Details of the Drug

General Information of Drug (ID: DMU8KOD)

Drug Name

Anakinra

Synonyms

Kineret; Kineret (TN); Anakinra (USAN/INN)

Indication

Disease Entry	ICD 11	Status	REF
Rheumatoid arthritis	FA20	Approved	[1]
Coronavirus Disease 2019 (COVID-19)	1D6Y	Phase 3	[2]
CINCA syndrome	N.A.	Investigative	[3]
------------------------------------------------------------------------------------

Therapeutic Class

Antiinflammatory Agents

Sequence

MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLG
IHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGW
FLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

Cross-matching ID

DrugBank ID: DB00026
TTD ID: D02DES

Repurposed Drugs (RPD)

Click to Jump to the Detailed RPD Information of This Drug

Molecular Interaction Atlas of This Drug

Drug Therapeutic Target (DTT)

DTT Name	DTT ID	UniProt ID	MOA	REF
Interleukin 1 receptor type 1 (IL1R1)	TTWOTEA	IL1R1_HUMAN	Antagonist	[4]
HUMAN interleukin-1 receptor 1 (IL1R1)	TTT7FOP	IL1R1_HUMAN	Antagonist	[5]

------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

ICD Disease Classification

15 Disease of the musculoskeletal system/connective tissue

Disease Class

ICD-11: FA20 Rheumatoid arthritis

The Studied Tissue

Synovial tissue

The Studied Disease

Rheumatoid arthritis [ICD-11:FA20]

Molecule Name	Molecule Type	Gene Name	p-value	Fold-Change	Z-score
Interleukin 1 receptor type 1 (IL1R1)	DTT	IL1R1	2.02E-03	0.65	1.01

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Same Disease as Anakinra

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Disease	REF
Upadacitinib	DM32B5U	Major	Additive immunosuppressive effects by the combination of Anakinra and Upadacitinib.	Rheumatoid arthritis [FA20]	[6]
Golimumab	DMHZV7X	Major	Additive immunosuppressive effects by the combination of Anakinra and Golimumab.	Rheumatoid arthritis [FA20]	[6]
Dexamethasone	DMMWZET	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Dexamethasone.	Rheumatoid arthritis [FA20]	[7]
Adalimumab	DMQMV1B	Major	Additive immunosuppressive effects by the combination of Anakinra and Adalimumab.	Rheumatoid arthritis [FA20]	[6]
Abatacept	DMSA8RU	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Abatacept.	Rheumatoid arthritis [FA20]	[7]
-----------

Coadministration of a Drug Treating the Disease Different from Anakinra (Comorbidity)

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Comorbidity	REF
Thioguanine	DM7NKEV	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Thioguanine.	Acute myeloid leukaemia [2A60]	[7]
Uracil mustard	DMHL7OB	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Uracil mustard.	Acute myeloid leukaemia [2A60]	[7]
Midostaurin	DMI6E0R	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Midostaurin.	Acute myeloid leukaemia [2A60]	[7]
Gemtuzumab ozogamicin	DMJ2O7B	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Gemtuzumab ozogamicin.	Acute myeloid leukaemia [2A60]	[7]
Idarubicin	DMM0XGL	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Idarubicin.	Acute myeloid leukaemia [2A60]	[7]
Daunorubicin	DMQUSBT	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Daunorubicin.	Acute myeloid leukaemia [2A60]	[7]
Oliceridine	DM6MDCF	Moderate	Altered metabolism of Anakinra due to Oliceridine alters the formation of CYP450 enzymes.	Acute pain [MG31]	[6]
Siltuximab	DMGEATB	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Siltuximab.	Anemia [3A00-3A9Z]	[7]
Nifedipine	DMSVOZT	Moderate	Altered metabolism of Anakinra due to Nifedipine alters the formation of CYP450 enzymes.	Angina pectoris [BA40]	[6]
Alprazolam	DMC7XDN	Moderate	Altered metabolism of Anakinra due to Alprazolam alters the formation of CYP450 enzymes.	Anxiety disorder [6B00-6B0Z]	[6]
Methylphenobarbital	DMDSWAG	Moderate	Altered metabolism of Anakinra due to Methylphenobarbital alters the formation of CYP450 enzymes.	Anxiety disorder [6B00-6B0Z]	[8]
Clobazam - Lundbeck	DMW1OQ0	Moderate	Altered metabolism of Anakinra due to Clobazam - Lundbeck alters the formation of CYP450 enzymes.	Anxiety disorder [6B00-6B0Z]	[6]
Budesonide	DMJIBAW	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Budesonide.	Asthma [CA23]	[7]
Aminophylline	DML2NIB	Moderate	Altered metabolism of Anakinra due to Aminophylline alters the formation of CYP450 enzymes.	Asthma [CA23]	[6]
Roflumilast	DMPGHY8	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Roflumilast.	Asthma [CA23]	[6]
Dupilumab	DMOAD2Y	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Dupilumab.	Atopic eczema [EA80]	[7]
Linezolid	DMGFPU2	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Linezolid.	Bacterial infection [1A00-1C4Z]	[7]
Temozolomide	DMKECZD	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Temozolomide.	Brain cancer [2A00]	[7]
Lomustine	DMMWSUL	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Lomustine.	Brain cancer [2A00]	[7]
Eribulin	DM1DX4Q	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Eribulin.	Breast cancer [2C60-2C6Y]	[7]
Talazoparib	DM1KS78	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Talazoparib.	Breast cancer [2C60-2C6Y]	[7]
Ixabepilone	DM2OZ3G	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Ixabepilone.	Breast cancer [2C60-2C6Y]	[7]
LY2835219	DM93VBZ	Moderate	Additive immunosuppressive effects by the combination of Anakinra and LY2835219.	Breast cancer [2C60-2C6Y]	[7]
Pralatrexate	DMAO80I	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Pralatrexate.	Breast cancer [2C60-2C6Y]	[7]
Palbociclib	DMD7L94	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Palbociclib.	Breast cancer [2C60-2C6Y]	[7]
Mitomycin	DMH0ZJE	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Mitomycin.	Breast cancer [2C60-2C6Y]	[7]
Thiotepa	DMIZKOP	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Thiotepa.	Breast cancer [2C60-2C6Y]	[7]
Cabazitaxel	DMPAZHC	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Cabazitaxel.	Breast cancer [2C60-2C6Y]	[7]
Bosutinib	DMTI8YE	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Bosutinib.	Breast cancer [2C60-2C6Y]	[7]
Trastuzumab	DMZQOUX	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Trastuzumab.	Breast cancer [2C60-2C6Y]	[7]
Atorvastatin	DMF28YC	Moderate	Altered metabolism of Anakinra due to Atorvastatin alters the formation of CYP450 enzymes.	Cardiovascular disease [BA00-BE2Z]	[6]
Corticotropin	DMP9TWZ	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Corticotropin.	Chronic kidney disease [GB61]	[7]
Irinotecan	DMP6SC2	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Irinotecan.	Colorectal cancer [2B91]	[7]
Oxaliplatin	DMQNWRD	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Oxaliplatin.	Colorectal cancer [2B91]	[7]
Aflibercept	DMT3D5I	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Aflibercept.	Colorectal cancer [2B91]	[7]
Capecitabine	DMTS85L	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Capecitabine.	Colorectal cancer [2B91]	[7]
Drospirenone	DM1A9W3	Moderate	Altered metabolism of Anakinra due to Drospirenone alters the formation of CYP450 enzymes.	Contraceptive management [QA21]	[6]
Levonorgestrel	DM1DP7T	Moderate	Altered metabolism of Anakinra due to Levonorgestrel alters the formation of CYP450 enzymes.	Contraceptive management [QA21]	[6]
Mestranol	DMG3F94	Moderate	Altered metabolism of Anakinra due to Mestranol alters the formation of CYP450 enzymes.	Contraceptive management [QA21]	[8]
Etonogestrel	DMKA8J4	Moderate	Altered metabolism of Anakinra due to Etonogestrel alters the formation of CYP450 enzymes.	Contraceptive management [QA21]	[6]
Norgestimate	DMYP4XC	Moderate	Altered metabolism of Anakinra due to Norgestimate alters the formation of CYP450 enzymes.	Contraceptive management [QA21]	[8]
Lidocaine	DML4ZOT	Moderate	Altered metabolism of Anakinra due to Lidocaine alters the formation of CYP450 enzymes.	Corneal disease [9A76-9A78]	[6]
Nimodipine	DMQ0RKZ	Moderate	Altered metabolism of Anakinra due to Nimodipine alters the formation of CYP450 enzymes.	Coronary vasospastic disease [BA85]	[6]
Oxtriphylline	DMLHSE3	Moderate	Altered metabolism of Anakinra due to Oxtriphylline alters the formation of CYP450 enzymes.	Cough [MD12]	[6]
Methadone	DMTW6IU	Moderate	Altered metabolism of Anakinra due to Methadone alters the formation of CYP450 enzymes.	Cough [MD12]	[6]
Mycophenolic acid	DMRBMAU	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Mycophenolic acid.	Crohn disease [DD70]	[7]
Rivaroxaban	DMQMBZ1	Moderate	Altered metabolism of Anakinra due to Rivaroxaban alters the formation of CYP450 enzymes.	Deep vein thrombosis [BD71]	[6]
Polatuzumab vedotin	DMF6Y0L	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Polatuzumab vedotin.	Diffuse large B-cell lymphoma [2A81]	[7]
Axicabtagene ciloleucel	DMYHN59	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Axicabtagene ciloleucel.	Diffuse large B-cell lymphoma [2A81]	[7]
PMID28870136-Compound-48	DMPIM9L	Moderate	Altered metabolism of Anakinra due to PMID28870136-Compound-48 alters the formation of CYP450 enzymes.	Discovery agent [N.A.]	[6]
Oestradiol valerate and dienogest	DMZK0FQ	Moderate	Altered metabolism of Anakinra due to Oestradiol valerate and dienogest alters the formation of CYP450 enzymes.	Endometriosis [GA10]	[8]
Diazepam	DM08E9O	Moderate	Altered metabolism of Anakinra due to Diazepam alters the formation of CYP450 enzymes.	Epilepsy/seizure [8A61-8A6Z]	[6]
Primidone	DM0WX6I	Moderate	Altered metabolism of Anakinra due to Primidone alters the formation of CYP450 enzymes.	Epilepsy/seizure [8A61-8A6Z]	[6]
Mephenytoin	DM5UGDK	Moderate	Altered metabolism of Anakinra due to Mephenytoin alters the formation of CYP450 enzymes.	Epilepsy/seizure [8A61-8A6Z]	[6]
Ethosuximide	DMDZ9LT	Moderate	Altered metabolism of Anakinra due to Ethosuximide alters the formation of CYP450 enzymes.	Epilepsy/seizure [8A61-8A6Z]	[6]
Phenytoin	DMNOKBV	Moderate	Altered metabolism of Anakinra due to Phenytoin alters the formation of CYP450 enzymes.	Epilepsy/seizure [8A61-8A6Z]	[6]
Fosphenytoin	DMOX3LB	Moderate	Altered metabolism of Anakinra due to Fosphenytoin alters the formation of CYP450 enzymes.	Epilepsy/seizure [8A61-8A6Z]	[6]
Clonazepam	DMTO13J	Moderate	Altered metabolism of Anakinra due to Clonazepam alters the formation of CYP450 enzymes.	Epilepsy/seizure [8A61-8A6Z]	[6]
Phenobarbital	DMXZOCG	Moderate	Altered metabolism of Anakinra due to Phenobarbital alters the formation of CYP450 enzymes.	Epilepsy/seizure [8A61-8A6Z]	[6]
Carbamazepine	DMZOLBI	Moderate	Altered metabolism of Anakinra due to Carbamazepine alters the formation of CYP450 enzymes.	Epilepsy/seizure [8A61-8A6Z]	[6]
Nicardipine	DMCDYW7	Moderate	Altered metabolism of Anakinra due to Nicardipine alters the formation of CYP450 enzymes.	Essential hypertension [BA00]	[6]
Bay 80-6946	DMLOS5R	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Bay 80-6946.	Follicular lymphoma [2A80]	[7]
Avapritinib	DMK2GZX	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Avapritinib.	Gastrointestinal stromal tumour [2B5B]	[7]
177Lu-DOTATATE	DMT8GVU	Moderate	Additive immunosuppressive effects by the combination of Anakinra and 177Lu-DOTATATE.	Hepatitis virus infection [1E50-1E51]	[7]
Procarbazine	DMIK367	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Procarbazine.	Hodgkin lymphoma [2B30]	[7]
Bleomycin	DMNER5S	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Bleomycin.	Hodgkin lymphoma [2B30]	[7]
Brentuximab vedotin	DMWLC57	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Brentuximab vedotin.	Hodgkin lymphoma [2B30]	[7]
Zidovudine	DM4KI7O	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Zidovudine.	Human immunodeficiency virus disease [1C60-1C62]	[7]
Simvastatin	DM30SGU	Moderate	Altered metabolism of Anakinra due to Simvastatin alters the formation of CYP450 enzymes.	Hyper-lipoproteinaemia [5C80]	[6]
Lovastatin	DM9OZWQ	Moderate	Altered metabolism of Anakinra due to Lovastatin alters the formation of CYP450 enzymes.	Hyper-lipoproteinaemia [5C80]	[6]
Nisoldipine	DM7ISKJ	Moderate	Altered metabolism of Anakinra due to Nisoldipine alters the formation of CYP450 enzymes.	Hypertension [BA00-BA04]	[6]
Levamlodipine	DM92S6N	Moderate	Altered metabolism of Anakinra due to Levamlodipine alters the formation of CYP450 enzymes.	Hypertension [BA00-BA04]	[6]
Isradipine	DMA5XGH	Moderate	Altered metabolism of Anakinra due to Isradipine alters the formation of CYP450 enzymes.	Hypertension [BA00-BA04]	[6]
Amlodipine	DMBDAZV	Moderate	Altered metabolism of Anakinra due to Amlodipine alters the formation of CYP450 enzymes.	Hypertension [BA00-BA04]	[6]
Felodipine	DMOSW35	Moderate	Altered metabolism of Anakinra due to Felodipine alters the formation of CYP450 enzymes.	Hypertension [BA00-BA04]	[6]
Fludrocortisone	DMUDIR8	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Fludrocortisone.	Hypo-osmolality/hyponatraemia [5C72]	[7]
Triazolam	DMETYK5	Moderate	Altered metabolism of Anakinra due to Triazolam alters the formation of CYP450 enzymes.	Insomnia [7A00-7A0Z]	[6]
Olaratumab	DMNYOIX	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Olaratumab.	Kaposi sarcoma [2B57]	[7]
Methotrexate	DM2TEOL	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Methotrexate.	Leukaemia [2A60-2B33]	[7]
Nelarabine	DMB6VEG	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Nelarabine.	Leukaemia [2A60-2B33]	[7]
DTI-015	DMXZRW0	Moderate	Additive immunosuppressive effects by the combination of Anakinra and DTI-015.	Liver cancer [2C12]	[7]
Denosumab	DMNI0KO	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Denosumab.	Low bone mass disorder [FB83]	[9]
Brigatinib	DM7W94S	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Brigatinib.	Lung cancer [2C25]	[7]
Lurbinectedin	DMEFRTZ	Moderate	Additive myelosuppressive effects by the combination of Anakinra and Lurbinectedin.	Lung cancer [2C25]	[6]
Osimertinib	DMRJLAT	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Osimertinib.	Lung cancer [2C25]	[7]
Belimumab	DM3OBQF	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Belimumab.	Lupus erythematosus [4A40]	[7]
Inotuzumab ozogamicin	DMAC130	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Inotuzumab ozogamicin.	Malignant haematopoietic neoplasm [2B33]	[7]
Rituximab	DM1YVZT	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Rituximab.	Malignant haematopoietic neoplasm [2B33]	[7]
Tositumomab	DMMYZ3D	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Tositumomab.	Malignant haematopoietic neoplasm [2B33]	[7]
Fludarabine	DMVRLT7	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Fludarabine.	Malignant haematopoietic neoplasm [2B33]	[7]
Pentostatin	DM0HXDS	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Pentostatin.	Mature B-cell leukaemia [2A82]	[7]
Ofatumumab	DM295PR	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Ofatumumab.	Mature B-cell leukaemia [2A82]	[7]
Obinutuzumab	DM3BVAE	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Obinutuzumab.	Mature B-cell leukaemia [2A82]	[7]
Cladribine	DM3JDRP	Major	Additive immunosuppressive effects by the combination of Anakinra and Cladribine.	Mature B-cell leukaemia [2A82]	[6]
Idelalisib	DM602WT	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Idelalisib.	Mature B-cell leukaemia [2A82]	[7]
GDC-0199	DMH0QKA	Moderate	Additive immunosuppressive effects by the combination of Anakinra and GDC-0199.	Mature B-cell leukaemia [2A82]	[7]
Chlorambucil	DMRKE63	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Chlorambucil.	Mature B-cell leukaemia [2A82]	[7]
IPI-145	DMWA24P	Moderate	Additive immunosuppressive effects by the combination of Anakinra and IPI-145.	Mature B-cell leukaemia [2A82]	[7]
Alemtuzumab	DMZL3IV	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Alemtuzumab.	Mature B-cell leukaemia [2A82]	[10]
Acalabrutinib	DM7GCVW	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Acalabrutinib.	Mature B-cell lymphoma [2A85]	[7]
Clofarabine	DMCVJ86	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Clofarabine.	Mature B-cell lymphoma [2A85]	[7]
Blinatumomab	DMGECIJ	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Blinatumomab.	Mature B-cell lymphoma [2A85]	[7]
Ibrutinib	DMHZCPO	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Ibrutinib.	Mature B-cell lymphoma [2A85]	[7]
Vincristine	DMINOX3	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Vincristine.	Mature B-cell lymphoma [2A85]	[6]
Teniposide	DMLW57T	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Teniposide.	Mature B-cell lymphoma [2A85]	[7]
Tisagenlecleucel	DMM9BJD	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Tisagenlecleucel.	Mature B-cell lymphoma [2A85]	[7]
Mercaptopurine	DMTM2IK	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Mercaptopurine.	Mature B-cell lymphoma [2A85]	[7]
Ponatinib	DMYGJQO	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Ponatinib.	Mature B-cell lymphoma [2A85]	[7]
Cytarabine	DMZD5QR	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Cytarabine.	Mature B-cell lymphoma [2A85]	[7]
Mechlorethamine	DM0CVXA	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Mechlorethamine.	Mature T-cell lymphoma [2A90]	[7]
Dacarbazine	DMNPZL4	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Dacarbazine.	Melanoma [2C30]	[7]
Ethinyl estradiol	DMODJ40	Moderate	Altered metabolism of Anakinra due to Ethinyl estradiol alters the formation of CYP450 enzymes.	Menopausal disorder [GA30]	[8]
Midazolam	DMXOELT	Moderate	Altered metabolism of Anakinra due to Midazolam alters the formation of CYP450 enzymes.	Mood/affect symptom [MB24]	[6]
Carfilzomib	DM48K0X	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Carfilzomib.	Multiple myeloma [2A83]	[7]
Panobinostat	DM58WKG	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Panobinostat.	Multiple myeloma [2A83]	[7]
Lenalidomide	DM6Q7U4	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Lenalidomide.	Multiple myeloma [2A83]	[7]
Thalidomide	DM70BU5	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Thalidomide.	Multiple myeloma [2A83]	[7]
Selinexor	DMBD4K3	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Selinexor.	Multiple myeloma [2A83]	[7]
Belantamab mafodotin	DMBT3AI	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Belantamab mafodotin.	Multiple myeloma [2A83]	[7]
Elotuzumab	DMEYHG9	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Elotuzumab.	Multiple myeloma [2A83]	[7]
Daratumumab	DMKCIUZ	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Daratumumab.	Multiple myeloma [2A83]	[7]
Bortezomib	DMNO38U	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Bortezomib.	Multiple myeloma [2A83]	[7]
Melphalan	DMOLNHF	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Melphalan.	Multiple myeloma [2A83]	[7]
Tecfidera	DM2OVDT	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Tecfidera.	Multiple sclerosis [8A40]	[7]
Siponimod	DM2R86O	Major	Additive immunosuppressive effects by the combination of Anakinra and Siponimod.	Multiple sclerosis [8A40]	[11]
Fingolimod	DM5JVAN	Major	Additive immunosuppressive effects by the combination of Anakinra and Fingolimod.	Multiple sclerosis [8A40]	[12]
Ocrelizumab	DMEZ2KH	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Ocrelizumab.	Multiple sclerosis [8A40]	[7]
Ozanimod	DMT6AM2	Major	Additive immunosuppressive effects by the combination of Anakinra and Ozanimod.	Multiple sclerosis [8A40]	[6]
Deflazacort	DMV0RNS	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Deflazacort.	Muscular dystrophy [8C70]	[7]
Bexarotene	DMOBIKY	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Bexarotene.	Mycosis fungoides [2B01]	[7]
Romidepsin	DMT5GNL	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Romidepsin.	Mycosis fungoides [2B01]	[7]
Decitabine	DMQL8XJ	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Decitabine.	Myelodysplastic syndrome [2A37]	[7]
Azacitidine	DMTA5OE	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Azacitidine.	Myelodysplastic syndrome [2A37]	[7]
Nilotinib	DM7HXWT	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Nilotinib.	Myeloproliferative neoplasm [2A20]	[7]
Ruxolitinib	DM7Q98D	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Ruxolitinib.	Myeloproliferative neoplasm [2A20]	[7]
Imatinib	DM7RJXL	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Imatinib.	Myeloproliferative neoplasm [2A20]	[7]
Dasatinib	DMJV2EK	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Dasatinib.	Myeloproliferative neoplasm [2A20]	[7]
Hydroxyurea	DMOQVU9	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Hydroxyurea.	Myeloproliferative neoplasm [2A20]	[7]
Omacetaxine mepesuccinate	DMPU2WX	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Omacetaxine mepesuccinate.	Myeloproliferative neoplasm [2A20]	[7]
Busulfan	DMXYJ9C	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Busulfan.	Myeloproliferative neoplasm [2A20]	[7]
Inebilizumab	DMI0RHA	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Inebilizumab.	Nervous system paraneoplastic/autoimmune disorder [8E4A]	[7]
Atezolizumab	DMMF8U0	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Atezolizumab.	Non-small cell lung cancer [2C25]	[7]
Olaparib	DM8QB1D	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Olaparib.	Ovarian cancer [2C73]	[7]
Carboplatin	DMG281S	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Carboplatin.	Ovarian cancer [2C73]	[7]
Altretamine	DMKLAYG	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Altretamine.	Ovarian cancer [2C73]	[7]
MK-4827	DMLYGH4	Moderate	Additive immunosuppressive effects by the combination of Anakinra and MK-4827.	Ovarian cancer [2C73]	[7]
Topotecan	DMP6G8T	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Topotecan.	Ovarian cancer [2C73]	[7]
Buprenorphine	DMPRI8G	Moderate	Altered metabolism of Anakinra due to Buprenorphine alters the formation of CYP450 enzymes.	Pain [MG30-MG3Z]	[6]
Hydrocodone	DMQ2JO5	Moderate	Altered metabolism of Anakinra due to Hydrocodone alters the formation of CYP450 enzymes.	Pain [MG30-MG3Z]	[6]
Streptozocin	DMOF7AT	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Streptozocin.	Pancreatic cancer [2C10]	[7]
Levamisole	DM5EN79	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Levamisole.	Parasitic infection [1D0Y-1G2Z]	[7]
Pemetrexed	DMMX2E6	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Pemetrexed.	Pleural mesothelioma [2C26]	[7]
Prednisone	DM2HG4X	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Prednisone.	Postoperative inflammation [1A00-CA43]	[7]
Betamethasone	DMAHJEF	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Betamethasone.	Postoperative inflammation [1A00-CA43]	[7]
Hydrocortisone	DMGEMB7	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Hydrocortisone.	Postoperative inflammation [1A00-CA43]	[7]
Brodalumab	DMASDQ6	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Brodalumab.	Psoriasis [EA90]	[7]
Efalizumab	DMCKL5V	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Efalizumab.	Psoriasis [EA90]	[13]
Infliximab	DMH7OIA	Major	Additive immunosuppressive effects by the combination of Anakinra and Infliximab.	Psoriasis [EA90]	[6]
Ustekinumab	DMHTYK3	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Ustekinumab.	Psoriasis [EA90]	[7]
Tildrakizumab	DMLW9HG	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Tildrakizumab.	Psoriasis [EA90]	[7]
Risankizumab	DMM32GT	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Risankizumab.	Psoriasis [EA90]	[7]
Ixekizumab	DMXW92T	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Ixekizumab.	Psoriasis [EA90]	[7]
Aldesleukin	DM4YMIS	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Aldesleukin.	Renal cell carcinoma [2C90]	[7]
Everolimus	DM8X2EH	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Everolimus.	Renal cell carcinoma [2C90]	[6]
Temsirolimus	DMS104F	Moderate	Additive myelosuppressive effects by the combination of Anakinra and Temsirolimus.	Renal cell carcinoma [2C90]	[6]
Fentanyl	DM8WAHT	Moderate	Altered metabolism of Anakinra due to Fentanyl alters the formation of CYP450 enzymes.	Sensation disturbance [MB40]	[6]
Sufentanil	DMU7YEL	Moderate	Altered metabolism of Anakinra due to Sufentanil alters the formation of CYP450 enzymes.	Sensation disturbance [MB40]	[6]
Anthrax vaccine	DM9GSWY	Moderate	Antagonize the effect of Anakinra when combined with Anthrax vaccine.	Sepsis [1G40-1G41]	[14]
Mogamulizumab	DMISH0Z	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Mogamulizumab.	Sezary syndrome [2B02]	[7]
Floxuridine	DM04LR2	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Floxuridine.	Solid tumour/cancer [2A00-2F9Z]	[7]
Dactinomycin	DM2YGNW	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Dactinomycin.	Solid tumour/cancer [2A00-2F9Z]	[7]
Cyclophosphamide	DM4O2Z7	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Cyclophosphamide.	Solid tumour/cancer [2A00-2F9Z]	[7]
Vinblastine	DM5TVS3	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Vinblastine.	Solid tumour/cancer [2A00-2F9Z]	[6]
PDX-101	DM6OC53	Moderate	Additive immunosuppressive effects by the combination of Anakinra and PDX-101.	Solid tumour/cancer [2A00-2F9Z]	[7]
Ifosfamide	DMCT3I8	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Ifosfamide.	Solid tumour/cancer [2A00-2F9Z]	[7]
Docetaxel	DMDI269	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Docetaxel.	Solid tumour/cancer [2A00-2F9Z]	[7]
Trabectedin	DMG3Y89	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Trabectedin.	Solid tumour/cancer [2A00-2F9Z]	[7]
Mitoxantrone	DMM39BF	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Mitoxantrone.	Solid tumour/cancer [2A00-2F9Z]	[7]
Etoposide	DMNH3PG	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Etoposide.	Solid tumour/cancer [2A00-2F9Z]	[7]
Epirubicin	DMPDW6T	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Epirubicin.	Solid tumour/cancer [2A00-2F9Z]	[7]
Prednisolone	DMQ8FR2	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Prednisolone.	Solid tumour/cancer [2A00-2F9Z]	[7]
Cisplatin	DMRHGI9	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Cisplatin.	Solid tumour/cancer [2A00-2F9Z]	[7]
Gemcitabine	DMSE3I7	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Gemcitabine.	Solid tumour/cancer [2A00-2F9Z]	[7]
Norethindrone	DMTY169	Moderate	Altered metabolism of Anakinra due to Norethindrone alters the formation of CYP450 enzymes.	Solid tumour/cancer [2A00-2F9Z]	[8]
Fluorouracil	DMUM7HZ	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Fluorouracil.	Solid tumour/cancer [2A00-2F9Z]	[7]
Taxol	DMUOT9V	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Taxol.	Solid tumour/cancer [2A00-2F9Z]	[7]
Doxorubicin	DMVP5YE	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Doxorubicin.	Solid tumour/cancer [2A00-2F9Z]	[7]
Vinorelbine	DMVXFYE	Moderate	Additive myelosuppressive effects by the combination of Anakinra and Vinorelbine.	Solid tumour/cancer [2A00-2F9Z]	[6]
Warfarin	DMJYCVW	Moderate	Altered metabolism of Anakinra due to Warfarin alters the formation of CYP450 enzymes.	Supraventricular tachyarrhythmia [BC81]	[6]
Pomalidomide	DMTGBAX	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Pomalidomide.	Systemic sclerosis [4A42]	[7]
Plicamycin	DM7C8YV	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Plicamycin.	Testicular cancer [2C80]	[7]
Apixaban	DM89JLN	Moderate	Altered metabolism of Anakinra due to Apixaban alters the formation of CYP450 enzymes.	Thrombosis [DB61-GB90]	[6]
Dicumarol	DMFQCB1	Moderate	Altered metabolism of Anakinra due to Dicumarol alters the formation of CYP450 enzymes.	Thrombosis [DB61-GB90]	[8]
Trimetrexate	DMDEA85	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Trimetrexate.	Toxoplasmosis [1F57]	[7]
Muromonab	DM8ANCF	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Muromonab.	Transplant rejection [NE84]	[7]
Sirolimus	DMGW1ID	Moderate	Additive myelosuppressive effects by the combination of Anakinra and Sirolimus.	Transplant rejection [NE84]	[6]
Azathioprine	DMMZSXQ	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Azathioprine.	Transplant rejection [NE84]	[7]
Mycophenolate mofetil	DMPQAGE	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Mycophenolate mofetil.	Transplant rejection [NE84]	[7]
Basiliximab	DMWNRZT	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Basiliximab.	Transplant rejection [NE84]	[7]
Belatacept	DMXLYQF	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Belatacept.	Transplant rejection [NE84]	[7]
Tacrolimus	DMZ7XNQ	Moderate	Additive myelosuppressive effects by the combination of Anakinra and Tacrolimus.	Transplant rejection [NE84]	[6]
Durvalumab	DM4PVDY	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Durvalumab.	Ureteral cancer [2C92]	[7]
Triamcinolone	DM98IXF	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Triamcinolone.	Vasomotor/allergic rhinitis [CA08]	[7]
Disopyramide	DM5SYZP	Moderate	Altered metabolism of Anakinra due to Disopyramide alters the formation of CYP450 enzymes.	Ventricular tachyarrhythmia [BC71]	[6]
Mexiletine	DMCTE9R	Moderate	Altered metabolism of Anakinra due to Mexiletine alters the formation of CYP450 enzymes.	Ventricular tachyarrhythmia [BC71]	[6]
Procainamide	DMNMXR8	Moderate	Altered metabolism of Anakinra due to Procainamide alters the formation of CYP450 enzymes.	Ventricular tachyarrhythmia [BC71]	[6]
Propafenone	DMPIBJK	Moderate	Altered metabolism of Anakinra due to Propafenone alters the formation of CYP450 enzymes.	Ventricular tachyarrhythmia [BC71]	[6]
Flecainide	DMSQDLE	Moderate	Altered metabolism of Anakinra due to Flecainide alters the formation of CYP450 enzymes.	Ventricular tachyarrhythmia [BC71]	[6]
Trifluridine	DMG2YBD	Moderate	Additive immunosuppressive effects by the combination of Anakinra and Trifluridine.	Virus infection [1A24-1D9Z]	[7]
-----------


⏷ Show the Full List of 209 DDI Information of This Drug

References

1	FDA Approved Drug Products from FDA Official Website. 2019. Application Number: (BLA) 103950.
2	ClinicalTrials.gov (NCT04364009) Anakinra for COVID-19 Respiratory Symptoms. U.S. National Institutes of Health.
3	Clinical and genetic characterization of Italian patients affected by CINCA syndrome. Rheumatology (Oxford). 2007 Mar;46(3):473-8.
4	IL-1 receptor antagonism and muscle gene expression in patients with type 2 diabetes. Eur Cytokine Netw. 2009 Jun 1;20(2):81-87.
5	FDA Approved Drug Products from FDA Official Website. 2019. Application Number: (BLA) 125166.
6	Cerner Multum, Inc. "UK Summary of Product Characteristics.".
7	Product Information. Arcalyst (rilonacept). Regeneron Pharmaceuticals Inc, Tarrytown, NY.
8	Product Information. Cosentyx (secukinumab). Novartis Pharmaceuticals, East Hanover, NJ.
9	Product Information. Prolia (denosumab). Amgen USA, Thousand Oaks, CA.
10	Product Information. Campath (alemtuzumab) Berlex, Richmond, CA.
11	Cerner Multum, Inc. "Australian Product Information.".
12	Product Information. Gilenya (fingolimod). Novartis Pharmaceuticals, East Hanover, NJ.
13	Product Information. Raptiva (efalizumab). Genentech, South San Francisco, CA.
14	CDC. Centers for Disease Control and Prevention/ "Recommendations of the advisory committtee on immunization practices (ACIP): use of vaccines and immune globulins in persons with altered immunocompetence." MMWR Morb Mortal Wkly Rep 42(RR-04) (1993): 1-18. [PMID: 20300058]