigative	Cytochrome P450 3A4 (CYP3A4) decreases the response to substance of Okadaic acid.	[133]
------------------------------------------------------------------------------------


⏷ Show the Full List of 22 Drug(s)

This DOT Affected the Biotransformations of 44 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Ethinyl estradiol	DMODJ40	Approved	Cytochrome P450 3A4 (CYP3A4) increases the hydroxylation of Ethinyl estradiol.	[77]
Ifosfamide	DMCT3I8	Approved	Cytochrome P450 3A4 (CYP3A4) decreases the ethylation of Ifosfamide.	[78]
Imatinib	DM7RJXL	Approved	Cytochrome P450 3A4 (CYP3A4) decreases the methylation of Imatinib.	[80]
Tacrolimus	DMZ7XNQ	Approved	Cytochrome P450 3A4 (CYP3A4) decreases the methylation of Tacrolimus.	[84]
Prasterone	DM67VKL	Approved	Cytochrome P450 3A4 (CYP3A4) increases the hydroxylation of Prasterone.	[85]
Propranolol	DM79NTF	Approved	Cytochrome P450 3A4 (CYP3A4) increases the oxidation of Propranolol.	[86]
Mefenamic acid	DMK7HFI	Approved	Cytochrome P450 3A4 (CYP3A4) increases the glutathionylation of Mefenamic acid.	[88]
Citalopram	DM2G9AE	Approved	Cytochrome P450 3A4 (CYP3A4) decreases the methylation of Citalopram.	[89]
Pomalidomide	DMTGBAX	Approved	Cytochrome P450 3A4 (CYP3A4) increases the oxidation of Pomalidomide.	[90]
Amphetamine	DMSZQAK	Approved	Cytochrome P450 3A4 (CYP3A4) decreases the alkylation of Amphetamine.	[91]
Lidocaine	DML4ZOT	Approved	Cytochrome P450 3A4 (CYP3A4) decreases the ethylation of Lidocaine.	[92]
Lamotrigine	DM8SXYG	Approved	Cytochrome P450 3A4 (CYP3A4) increases the glutathionylation of Lamotrigine.	[93]
Letrozole	DMH07Y3	Approved	Cytochrome P450 3A4 (CYP3A4) increases the oxidation of Letrozole.	[96]
Metoprolol	DMOJ0V6	Approved	Cytochrome P450 3A4 (CYP3A4) increases the hydroxylation of Metoprolol.	[98]
Teniposide	DMLW57T	Approved	Cytochrome P450 3A4 (CYP3A4) decreases the methylation of Teniposide.	[100]
Dextromethorphan	DMUDJZM	Approved	Cytochrome P450 3A4 (CYP3A4) decreases the methylation of Dextromethorphan.	[101]
Flunitrazepam	DMGR5Z3	Approved	Cytochrome P450 3A4 (CYP3A4) increases the hydroxylation of Flunitrazepam.	[101]
Almogran	DM7I64Z	Approved	Cytochrome P450 3A4 (CYP3A4) decreases the methylation of Almogran.	[103]
Doxercalciferol	DM6FG1P	Approved	Cytochrome P450 3A4 (CYP3A4) increases the hydroxylation of Doxercalciferol.	[104]
Estazolam	DMZGXUM	Approved	Cytochrome P450 3A4 (CYP3A4) increases the hydroxylation of Estazolam.	[106]
Perazine	DM2AOTZ	Approved	Cytochrome P450 3A4 (CYP3A4) decreases the methylation of Perazine.	[107]
Rivaroxaban	DMQMBZ1	Approved	Cytochrome P450 3A4 (CYP3A4) increases the hydroxylation of Rivaroxaban.	[110]
Adinazolam	DMBHO9Y	Approved	Cytochrome P450 3A4 (CYP3A4) decreases the methylation of Adinazolam.	[111]
Amoxapine	DMKITQE	Approved	Cytochrome P450 3A4 (CYP3A4) increases the chemical synthesis of Amoxapine.	[112]
Alfacalcidol	DM1237M	Phase 4	Cytochrome P450 3A4 (CYP3A4) increases the hydroxylation of Alfacalcidol.	[104]
N-DESMETHYLCLOZAPINE	DMVIRN3	Phase 2	Cytochrome P450 3A4 (CYP3A4) increases the chemical synthesis of N-DESMETHYLCLOZAPINE.	[118]
Saracatinib	DMBLHGP	Phase 2	Cytochrome P450 3A4 (CYP3A4) increases the oxidation of Saracatinib.	[120]
Tetrandrine	DMAOJBX	Phase 1	Cytochrome P450 3A4 (CYP3A4) increases the glutathionylation of Tetrandrine.	[122]
Norcisapride	DMJSKUI	Discontinued in Phase 2	Cytochrome P450 3A4 (CYP3A4) affects the chemical synthesis of Norcisapride.	[125]
SCH-C	DM8J9SF	Discontinued in Phase 1	Cytochrome P450 3A4 (CYP3A4) decreases the ethylation of SCH-C.	[127]
N-desethyl sunitinib	DM5ATJ0	Preclinical	Cytochrome P450 3A4 (CYP3A4) increases the chemical synthesis of N-desethyl sunitinib.	[123]
EMODIN	DMAEDQG	Terminated	Cytochrome P450 3A4 (CYP3A4) increases the hydroxylation of EMODIN.	[129]
Nimesulide	DMR1NMD	Terminated	Cytochrome P450 3A4 (CYP3A4) increases the glutathionylation of Nimesulide.	[130]
HELENALIN	DMMCI4H	Terminated	Cytochrome P450 3A4 (CYP3A4) increases the oxidation of HELENALIN.	[131]
all-trans-4-oxo-retinoic acid	DMM2R1N	Investigative	Cytochrome P450 3A4 (CYP3A4) increases the chemical synthesis of all-trans-4-oxo-retinoic acid.	[135]
Chlorphrifos oxon	DMGBT68	Investigative	Cytochrome P450 3A4 (CYP3A4) increases the chemical synthesis of Chlorphrifos oxon.	[138]
Aloe-emodin	DMPTY8S	Investigative	Cytochrome P450 3A4 (CYP3A4) increases the chemical synthesis of Aloe-emodin.	[139]
2-hydroxy-17beta-estradiol	DMM9Z0B	Investigative	Cytochrome P450 3A4 (CYP3A4) increases the chemical synthesis of 2-hydroxy-17beta-estradiol.	[142]
eucalyptol	DME5CK3	Investigative	Cytochrome P450 3A4 (CYP3A4) increases the hydroxylation of eucalyptol.	[143]
Dimemorfan	DM2Q3CL	Investigative	Cytochrome P450 3A4 (CYP3A4) increases the oxidation of Dimemorfan.	[144]
Tauroursodeoxycholic acid	DMFKRQE	Investigative	Cytochrome P450 3A4 (CYP3A4) increases the hydroxylation of Tauroursodeoxycholic acid.	[145]
Taurochenodeoxycholic acid	DMEL9UT	Investigative	Cytochrome P450 3A4 (CYP3A4) increases the hydroxylation of Taurochenodeoxycholic acid.	[145]
Benzyloxyresorufin	DM26SR7	Investigative	Cytochrome P450 3A4 (CYP3A4) increases the oxidation of Benzyloxyresorufin.	[147]
Glycodeoxycholic acid	DM1XEJV	Investigative	Cytochrome P450 3A4 (CYP3A4) increases the hydroxylation of Glycodeoxycholic acid.	[145]
------------------------------------------------------------------------------------


⏷ Show the Full List of 44 Drug(s)

96 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Cytochrome P450 3A4 (CYP3A4).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Cytochrome P450 3A4 (CYP3A4).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Cytochrome P450 3A4 (CYP3A4).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Cytochrome P450 3A4 (CYP3A4).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Cytochrome P450 3A4 (CYP3A4).	[6]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Cytochrome P450 3A4 (CYP3A4).	[7]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the activity of Cytochrome P450 3A4 (CYP3A4).	[8]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Cytochrome P450 3A4 (CYP3A4).	[9]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Cytochrome P450 3A4 (CYP3A4).	[10]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Cytochrome P450 3A4 (CYP3A4).	[11]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Cytochrome P450 3A4 (CYP3A4).	[12]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Cytochrome P450 3A4 (CYP3A4).	[13]
Carbamazepine	DMZOLBI	Approved	Carbamazepine increases the expression of Cytochrome P450 3A4 (CYP3A4).	[14]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Cytochrome P450 3A4 (CYP3A4).	[15]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Cytochrome P450 3A4 (CYP3A4).	[16]
Phenobarbital	DMXZOCG	Approved	Phenobarbital increases the activity of Cytochrome P450 3A4 (CYP3A4).	[17]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Cytochrome P450 3A4 (CYP3A4).	[18]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil affects the expression of Cytochrome P450 3A4 (CYP3A4).	[19]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Cytochrome P450 3A4 (CYP3A4).	[14]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the activity of Cytochrome P450 3A4 (CYP3A4).	[8]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the activity of Cytochrome P450 3A4 (CYP3A4).	[20]
Isotretinoin	DM4QTBN	Approved	Isotretinoin increases the activity of Cytochrome P450 3A4 (CYP3A4).	[21]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of Cytochrome P450 3A4 (CYP3A4).	[22]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol increases the expression of Cytochrome P450 3A4 (CYP3A4).	[23]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Cytochrome P450 3A4 (CYP3A4).	[24]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of Cytochrome P450 3A4 (CYP3A4).	[25]
Etoposide	DMNH3PG	Approved	Etoposide increases the expression of Cytochrome P450 3A4 (CYP3A4).	[26]
Paclitaxel	DMLB81S	Approved	Paclitaxel increases the expression of Cytochrome P450 3A4 (CYP3A4).	[6]
Diclofenac	DMPIHLS	Approved	Diclofenac increases the expression of Cytochrome P450 3A4 (CYP3A4).	[27]
Malathion	DMXZ84M	Approved	Malathion increases the expression of Cytochrome P450 3A4 (CYP3A4).	[28]
Indomethacin	DMSC4A7	Approved	Indomethacin increases the expression of Cytochrome P450 3A4 (CYP3A4).	[29]
Menthol	DMG2KW7	Approved	Menthol increases the expression of Cytochrome P450 3A4 (CYP3A4).	[30]
Permethrin	DMZ0Q1G	Approved	Permethrin increases the expression of Cytochrome P450 3A4 (CYP3A4).	[31]
Azacitidine	DMTA5OE	Approved	Azacitidine increases the expression of Cytochrome P450 3A4 (CYP3A4).	[32]
Simvastatin	DM30SGU	Approved	Simvastatin increases the expression of Cytochrome P450 3A4 (CYP3A4).	[7]
Obeticholic acid	DM3Q1SM	Approved	Obeticholic acid decreases the expression of Cytochrome P450 3A4 (CYP3A4).	[33]
Rifampicin	DM5DSFZ	Approved	Rifampicin increases the expression of Cytochrome P450 3A4 (CYP3A4).	[14]
Cyclophosphamide	DM4O2Z7	Approved	Cyclophosphamide increases the expression of Cytochrome P450 3A4 (CYP3A4).	[34]
Mifepristone	DMGZQEF	Approved	Mifepristone increases the expression of Cytochrome P450 3A4 (CYP3A4).	[35]
Capsaicin	DMGMF6V	Approved	Capsaicin decreases the activity of Cytochrome P450 3A4 (CYP3A4).	[36]
Alitretinoin	DMME8LH	Approved	Alitretinoin increases the activity of Cytochrome P450 3A4 (CYP3A4).	[21]
Pioglitazone	DMKJ485	Approved	Pioglitazone increases the expression of Cytochrome P450 3A4 (CYP3A4).	[24]
Thalidomide	DM70BU5	Approved	Thalidomide increases the expression of Cytochrome P450 3A4 (CYP3A4).	[37]
Liothyronine	DM6IR3P	Approved	Liothyronine increases the expression of Cytochrome P450 3A4 (CYP3A4).	[38]
Lindane	DMB8CNL	Approved	Lindane increases the expression of Cytochrome P450 3A4 (CYP3A4).	[39]
Phenytoin	DMNOKBV	Approved	Phenytoin increases the expression of Cytochrome P450 3A4 (CYP3A4).	[14]
Prednisolone	DMQ8FR2	Approved	Prednisolone increases the expression of Cytochrome P450 3A4 (CYP3A4).	[40]
Hydrocortisone	DMGEMB7	Approved	Hydrocortisone increases the expression of Cytochrome P450 3A4 (CYP3A4).	[7]
Ursodeoxycholic acid	DMCUT21	Approved	Ursodeoxycholic acid increases the expression of Cytochrome P450 3A4 (CYP3A4).	[41]
Adefovir dipivoxil	DMMAWY1	Approved	Adefovir dipivoxil decreases the activity of Cytochrome P450 3A4 (CYP3A4).	[42]
Ritonavir	DMU764S	Approved	Ritonavir increases the expression of Cytochrome P450 3A4 (CYP3A4).	[15]
Nefazodone	DM4ZS8M	Approved	Nefazodone decreases the expression of Cytochrome P450 3A4 (CYP3A4).	[43]
Dihydroartemisinin	DMBXVMZ	Approved	Dihydroartemisinin decreases the activity of Cytochrome P450 3A4 (CYP3A4).	[8]
Methylprednisolone	DM4BDON	Approved	Methylprednisolone decreases the expression of Cytochrome P450 3A4 (CYP3A4).	[15]
Chenodiol	DMQ8JIK	Approved	Chenodiol decreases the expression of Cytochrome P450 3A4 (CYP3A4).	[44]
Cholecalciferol	DMGU74E	Approved	Cholecalciferol increases the expression of Cytochrome P450 3A4 (CYP3A4).	[45]
Dopamine	DMPGUCF	Approved	Dopamine decreases the activity of Cytochrome P450 3A4 (CYP3A4).	[46]
Bosentan	DMIOGBU	Approved	Bosentan increases the expression of Cytochrome P450 3A4 (CYP3A4).	[47]
Lovastatin	DM9OZWQ	Approved	Lovastatin increases the expression of Cytochrome P450 3A4 (CYP3A4).	[7]
Deoxycholic acid	DM3GYAL	Approved	Deoxycholic acid increases the expression of Cytochrome P450 3A4 (CYP3A4).	[48]
Warfarin	DMJYCVW	Approved	Warfarin decreases the expression of Cytochrome P450 3A4 (CYP3A4).	[49]
Orlistat	DMRJSP8	Approved	Orlistat increases the expression of Cytochrome P450 3A4 (CYP3A4).	[50]
Eicosapentaenoic acid/docosa-hexaenoic acid	DMMUCG4	Approved	Eicosapentaenoic acid/docosa-hexaenoic acid decreases the activity of Cytochrome P450 3A4 (CYP3A4).	[52]
Atazanavir	DMSYRBX	Approved	Atazanavir decreases the expression of Cytochrome P450 3A4 (CYP3A4).	[43]
Crizotinib	DM4F29C	Approved	Crizotinib increases the expression of Cytochrome P450 3A4 (CYP3A4).	[53]
Ciprofloxacin XR	DM2NLS9	Approved	Ciprofloxacin XR decreases the activity of Cytochrome P450 3A4 (CYP3A4).	[54]
Tetracycline	DMZA017	Approved	Tetracycline increases the expression of Cytochrome P450 3A4 (CYP3A4).	[55]
Omeprazole	DM471KJ	Approved	Omeprazole increases the expression of Cytochrome P450 3A4 (CYP3A4).	[35]
Cimetidine	DMH61ZB	Approved	Cimetidine decreases the activity of Cytochrome P450 3A4 (CYP3A4).	[56]
Mitotane	DMU1GX0	Approved	Mitotane increases the expression of Cytochrome P450 3A4 (CYP3A4).	[57]
Clotrimazole	DMMFCIH	Approved	Clotrimazole increases the expression of Cytochrome P450 3A4 (CYP3A4).	[7]
Nifedipine	DMSVOZT	Approved	Nifedipine increases the expression of Cytochrome P450 3A4 (CYP3A4).	[15]
Thioridazine	DM35M8J	Approved	Thioridazine decreases the activity of Cytochrome P450 3A4 (CYP3A4).	[59]
Flutamide	DMK0O7U	Approved	Flutamide increases the expression of Cytochrome P450 3A4 (CYP3A4).	[34]
Nelfinavir mesylate	DMFX6G8	Approved	Nelfinavir mesylate decreases the activity of Cytochrome P450 3A4 (CYP3A4).	[60]
Teriflunomide	DMQ2FKJ	Approved	Teriflunomide increases the expression of Cytochrome P450 3A4 (CYP3A4).	[61]
Efavirenz	DMC0GSJ	Approved	Efavirenz increases the expression of Cytochrome P450 3A4 (CYP3A4).	[15]
Erythromycin	DM4K7GQ	Approved	Erythromycin increases the expression of Cytochrome P450 3A4 (CYP3A4).	[55]
Ketamine	DMT5HA4	Approved	Ketamine decreases the expression of Cytochrome P450 3A4 (CYP3A4).	[62]
Budesonide	DMJIBAW	Approved	Budesonide increases the expression of Cytochrome P450 3A4 (CYP3A4).	[63]
Loratadine	DMF3AN7	Approved	Loratadine decreases the activity of Cytochrome P450 3A4 (CYP3A4).	[64]
Pentamidine	DMHZJCG	Approved	Pentamidine decreases the activity of Cytochrome P450 3A4 (CYP3A4).	[8]
Methoxsalen	DME8FZ9	Approved	Methoxsalen increases the expression of Cytochrome P450 3A4 (CYP3A4).	[65]
Reserpine	DM6VM38	Approved	Reserpine increases the expression of Cytochrome P450 3A4 (CYP3A4).	[15]
Clopidogrel	DMOL54H	Approved	Clopidogrel increases the expression of Cytochrome P450 3A4 (CYP3A4).	[66]
Lansoprazole	DMXYLQ3	Approved	Lansoprazole increases the expression of Cytochrome P450 3A4 (CYP3A4).	[67]
Terbinafine	DMI6HUW	Approved	Terbinafine increases the expression of Cytochrome P450 3A4 (CYP3A4).	[68]
Spironolactone	DM2AQ5N	Approved	Spironolactone increases the expression of Cytochrome P450 3A4 (CYP3A4).	[7]
Cholic acid	DM7OKQV	Approved	Cholic acid decreases the activity of Cytochrome P450 3A4 (CYP3A4).	[48]
Gemfibrozil	DMD8Q3J	Approved	Gemfibrozil increases the expression of Cytochrome P450 3A4 (CYP3A4).	[69]
Felodipine	DMOSW35	Approved	Felodipine increases the expression of Cytochrome P450 3A4 (CYP3A4).	[70]
Miconazole	DMPMYE8	Approved	Miconazole increases the expression of Cytochrome P450 3A4 (CYP3A4).	[71]
Probenecid	DMMFWOJ	Approved	Probenecid decreases the expression of Cytochrome P450 3A4 (CYP3A4).	[15]
Fluticasone propionate	DMRWLB2	Approved	Fluticasone propionate decreases the activity of Cytochrome P450 3A4 (CYP3A4).	[72]
Lopinavir	DMITQS0	Approved	Lopinavir decreases the activity of Cytochrome P450 3A4 (CYP3A4).	[60]
Clarithromycin	DM4M1SG	Approved	Clarithromycin decreases the expression of Cytochrome P450 3A4 (CYP3A4).	[15]
------------------------------------------------------------------------------------


⏷ Show the Full List of 96 Drug(s)

3 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Glutathione	DMAHMT9	Approved	Glutathione affects the binding of Cytochrome P450 3A4 (CYP3A4).	[51]
Nevirapine	DM6HX9B	Approved	Nevirapine affects the binding of Cytochrome P450 3A4 (CYP3A4).	[58]
Bromocriptine	DMVE3TK	Approved	Bromocriptine affects the binding of Cytochrome P450 3A4 (CYP3A4).	[74]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Biochemical Pathways of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Nortriptyline	DM4KDYJ	Approved	Nortriptyline increases the metabolism of Cytochrome P450 3A4 (CYP3A4).	[73]
------------------------------------------------------------------------------------

References

1	CYP3A4 mutation causes vitamin D-dependent rickets type 3. J Clin Invest. 2018 May 1;128(5):1913-1918. doi: 10.1172/JCI98680. Epub 2018 Apr 3.
2	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3	Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
4	Differentiation-specific factors modulate epidermal CYP1-4 gene expression in human skin in response to retinoic acid and classic aryl hydrocarbon receptor ligands. J Pharmacol Exp Ther. 2006 Dec;319(3):1162-71.
5	Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
6	The pregnane X receptor regulates gene expression in a ligand- and promoter-selective fashion. Mol Endocrinol. 2005 May;19(5):1170-80.
7	Receptor-dependent regulation of the CYP3A4 gene. Toxicology. 2002 Dec 27;181-182:199-202.
8	Application of higher throughput screening (HTS) inhibition assays to evaluate the interaction of antiparasitic drugs with cytochrome P450s. Drug Metab Dispos. 2001 Jan;29(1):30-5.
9	Regulation of CYP3A4 expression in human hepatocytes by pharmaceuticals and natural products. Drug Metab Dispos. 2003 May;31(5):533-9.
10	Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
11	Oxidative stress induces GSTP1 and CYP3A4 expression in the human erythroleukemia cell line, K562. Biol Pharm Bull. 2004 Apr;27(4):492-5.
12	Transcriptional control of intestinal cytochrome P-4503A by 1alpha,25-dihydroxy vitamin D3. Mol Pharmacol. 2001 Dec;60(6):1399-406.
13	Triclosan treatment decreased the antitumor effect of sorafenib on hepatocellular carcinoma cells. Onco Targets Ther. 2018 May 18;11:2945-2954.
14	A reporter gene assay to assess the molecular mechanisms of xenobiotic-dependent induction of the human CYP3A4 gene in vitro. Xenobiotica. 1999 Mar;29(3):269-79.
15	Use of immortalized human hepatocytes to predict the magnitude of clinical drug-drug interactions caused by CYP3A4 induction. Drug Metab Dispos. 2006 Oct;34(10):1742-8.
16	Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
17	Regulation of cytochrome P450 2C9 expression in primary cultures of human hepatocytes. J Biochem Mol Toxicol. 2009 Jan-Feb;23(1):43-58.
18	Isoform-specific regulation of cytochromes P450 expression by estradiol and progesterone. Drug Metab Dispos. 2013 Feb;41(2):263-9.
19	Multi-level gene expression profiles affected by thymidylate synthase and 5-fluorouracil in colon cancer. BMC Genomics. 2006 Apr 3;7:68. doi: 10.1186/1471-2164-7-68.
20	Characterization of the structural determinants required for potent mechanism-based inhibition of human cytochrome P450 1A1 by cannabidiol. Chem Biol Interact. 2014 May 25;215:62-8.
21	Retinoids activate the RXR/SXR-mediated pathway and induce the endogenous CYP3A4 activity in Huh7 human hepatoma cells. Toxicol Sci. 2006 Jul;92(1):51-60.
22	Effect of troglitazone on cytochrome P450 enzymes in primary cultures of human and rat hepatocytes. Xenobiotica. 2000 Mar;30(3):273-84. doi: 10.1080/004982500237668.
23	Use of comprehensive screening methods to detect selective human CAR activators. Biochem Pharmacol. 2011 Dec 15;82(12):1994-2007.
24	Comparative effects of thiazolidinediones on in vitro P450 enzyme induction and inhibition. Drug Metab Dispos. 2003 Apr;31(4):439-46.
25	CYP4F2 repression and a modified alpha-tocopherol (vitamin E) metabolism are two independent consequences of ethanol toxicity in human hepatocytes. Toxicol In Vitro. 2017 Apr;40:124-133.
26	Development of in vitro 3D cell model from hepatocellular carcinoma (HepG2) cell line and its application for genotoxicity testing. Arch Toxicol. 2019 Nov;93(11):3321-3333. doi: 10.1007/s00204-019-02576-6. Epub 2019 Sep 21.
27	Species-specific toxicity of diclofenac and troglitazone in primary human and rat hepatocytes. Chem Biol Interact. 2009 Apr 15;179(1):17-24.
28	Characterization of human cytochrome P450 induction by pesticides. Toxicology. 2012 Mar 29;294(1):17-26.
29	Development of an alternative zebrafish model for drug-induced intestinal toxicity. J Appl Toxicol. 2018 Feb;38(2):259-273. doi: 10.1002/jat.3520. Epub 2017 Oct 13.
30	Menthol reduces the anticoagulant effect of warfarin by inducing cytochrome P450 2C expression. Eur J Pharm Sci. 2014 Jun 2;56:92-101. doi: 10.1016/j.ejps.2014.02.011. Epub 2014 Mar 1.
31	Pyrethroid insecticides: isoform-dependent hydrolysis, induction of cytochrome P450 3A4 and evidence on the involvement of the pregnane X receptor. Toxicol Appl Pharmacol. 2009 May 15;237(1):49-58.
32	Self-assembled 3D spheroids and hollow-fibre bioreactors improve MSC-derived hepatocyte-like cell maturation in vitro. Arch Toxicol. 2017 Apr;91(4):1815-1832.
33	Pharmacotoxicology of clinically-relevant concentrations of obeticholic acid in an organotypic human hepatocyte system. Toxicol In Vitro. 2017 Mar;39:93-103.
34	Nuclear receptor mediated induction of cytochrome P450 3A4 by anticancer drugs: a key role for the pregnane X receptor. Cancer Chemother Pharmacol. 2009 Jun;64(1):35-43.
35	A cell-based reporter gene assay for determining induction of CYP3A4 in a high-volume system. J Pharmacol Exp Ther. 2002 Oct;303(1):412-23.
36	Studies of the toxicological potential of capsinoids, XIII: inhibitory effects of capsaicin and capsinoids on cytochrome P450 3A4 in human liver microsomes. Int J Toxicol. 2010 Mar;29(2 Suppl):22S-6S.
37	Thalidomide increases human hepatic cytochrome P450 3A enzymes by direct activation of the pregnane X receptor. Chem Res Toxicol. 2014 Feb 17;27(2):304-308.
38	Similarities and differences between two modes of antagonism of the thyroid hormone receptor. ACS Chem Biol. 2011 Oct 21;6(10):1096-106.
39	A PXR reporter gene assay in a stable cell culture system: CYP3A4 and CYP2B6 induction by pesticides. Biochem Pharmacol. 2004 Dec 15;68(12):2347-58.
40	Induction of CYP3As in HepG2 cells by several drugs. Association between induction of CYP3A4 and expression of glucocorticoid receptor. Biol Pharm Bull. 2003 Apr;26(4):510-7.
41	Effects of ursodeoxycholic acid on P-glycoprotein and cytochrome P450 3A4-dependent pharmacokinetics in humans. Clin Pharmacol Ther. 2006 May;79(5):449-60.
42	Inhibition of human liver microsomal cytochrome P450 activities by adefovir and tenofovir. Xenobiotica. 2006 Dec;36(12):1165-77.
43	Robustness testing and optimization of an adverse outcome pathway on cholestatic liver injury. Arch Toxicol. 2020 Apr;94(4):1151-1172. doi: 10.1007/s00204-020-02691-9. Epub 2020 Mar 10.
44	Chenodeoxycholic acid significantly impacts the expression of miRNAs and genes involved in lipid, bile acid and drug metabolism in human hepatocytes. Life Sci. 2016 Jul 1;156:47-56.
45	Intestinal and hepatic CYP3A4 catalyze hydroxylation of 1alpha,25-dihydroxyvitamin D(3): implications for drug-induced osteomalacia. Mol Pharmacol. 2006 Jan;69(1):56-65.
46	Functional expression and comparative characterization of nine murine cytochromes P450 by fluorescent inhibition screening. Drug Metab Dispos. 2008 Jul;36(7):1322-31.
47	Comparison of immortalized Fa2N-4 cells and human hepatocytes as in vitro models for cytochrome P450 induction. Drug Metab Dispos. 2008 Jun;36(6):1046-55.
48	Acetylated deoxycholic (DCA) and cholic (CA) acids are potent ligands of pregnane X (PXR) receptor. Toxicol Lett. 2017 Jan 4;265:86-96.
49	Warfarin calcifies human aortic valve interstitial cells at high-phosphate conditions via pregnane X receptor. J Bone Miner Metab. 2019 Nov;37(6):944-956. doi: 10.1007/s00774-019-01001-3. Epub 2019 Apr 8.
50	Investigation of Orlistat effects on PXR activation and CYP3A4 expression in primary human hepatocytes and human intestinal LS174T cells. Eur J Pharm Sci. 2010 Oct 9;41(2):276-80. doi: 10.1016/j.ejps.2010.06.019. Epub 2010 Jul 3.
51	Effect of glutathione on homo- and heterotropic cooperativity in cytochrome P450 3A4. Arch Biochem Biophys. 2008 Mar 15;471(2):134-45. doi: 10.1016/j.abb.2008.01.001. Epub 2008 Jan 11.
52	The inhibitory effect of polyunsaturated fatty acids on human CYP enzymes. Life Sci. 2006 Nov 25;79(26):2432-40.
53	Prediction of crizotinib-midazolam interaction using the Simcyp population-based simulator: comparison of CYP3A time-dependent inhibition between human liver microsomes versus hepatocytes. Drug Metab Dispos. 2013 Feb;41(2):343-52.
54	Methadone, ciprofloxacin, and adverse drug reactions. Lancet. 2000 Dec 16;356(9247):2069-70.
55	A comprehensive in vitro and in silico analysis of antibiotics that activate pregnane X receptor and induce CYP3A4 in liver and intestine. Drug Metab Dispos. 2008 Aug;36(8):1689-97.
56	Comparison of information on the pharmacokinetic interactions of Ca antagonists in the package inserts from three countries (Japan, USA and UK). Eur J Clin Pharmacol. 2005 Aug;61(7):531-6.
57	Mitotane induces CYP3A4 expression via activation of the steroid and xenobiotic receptor. J Endocrinol. 2013 Feb 15;216(3):297-305.
58	Bioactivation of nevirapine to a reactive quinone methide: implications for liver injury. Chem Res Toxicol. 2012 Aug 20;25(8):1708-19. doi: 10.1021/tx300172s. Epub 2012 Jul 26.
59	Inhibition of cytochrome P450 enzymes participating in p-nitrophenol hydroxylation by drugs known as CYP2E1 inhibitors. Chem Biol Interact. 2004 Apr 15;147(3):331-40.
60	Mechanism-based inactivation of CYP3A by HIV protease inhibitors. J Pharmacol Exp Ther. 2005 Feb;312(2):583-91.
61	Teriflunomide is an indirect human constitutive androstane receptor (CAR) activator interacting with epidermal growth factor (EGF) signaling. Front Pharmacol. 2018 Oct 11;9:993.
62	Cytoskeleton interruption in human hepatoma HepG2 cells induced by ketamine occurs possibly through suppression of calcium mobilization and mitochondrial function. Drug Metab Dispos. 2009 Jan;37(1):24-31.
63	Expression and regulation of the bile acid transporter, OSTalpha-OSTbeta in rat and human intestine and liver. Biopharm Drug Dispos. 2009 Jul;30(5):241-58.
64	Cetirizine and loratadine-based antihistamines with 5-lipoxygenase inhibitory activity. Bioorg Med Chem Lett. 2004 Nov 15;14(22):5591-4.
65	Photochemotherapeutic agent 8-methoxypsoralen induces cytochrome P450 3A4 and carboxylesterase HCE2: evidence on an involvement of the pregnane X receptor. Toxicol Sci. 2007 Jan;95(1):13-22.
66	Identification of novel agonists by high-throughput screening and molecular modelling of human constitutive androstane receptor isoform 3. Arch Toxicol. 2019 Aug;93(8):2247-2264. doi: 10.1007/s00204-019-02495-6. Epub 2019 Jul 16.
67	Measurement of cytochrome P450 gene induction in human hepatocytes using quantitative real-time reverse transcriptase-polymerase chain reaction. Drug Metab Dispos. 2000 Jul;28(7):781-8.
68	Development of a strategy to identify and evaluate direct and indirect activators of constitutive androstane receptor in rats. Food Chem Toxicol. 2022 Dec;170:113510. doi: 10.1016/j.fct.2022.113510. Epub 2022 Nov 8.
69	Comparative effects of fibrates on drug metabolizing enzymes in human hepatocytes. Pharm Res. 2005 Jan;22(1):71-8.
70	Optical isomers of dihydropyridine calcium channel blockers display enantiospecific effects on the expression and enzyme activities of human xenobiotics-metabolizing cytochromes P450. Toxicol Lett. 2016 Nov 16;262:173-186.
71	Azole antimycotics differentially affect rifampicin-induced pregnane X receptor-mediated CYP3A4 gene expression. Drug Metab Dispos. 2008 Feb;36(2):339-48.
72	The inhaled glucocorticoid fluticasone propionate efficiently inactivates cytochrome P450 3A5, a predominant lung P450 enzyme. Chem Res Toxicol. 2010 Aug 16;23(8):1356-64.
73	Bioactivation of the tricyclic antidepressant amitriptyline and its metabolite nortriptyline to arene oxide intermediates in human liver microsomes and recombinant P450s. Chem Biol Interact. 2008 May 9;173(1):59-67.
74	Mechanism of interactions of alpha-naphthoflavone with cytochrome P450 3A4 explored with an engineered enzyme bearing a fluorescent probe. Biochemistry. 2007 Jan 9;46(1):106-19. doi: 10.1021/bi061944p.
75	mRNA transfection retrofits cell-based assays with xenobiotic metabolism. J Pharmacol Toxicol Methods. 2018 Jul-Aug;92:77-94. doi: 10.1016/j.vascn.2018.03.002. Epub 2018 Mar 16.
76	Concise prediction models of anticancer efficacy of 8 drugs using expression data from 12 selected genes. Int J Cancer. 2004 Sep 10;111(4):617-26. doi: 10.1002/ijc.20289.
77	The involvement of CYP3A4 and CYP2C9 in the metabolism of 17 alpha-ethinylestradiol. Drug Metab Dispos. 2004 Nov;32(11):1209-12.
78	Contribution of CYP3A5 to hepatic and renal ifosfamide N-dechloroethylation. Drug Metab Dispos. 2005 Jul;33(7):1074-81. doi: 10.1124/dmd.104.002279. Epub 2005 Apr 8.
79	Epoxidation of the methamphetamine pyrolysis product, trans-phenylpropene, to trans-phenylpropylene oxide by CYP enzymes and stereoselective glutathione adduct formation. Toxicol Appl Pharmacol. 2006 Mar 1;211(2):148-56. doi: 10.1016/j.taap.2005.06.017. Epub 2005 Jul 20.
80	Participation of CYP2C8 and CYP3A4 in the N-demethylation of imatinib in human hepatic microsomes. Br J Pharmacol. 2010 Nov;161(5):1059-69. doi: 10.1111/j.1476-5381.2010.00946.x.
81	Combined Docking and Quantum Chemical Study on CYP-Mediated Metabolism of Estrogens in Man. Chem Res Toxicol. 2017 Feb 20;30(2):583-594. doi: 10.1021/acs.chemrestox.6b00330. Epub 2016 Dec 14.
82	ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
83	Development of a highly sensitive cytotoxicity assay system for CYP3A4-mediated metabolic activation. Drug Metab Dispos. 2011 Aug;39(8):1388-95. doi: 10.1124/dmd.110.037077. Epub 2011 May 3.
84	Contribution of CYP3A5 to the in vitro hepatic clearance of tacrolimus. Clin Chem. 2005 Aug;51(8):1374-81.
85	Variability of CYP3A7 expression in human fetal liver. J Pharmacol Exp Ther. 2005 Aug;314(2):626-35. doi: 10.1124/jpet.105.086504. Epub 2005 Apr 21.
86	Comparative study of the oxidation of propranolol enantiomers in hepatic and small intestinal microsomes from cynomolgus and marmoset monkeys. Chem Biol Interact. 2010 Jan 5;183(1):67-78. doi: 10.1016/j.cbi.2009.10.007.
87	Human glutathione S-transferases- and NAD(P)H:quinone oxidoreductase 1-catalyzed inactivation of reactive quinoneimines of amodiaquine and N-desethylamodiaquine: possible implications for susceptibility to amodiaquine-induced liver toxicity. Toxicol Lett. 2017 Jun 5;275:83-91.
88	Cytochrome P450-mediated bioactivation of mefenamic acid to quinoneimine intermediates and inactivation by human glutathione S-transferases. Chem Res Toxicol. 2014 Dec 15;27(12):2071-81.
89	Identification of three cytochrome P450 isozymes involved in N-demethylation of citalopram enantiomers in human liver microsomes. Pharmacogenetics. 1997 Feb;7(1):1-10.
90	Human cytochrome P450 oxidation of 5-hydroxythalidomide and pomalidomide, an amino analogue of thalidomide. Chem Res Toxicol. 2014 Jan 21;27(1):147-56. doi: 10.1021/tx4004215. Epub 2013 Dec 24.
91	Human cytochrome P450 kinetic studies on six N-2-methoxybenzyl (NBOMe)-derived new psychoactive substances using the substrate depletion approach. Toxicol Lett. 2018 Mar 15;285:1-8. doi: 10.1016/j.toxlet.2017.12.017. Epub 2017 Dec 23.
92	The effect of mild and moderate hepatic impairment on the pharmacokinetics of valdecoxib, a selective COX-2 inhibitor. Eur J Clin Pharmacol. 2005 Jun;61(4):247-56.
93	Bioactivation of lamotrigine in vivo in rat and in vitro in human liver microsomes, hepatocytes, and epidermal keratinocytes: characterization of thioether conjugates by liquid chromatography/mass spectrometry and high field nuclear magnetic resonance spectroscopy. Chem Res Toxicol. 2010 Jan;23(1):159-70. doi: 10.1021/tx9003243.
94	The role of hepatic cytochrome P450s in the cytotoxicity of dronedarone. Arch Toxicol. 2018 Jun;92(6):1969-1981. doi: 10.1007/s00204-018-2196-x. Epub 2018 Apr 3.
95	Polymorphisms of drug-metabolizing enzymes (GST, CYP2B6 and CYP3A) affect the pharmacokinetics of thiotepa and tepa. Br J Clin Pharmacol. 2009 Jan;67(1):50-60. doi: 10.1111/j.1365-2125.2008.03321.x. Epub 2008 Nov 17.
96	Deactivation of anti-cancer drug letrozole to a carbinol metabolite by polymorphic cytochrome P450 2A6 in human liver microsomes. Xenobiotica. 2009 Nov;39(11):795-802. doi: 10.3109/00498250903171395.
97	Relationship between response to risperidone, plasma concentrations of risperidone and CYP3A4 polymorphisms in schizophrenia patients. J Psychopharmacol. 2010 Jul;24(7):1115-20. doi: 10.1177/0269881109104932. Epub 2009 Apr 24.
98	Cytochrome P450 enzymes involved in metoprolol metabolism and use of metoprolol as a CYP2D6 phenotyping probe drug. Front Pharmacol. 2018 Jul 24;9:774.
99	Metabolite profiling and reaction phenotyping for the in vitro assessment of the bioactivation of bromfenac. Chem Res Toxicol. 2020 Jan 21;33(1):249-257.
100	O-demethylation of epipodophyllotoxins is catalyzed by human cytochrome P450 3A4. Mol Pharmacol. 1994 Feb;45(2):352-8.
101	Evidence of significant contribution from CYP3A5 to hepatic drug metabolism. Drug Metab Dispos. 2004 Dec;32(12):1434-45. doi: 10.1124/dmd.104.001313. Epub 2004 Sep 21.
102	Catalytic activities of human liver cytochrome P-450 IIIA4 expressed in Saccharomyces cerevisiae. Biochemistry. 1990 Dec 25;29(51):11280-92.
103	Identification of the human liver enzymes involved in the metabolism of the antimigraine agent almotriptan. Drug Metab Dispos. 2003 Apr;31(4):404-11.
104	CYP3A4 is a human microsomal vitamin D 25-hydroxylase. J Bone Miner Res. 2004 Apr;19(4):680-8.
105	Evaluation of Recombinant CYP3A4 Variants on the Metabolism of Oxycodone In Vitro. Chem Res Toxicol. 2021 Jan 18;34(1):103-109. doi: 10.1021/acs.chemrestox.0c00361. Epub 2021 Jan 4.
106	Identification of human cytochrome P450 enzymes involved in the formation of 4-hydroxyestazolam from estazolam. Xenobiotica. 2005 May;35(5):455-65.
107	Cytochrome P-450 enzymes and FMO3 contribute to the disposition of the antipsychotic drug perazine in vitro. Psychopharmacology (Berl). 2000 Sep;151(4):312-20.
108	The relative role of CYP3A4 and CYP3A5 in eplerenone metabolism. Toxicol Lett. 2019 Oct 15;315:9-13.
109	Sunitinib-induced hypertension in CYP3A4 rs4646437 A-allele carriers with metastatic renal cell carcinoma. Pharmacogenomics J. 2017 Jan;17(1):42-46. doi: 10.1038/tpj.2015.100. Epub 2016 Jan 26.
110	Mechanism-Based Inactivation of Cytochrome P450 3A4 and 3A5 by the Fibroblast Growth Factor Receptor Inhibitor Erdafitinib. Chem Res Toxicol. 2021 Jul 19;34(7):1800-1813. doi: 10.1021/acs.chemrestox.1c00178. Epub 2021 Jun 30.
111	Kinetic characterization and identification of the enzymes responsible for the hepatic biotransformation of adinazolam and N-desmethyladinazolam in man. J Pharm Pharmacol. 1998 Mar;50(3):265-74.
112	In vitro identification of the human cytochrome p450 enzymes involved in the oxidative metabolism of loxapine. Biopharm Drug Dispos. 2011 Oct;32(7):398-407.
113	Metabolism of MK-0524, a prostaglandin D2 receptor 1 antagonist, in microsomes and hepatocytes from preclinical species and humans. Drug Metab Dispos. 2007 Feb;35(2):283-92. doi: 10.1124/dmd.106.011551. Epub 2006 Nov 28.
114	Cytochromes P450 2C8 and 3A Catalyze the Metabolic Activation of the Tyrosine Kinase Inhibitor Masitinib. Chem Res Toxicol. 2022 Sep 19;35(9):1467-1481. doi: 10.1021/acs.chemrestox.2c00057. Epub 2022 Sep 1.
115	Human hepatic metabolism of the anti-osteoporosis drug eldecalcitol involves sterol C4-methyl oxidase. Pharmacol Res Perspect. 2015 Mar;3(2):e00120.
116	Characterization of the cytochrome P-450 gene family responsible for the N-dealkylation of the ergot alkaloid CQA 206-291 in humans. Drug Metab Dispos. 1992 Jan-Feb;20(1):56-63.
117	The formation of estrogen-like tamoxifen metabolites and their influence on enzyme activity and gene expression of ADME genes. Arch Toxicol. 2018 Mar;92(3):1099-1112.
118	Interindividual variation in relative CYP1A2/3A4 phenotype influences susceptibility of clozapine oxidation to cytochrome P450-specific inhibition in human hepatic microsomes. Drug Metab Dispos. 2008 Dec;36(12):2547-55. doi: 10.1124/dmd.108.023671. Epub 2008 Sep 22.
119	Identification of Quinone Methide Intermediate Resulting from Metabolic Activation of Icaritin in Vitro and in Vivo. Chem Res Toxicol. 2019 Jun 17;32(6):969-973. doi: 10.1021/acs.chemrestox.8b00418. Epub 2019 Apr 9.
120	Cytochrome P450 Mediated Bioactivation of Saracatinib. Chem Res Toxicol. 2016 Nov 21;29(11):1835-1842. doi: 10.1021/acs.chemrestox.6b00242. Epub 2016 Nov 3.
121	Functional assessment of the effects of CYP3A4 variants on acalabrutinib metabolism in vitro. Chem Biol Interact. 2021 Aug 25;345:109559. doi: 10.1016/j.cbi.2021.109559. Epub 2021 Jun 18.
122	Pulmonary toxicity and metabolic activation of tetrandrine in CD-1 mice. Chem Res Toxicol. 2011 Dec 19;24(12):2142-52. doi: 10.1021/tx200290s. Epub 2011 Nov 11.
123	Cytochromes P450 1A2 and 3A4 Catalyze the Metabolic Activation of Sunitinib. Chem Res Toxicol. 2018 Jul 16;31(7):570-584. doi: 10.1021/acs.chemrestox.8b00005. Epub 2018 Jun 18.
124	Identification of human P450 isoforms involved in the metabolism of the antiallergic drug, oxatomide, and its kinetic parameters and inhibition constants. Biol Pharm Bull. 2005 Feb;28(2):328-34.
125	Cytochrome P450 Involvement in the biotransformation of cisapride and racemic norcisapride in vitro: differential activity of individual human CYP3A isoforms. Drug Metab Dispos. 2001 Dec;29(12):1548-54.
126	Metabolism of vanoxerine, 1-[2-[bis(4-fluorophenyl)methoxy]ethyl]-4-(3-phenylpropyl)piperazine, by human cytochrome P450 enzymes. Drug Metab Dispos. 2001 Sep;29(9):1216-20.
127	Identification of human liver cytochrome P450 enzymes involved in the metabolism of SCH 351125, a CCR5 antagonist. Xenobiotica. 2005 May;35(5):405-17. doi: 10.1080/00498250500136569.
128	Antitumor activity of methoxymorpholinyl doxorubicin: potentiation by cytochrome P450 3A metabolism. Mol Pharmacol. 2005 Jan;67(1):212-9. doi: 10.1124/mol.104.005371. Epub 2004 Oct 1.
129	Chemical Reactivity of Aloe-Emodin and Its Hydroxylation Metabolites to Thiols. Chem Res Toxicol. 2019 Feb 18;32(2):234-244. doi: 10.1021/acs.chemrestox.8b00248. Epub 2019 Feb 6.
130	Chemical and Enzymatic Transformations of Nimesulide to GSH Conjugates through Reductive and Oxidative Mechanisms. Chem Res Toxicol. 2015 Dec 21;28(12):2267-77. doi: 10.1021/acs.chemrestox.5b00290. Epub 2015 Nov 12.
131	In vitro metabolism of helenalin and its inhibitory effect on human cytochrome P450 activity. Arch Toxicol. 2022 Mar;96(3):793-808. doi: 10.1007/s00204-021-03218-6. Epub 2022 Jan 6.
132	Mechanism of inactivation of human cytochrome P450 2B6 by phencyclidine. Drug Metab Dispos. 2006 Sep;34(9):1523-9. doi: 10.1124/dmd.106.010579. Epub 2006 Jun 16.
133	CYP3A4 activity reduces the cytotoxic effects of okadaic acid in HepaRG cells. Arch Toxicol. 2014 Aug;88(8):1519-26. doi: 10.1007/s00204-014-1206-x. Epub 2014 Feb 7.
134	Consequences of genetic polymorphisms for sirolimus requirements after renal transplant in patients on primary sirolimus therapy. Am J Transplant. 2005 Mar;5(3):595-603.
135	Identification of human cytochrome P450 isoforms that contribute to all-trans-retinoic acid 4-hydroxylation. Biochem Pharmacol. 2000 Aug 15;60(4):517-26. doi: 10.1016/s0006-2952(00)00356-7.
136	Comparative metabolism of the tobacco-related carcinogens benzo[a]pyrene, 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone, 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanol, and N'- nitrosonornicotine in human hepatic microsomes. Drug Metab Dispos. 1997 Feb;25(2):154-62.
137	Acetaminophen reactive intermediates target hepatic thioredoxin reductase. Chem Res Toxicol. 2014 May 19;27(5):882-94. doi: 10.1021/tx5000443. Epub 2014 Apr 4.
138	Human variation in CYP-specific chlorpyrifos metabolism. Toxicology. 2010 Oct 29;276(3):184-91. doi: 10.1016/j.tox.2010.08.005. Epub 2010 Aug 13.
139	Cytochrome P450 mediated metabolic activation of chrysophanol. Chem Biol Interact. 2018 Jun 1;289:57-67. doi: 10.1016/j.cbi.2018.04.015. Epub 2018 Apr 24.
140	Ellipticine oxidation and DNA adduct formation in human hepatocytes is catalyzed by human cytochromes P450 and enhanced by cytochrome b5. Toxicology. 2012 Dec 16;302(2-3):233-41. doi: 10.1016/j.tox.2012.08.004. Epub 2012 Aug 16.
141	Foetal and adult human CYP3A isoforms in the bioactivation of organophosphorothionate insecticides. Toxicol Lett. 2006 Dec 15;167(3):245-55. doi: 10.1016/j.toxlet.2006.10.006. Epub 2006 Oct 24.
142	Inhibition of the human liver microsomal and human cytochrome P450 1A2 and 3A4 metabolism of estradiol by deployment-related and other chemicals. Drug Metab Dispos. 2006 Sep;34(9):1606-14.
143	Metabolism of 1,8-cineole by human cytochrome P450 enzymes: identification of a new hydroxylated metabolite. Biochim Biophys Acta. 2005 Apr 15;1722(3):304-11. doi: 10.1016/j.bbagen.2004.12.019. Epub 2005 Jan 17.
144	The oxidative metabolism of dimemorfan by human cytochrome P450 enzymes. J Pharm Sci. 2010 Feb;99(2):1063-77.
145	Novel insights into bile acid detoxification via CYP, UGT and SULT enzymes. Toxicol In Vitro. 2023 Mar;87:105533. doi: 10.1016/j.tiv.2022.105533. Epub 2022 Dec 5.
146	Studies on the metabolism of the novel, selective cyclooxygenase-2 inhibitor indomethacin phenethylamide in rat, mouse, and human liver microsomes: identification of active metabolites. Drug Metab Dispos. 2004 Jan;32(1):113-22.
147	Structure-dependent genotoxic potencies of selected pyrrolizidine alkaloids in metabolically competent HepG2 cells. Arch Toxicol. 2020 Dec;94(12):4159-4172. doi: 10.1007/s00204-020-02895-z. Epub 2020 Sep 10.
148	Expression of the human CYP3A4 gene in the small intestine of transgenic mice: in vitro metabolism and pharmacokinetics of midazolam. Drug Metab Dispos. 2003 May;31(5):548-58. doi: 10.1124/dmd.31.5.548.