Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT3OT40)

DTT Name	Multidrug resistance protein 1 (ABCB1)
Synonyms	PGY1; P-glycoprotein 1; MDR1; CD243 antigen; CD243; ATP-binding cassette sub-family B member 1
Gene Name	ABCB1
DTT Type	Successful target	[1]
BioChemical Class	ABC transporter
UniProt ID	MDR1_HUMAN
TTD ID	T25258
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	EC 7.6.2.2
Sequence	MDLEGDRNGGAKKKNFFKLNNKSEKDKKEKKPTVSVFSMFRYSNWLDKLYMVVGTLAAII HGAGLPLMMLVFGEMTDIFANAGNLEDLMSNITNRSDINDTGFFMNLEEDMTRYAYYYSG IGAGVLVAAYIQVSFWCLAAGRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTDDVS KINEGIGDKIGMFFQSMATFFTGFIVGFTRGWKLTLVILAISPVLGLSAAVWAKILSSFT DKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANISIG AAFLLIYASYALAFWYGTTLVLSGEYSIGQVLTVFFSVLIGAFSVGQASPSIEAFANARG AAYEIFKIIDNKPSIDSYSKSGHKPDNIKGNLEFRNVHFSYPSRKEVKILKGLNLKVQSG QTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEPVLF ATTIAENIRYGRENVTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIA IARALVRNPKILLLDEATSALDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADVIAG FDDGVIVEKGNHDELMKEKGIYFKLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRS SLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPYFVVGVFCAII NGGLQPAFAIIFSKIIGVFTRIDDPETKRQNSNLFSLLFLALGIISFITFFLQGFTFGKA GEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQNI ANLGTGIIISFIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEA IENFRTVVSLTQEQKFEHMYAQSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCFRFG AYLVAHKLMSFEDVLLVFSAVVFGAMAVGQVSSFAPDYAKAKISAAHIIMIIEKTPLIDS YSTEGLMPNTLEGNVTFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKSTVV QLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVV SQEEIVRAAKEANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARALVRQPHILLLD EATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQL LAQKGIYFSMVSVQAGTKRQ
Function	Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.
KEGG Pathway	ABC transporters (hsa02010 ) Bile secretion (hsa04976 ) MicroRNAs in cancer (hsa05206 )
Reactome Pathway	ABC-family proteins mediated transport (R-HSA-382556 )
BioCyc Pathway	MetaCyc:HS01500-MON

Molecular Interaction Atlas (MIA) of This DTT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DTT

2 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
EDP-322	DMWTVM1	Bacterial infection	1A00-1C4Z	Phase 1	[2]
W-198	DMJ2R69	Solid tumour/cancer	2A00-2F9Z	Phase 1	[3]
------------------------------------------------------------------------------------

8 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
CBT-1	DM097UP	Non-small-cell lung cancer	2C25.Y	Discontinued in Phase 3	[4]
LY335979	DM2KITF	Acute myeloid leukaemia	2A60	Discontinued in Phase 3	[5]
Biricodar	DM65JCM	Ovarian cancer	2C73	Discontinued in Phase 2	[6]
S-9788	DMER3I9	Solid tumour/cancer	2A00-2F9Z	Discontinued in Phase 2	[7]
Tariquidar	DMJG7VP	Adrenocortical carcinoma	2D11.Z	Discontinued in Phase 2	[8]
Elacridar	DMURVE8	Solid tumour/cancer	2A00-2F9Z	Discontinued in Phase 1	[9]
ONT-093	DMB8T5U	Solid tumour/cancer	2A00-2F9Z	Discontinued in Phase 1	[10]
XR-9051	DMCK210	Solid tumour/cancer	2A00-2F9Z	Discontinued in Phase 1	[11]
------------------------------------------------------------------------------------


⏷ Show the Full List of 8 Discontinued Drug(s)

8 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
4,3'',5''-trimethoxy-[1,1':2',1'']-terphenyl	DMBN4G6	Discovery agent	N.A.	Investigative	[12]
6-(3,5-dimethoxy-phenyl)-naphthalen-2-ol	DMIXT2L	Discovery agent	N.A.	Investigative	[12]
TRISMETHOXYRESVERATROL	DM6USPC	Discovery agent	N.A.	Investigative	[12]
XR-9456	DMTUFI1	Discovery agent	N.A.	Investigative	[13]
XR-9504	DMIQP69	Discovery agent	N.A.	Investigative	[13]
XR-9544	DM1OZPN	Discovery agent	N.A.	Investigative	[13]
XR-9577	DMIZV6T	Discovery agent	N.A.	Investigative	[13]
[1,1':2',1'']-terphenyl-4,3'',5''-triol	DMVOY4D	Discovery agent	N.A.	Investigative	[12]
------------------------------------------------------------------------------------


⏷ Show the Full List of 8 Investigative Drug(s)

Molecular Expression Atlas (MEA) of This DTT

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Lung cancer	2C82	Lung tissue	3.12E-33	-0.83	-1.04
Ovarian cancer	2C82	Ovarian tissue	1.53E-04	-0.69	-2.04
------------------------------------------------------------------------------------

The Drug Transporter (DTP) Role of This DTT

DTT DTP Name

P-glycoprotein 1 (ABCB1) DTP Info

Gene Name

ABCB1

339 Approved Drug(s) Transported by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Abacavir	DMMN36E	Human immunodeficiency virus infection	1C62	Approved	[14]
Acebutolol	DM0TI4U	Hypertension	BA00-BA04	Approved	[15]
Acrivastine	DMTIGA0	Allergic rhinitis	CA08.0	Approved	[16]
Ajmaline	DMDJW5K	Atrial fibrillation	BC81.3	Approved	[17]
Albendazole	DMYZ57N	Echinococcus granulosus infectious disease		Approved	[18]
Aldosterone	DM9S2JW	Hypertension	BA00-BA04	Approved	[19]
Aliskiren	DM1BV7W	Hypertension	BA00-BA04	Approved	[20]
Ambrisentan	DMD1QXW	Pulmonary arterial hypertension	BB01.0	Approved	[21]
Amiodarone	DMUTEX3	Tachyarrhythmias	BC71	Approved	[22]
Amisulpride	DMSJVAM	Schizophrenia	6A20	Approved	[23]
Amitriptyline	DMK7F9S	Depression	6A70-6A7Z	Approved	[24]
Amoxicillin	DMUYNEI	Acute otitis media	AB00	Approved	[15]
Amphotericin B	DMTAJQE	Acne vulgaris	ED80	Approved	[25]
Amprenavir	DMLMXE0	Human immunodeficiency virus infection	1C62	Approved	[22]
Apixaban	DM89JLN	Thrombosis	DB61-GB90	Approved	[26]
Apremilast	DMTWS9E	Psoriasis vulgaris	EA90	Approved	[27]
Aprepitant	DM053KT	Depression	6A70-6A7Z	Approved	[28]
ARRY-162	DM1P6FR	Melanoma	2C30	Approved	[29]
Arsenic trioxide	DM61TA4	Acute lymphoblastic leukaemia	2A85	Approved	[30]
Aspirin	DM672AH	Acute coronary syndrome	BA41	Approved	[24]
Atenolol	DMNKG1Z	Angina pectoris	BA40	Approved	[31]
Atomoxetine	DM5L6HI	Attention deficit hyperactivity disorder	6A05.Z	Approved	[28]
Atorvastatin	DMF28YC	Acute coronary syndrome	BA41	Approved	[27]
Axitinib	DMGVH6N	Renal cell carcinoma	2C90	Approved	[32]
Azathioprine	DMMZSXQ	Lupus nephritis	4A40.0Y	Approved	[24]
Baloxavir marboxil	DM1UV7F	Influenza virus infection	1E30-1E32	Approved	[33]
Baricitinib	DM4ONW5	Rheumatoid arthritis	FA20	Approved	[34]
Beclomethasone	DMZPHIK	Allergic rhinitis	CA08.0	Approved	[35]
Bepridil	DM0RKS4	Chronic/stable angina	BA40.1	Approved	[22]
Beta-acetyldigoxin	DMI6GKT	Cardiovascular disease	BA00-BE2Z	Approved	[36]
Beta-carotene	DM0RXBT	Vitamin deficiency	5B55-5B71	Approved	[25]
Betamethasone	DMAHJEF	Acute adrenal insufficiency		Approved	[37]
BETRIXABAN	DM2C4RF	Venous thromboembolism	BD72	Approved	[38]
BIBW 2992	DMTKD7Q	Non-small-cell lung cancer	2C25.Y	Approved	[39]
Bicalutamide	DMZMSPF	Prostate cancer	2C82.0	Approved	[40]
BOCEPREVIR	DMBSHMF	Hepatitis C virus infection	1E51.1	Approved	[41]
Bortezomib	DMNO38U	Leukemia		Approved	[42]
Bosutinib	DMTI8YE	Blast phase chronic myelogenous leukemia, BCR-ABL1 positive		Approved	[43]
Brilinta	DMBR01X	Acute coronary syndrome	BA41	Approved	[44]
Bromocriptine	DMVE3TK	Acromegaly	5A60.0	Approved	[28]
Bupropion	DM5PCS7	Depression	6A70-6A7Z	Approved	[45]
Cabergoline	DMQ4HIN	Hyperprolactinaemia	5A60.1	Approved	[46]
Canagliflozin	DMFRM1I	Non-insulin dependent diabetes	5A11	Approved	[47]
Cannabidiol	DM0659E	Dravet syndrome	8A61.11	Approved	[44]
Carfilzomib	DM48K0X	Multiple myeloma	2A83	Approved	[48]
Carvedilol	DMHTEAO	Chronic heart failure	BD1Z	Approved	[27]
Cefoperazone	DM53PV8	Bacterial infection	1A00-1C4Z	Approved	[22]
Cefotetan	DM07TX3	Bacteremia	1A73	Approved	[15]
Ceftriaxone	DMCEW64	Acute gonococcal cervicitis		Approved	[22]
Celiprolol hcl	DMD5LBX	Hypertension	BA00-BA04	Approved	[49]
Cepharanthine	DM9Y5JB	N. A.	N. A.	Approved	[50]
Ceritinib	DMB920Z	Non-small-cell lung cancer	2C25.Y	Approved	[51]
Cerivastatin	DMXCM7H	Hyperlipidaemia	5C80	Approved	[52]
Cetirizine	DMOMP9U	Allergic rhinitis	CA08.0	Approved	[53]
Chlorambucil	DMRKE63	Chronic lymphocytic leukaemia	2A82.0	Approved	[22]
Chloramphenicol	DMFXEWT	Bacterial infection	1A00-1C4Z	Approved	[54]
Chloroquine	DMSI5CB	Malaria	1F40-1F45	Approved	[28]
Chlorpromazine	DMBGZI3	Acute intermittent hepatic porphyria	5C58.11	Approved	[22]
Ciclesonide	DM2NA4K	Allergic rhinitis	CA08.0	Approved	[35]
Ciclosporin	DMAZJFX	Graft-versus-host disease	4B24	Approved	[55]
Cimetidine	DMH61ZB	Acid-reflux disorder	DA22	Approved	[22]
Cisplatin	DMRHGI9	Adenocarcinoma	2D40	Approved	[22]
Citalopram	DM2G9AE	Acute coronary syndrome	BA41	Approved	[56]
Clarithromycin	DM4M1SG	Acute maxillary sinusitis		Approved	[22]
Clobazam - Lundbeck	DMW1OQ0	Anxiety disorder	6B00-6B0Z	Approved	[27]
Clofazimine	DMEBOFW	Crohn disease	DD70	Approved	[57]
Clomifene	DMKI7RB	Female infertility	GA31.Z	Approved	[58]
Clomiphene Citrate	DMS51VC	Female infertility	GA31.Z	Approved	[58]
Clomipramine	DMINRKW	Depression	6A70-6A7Z	Approved	[28]
Clonidine	DM6RZ9Q	Attention deficit hyperactivity disorder	6A05.Z	Approved	[24]
Clopidogrel	DMOL54H	Acute coronary syndrome	BA41	Approved	[59]
Clozapine	DMFC71L	Schizophrenia	6A20	Approved	[23]
Colchicine	DM2POTE	Acute gout flare	FA25.0	Approved	[60]
cortisone	DMU5QZX	Atopic dermatitis	EA80	Approved	[37]
Crizotinib	DM4F29C	Non-small-cell lung cancer	2C25.Y	Approved	[61]
Cytarabine	DMZD5QR	Acute lymphoblastic leukaemia	2A85	Approved	[22]
Dabigatran	DMDI6R4	Stroke	8B20	Approved	[62]
Dabrafenib	DMX6OE3	Melanoma	2C30	Approved	[63]
Daclatasvir	DMSFK9V	Hepatitis C virus infection	1E51.1	Approved	[62]
Dactinomycin	DM2YGNW	Adult kidney Wilms tumor		Approved	[64]
Darunavir	DMN3GCH	Human immunodeficiency virus infection	1C62	Approved	[65]
Dasatinib	DMJV2EK	Blast phase chronic myelogenous leukemia, BCR-ABL1 positive		Approved	[66]
Daunorubicin	DMQUSBT	Acute monocytic leukemia		Approved	[22]
Debrisoquin	DMC50ME	Hypertension	BA00-BA04	Approved	[67]
Deflazacort	DMV0RNS	Duchenne dystrophy	8C70	Approved	[44]
Delavirdine	DM3NF5G	Human immunodeficiency virus infection	1C62	Approved	[14]
Desipramine	DMT2FDC	Attention deficit hyperactivity disorder	6A05.Z	Approved	[68]
Desloratadine	DM56YN7	Allergic rhinitis	CA08.0	Approved	[69]
Dexamethasone	DMMWZET	Acute adrenal insufficiency		Approved	[70]
Dexlansoprazole	DM1DBV5	Erosive esophagitis	DA25.0	Approved	[68]
Diazepam	DM08E9O	Alcohol withdrawal		Approved	[71]
Dicloxacillin	DM8EU0Z	Bacterial infection	1A00-1C4Z	Approved	[72]
Diethylstilbestrol	DMN3UXQ	Gonorrheal vaginitis	GA02	Approved	[58]
Digitoxin	DMWVIGP	Arrhythmia	BC9Z	Approved	[73]
Digoxin	DMQCTIH	Arrhythmia	BC9Z	Approved	[74]
Dihydroergocristine	DM5SQ1G	Alcohol dependence	6C40.2	Approved	[75]
Diltiazem	DMAI7ZV	Angina pectoris	BA40	Approved	[22]
Dipyridamole	DMXY30O	Atrial fibrillation	BC81.3	Approved	[28]
Docetaxel	DMDI269	Advanced cancer	2A00-2F9Z	Approved	[76]
Dolutegravir	DMCZGRE	Human immunodeficiency virus infection	1C62	Approved	[27]
Domperidone	DMBDPY0	Gastrointestinal disease	DE2Z	Approved	[23]
Doxorubicin	DMVP5YE	Acute myelogenous leukaemia	2A41	Approved	[77]
Doxycycline	DM7ICNU	Acne vulgaris	ED80	Approved	[22]
DU-176b	DMCIJBH	Atrial fibrillation	BC81.3	Approved	[78]
Efavirenz	DMC0GSJ	Human immunodeficiency virus infection	1C62	Approved	[15]
Eletriptan	DMW649X	Migraine	8A80	Approved	[28]
Eliglustat tartrate	DMSRZAO	Metabolic disorder	5C50-5D2Z	Approved	[44]
Emetine	DMCT2YF	Hepatitis virus infection	1E50-1E51	Approved	[64]
Empagliflozin	DMRF9YK	Type-1 diabetes	5A10	Approved	[44]
Epinastine	DMX0K3Q	Allergic conjunctivitis	9A60.02	Approved	[79]
Epirubicin	DMPDW6T	Solid tumour/cancer	2A00-2F9Z	Approved	[22]
Ergotamine	DMKR3C5	Cluster headache	8A81.0	Approved	[28]
Erlotinib	DMCMBHA	Adrenal gland neoplasm		Approved	[80]
Erythromycin	DM4K7GQ	Acne vulgaris	ED80	Approved	[81]
Eslicarbazepine acetate	DMREUZV	N. A.	N. A.	Approved	[82]
Estradiol	DMUNTE3	Acne vulgaris	ED80	Approved	[58]
Estriol	DMOEM2I	Hormone deficiency	5A61.1	Approved	[83]
Estrone	DM5T6US	Acne vulgaris	ED80	Approved	[83]
Estrone sulfate	DMVBIZL	Atrophic vaginitis	GA30.2	Approved	[52]
Ethinyl Estradiol	DMODJ40	Acne vulgaris	ED80	Approved	[83]
Etoposide	DMNH3PG	Acute myelogenous leukaemia	2A41	Approved	[84]
Everolimus	DM8X2EH	Advanced cancer	2A00-2F9Z	Approved	[85]
Ezetimibe	DM7A8TW	Atherosclerosis	BD40	Approved	[86]
Famciclovir	DMJHLSD	Meniere disease	AB31.0	Approved	[16]
Felodipine	DMOSW35	Hypertension	BA00-BA04	Approved	[87]
Fentanyl	DM8WAHT	Analgesia	MB40.8	Approved	[22]
Fesoterodine fumarate	DM13495	Overactive bladder	GC50.0	Approved	[88]
Fexofenadine	DM17ONX	Allergic rhinitis	CA08.0	Approved	[89]
Fluorouracil	DMUM7HZ	Adenocarcinoma	2D40	Approved	[22]
Fluoxetine	DM3PD2C	Bipolar depression		Approved	[90]
Flupentixol	DM0DJ9O	Schizophrenia	6A20	Approved	[23]
Fluphenazine	DMIT8LX	Psychotic disorder	6A20-6A25	Approved	[23]
Fluticasone propionate	DMRWLB2	Allergic asthma	CA23.0	Approved	[35]
Fluvastatin	DM4MDJY	Arteriosclerosis	BD40	Approved	[68]
Fluvoxamine	DMQTJSX	Depression	6A70-6A7Z	Approved	[23]
Folic Acid	DMEMBJC	Colorectal carcinoma		Approved	[91]
Fosamprenavir	DM4W9B3	Human immunodeficiency virus infection	1C62	Approved	[27]
Gatifloxacin	DMSL679	Acute gonococcal cervicitis		Approved	[92]
Gefitinib	DM15F0X	Colon adenocarcinoma		Approved	[93]
Gemcitabine	DMSE3I7	Anterior urethra cancer		Approved	[94]
Gepirone	DMGX5Q0	Major depressive disorder	6A70.3	Approved	[15]
Gilteritinib	DMTI0ZO	Acute myeloid leukaemia	2A60	Approved	[44]
Glecaprevir	DM31YVO	N. A.	N. A.	Approved	[27]
Glutathione	DMAHMT9	Human immunodeficiency virus infection	1C62	Approved	[95]
Gramicidin D	DMPT74U	Bacterial infection	1A00-1C4Z	Approved	[22]
Grepafloxacin	DMGLX0T	Chronic bronchitis	CA20.1	Approved	[22]
Guanabenz	DM5QWEL	High blood pressure	BA00	Approved	[68]
Guggulsterone	DMP7LK1	Osteoarthritis	FA00-FA05	Approved	[96]
Haloperidol	DM96SE0	Delirium		Approved	[23]
Hydrocortisone	DMGEMB7	Acne vulgaris	ED80	Approved	[35]
Hydroxyurea	DMOQVU9	Chronic myelogenous leukaemia	2A20.0	Approved	[22]
Ibrutinib	DMHZCPO	Mantle cell lymphoma	2A85.5	Approved	[97]
Idarubicin	DMM0XGL	Acute myelogenous leukaemia	2A41	Approved	[98]
Imatinib	DM7RJXL	Acute lymphoblastic leukaemia	2A85	Approved	[99]
Imipramine	DM2NUH3	Depression	6A70-6A7Z	Approved	[24]
Indacaterol	DMQJHR7	Chronic obstructive pulmonary disease	CA22	Approved	[44]
Indinavir	DM0T3YH	Human immunodeficiency virus infection	1C62	Approved	[100]
Indomethacin	DMSC4A7	Bursitis		Approved	[101]
Ingenol mebutate	DMK1CZJ	Actinic keratosis	EK90.0	Approved	[102]
Intedanib	DMSTA36	Colorectal cancer	2B91.Z	Approved	[103]
Irinotecan	DMP6SC2	Adenocarcinoma	2D40	Approved	[104]
Itraconazole	DMCR1MV	Aspergillosis	1F20	Approved	[22]
Ivacaftor	DMZC1HS	Cystic fibrosis	CA25	Approved	[105]
Ivermectin	DMDBX5F	Intestinal strongyloidiasis due to nematode parasite	1F6B	Approved	[106]
Ivosidenib	DM8S6T7	Acute myeloid leukaemia	2A60	Approved	[107]
Ixabepilone	DM2OZ3G	Breast cancer	2C60-2C65	Approved	[108]
Ketoconazole	DMPZI3Q	Blastomycosis	1F22	Approved	[22]
L-Tryptophan	DMIBH7M	Depression	6A70-6A7Z	Approved	[109]
Labetalol	DMK8U72	Hypertension	BA00-BA04	Approved	[15]
Lamotrigine	DM8SXYG	Bipolar disorder	6A60	Approved	[110]
Lapatinib	DM3BH1Y	Breast cancer	2C60-2C65	Approved	[27]
Lenalidomide	DM6Q7U4	Adult T-cell leukemia/lymphoma		Approved	[111]
Lenvatinib	DMB1IU4	Thyroid cancer	2D10	Approved	[112]
Levetiracetam	DMTGDN8	Epilepsy	8A60-8A68	Approved	[113]
Levodopa	DMN3E57	Parkinson disease	8A00.0	Approved	[15]
Levofloxacin	DMS60RB	Acute maxillary sinusitis		Approved	[22]
Levomepromazine	DMIKFEL	Bipolar disorder	6A60	Approved	[23]
Levomilnacipran	DMV26S8	Fibromyalgia	MG30.01	Approved	[114]
Lidocaine	DML4ZOT	Anaesthesia	9A78.6	Approved	[22]
Linagliptin	DMWFJTR	Non-insulin dependent diabetes	5A11	Approved	[27]
Loperamide	DMOJZQ9	Diarrhea	ME05.1	Approved	[115]
Lopinavir	DMITQS0	Human immunodeficiency virus infection	1C62	Approved	[116]
Loratadine	DMF3AN7	Allergy	4A80-4A85	Approved	[69]
Losartan	DM72JXH	Diabetic kidney disease	GB61.Z	Approved	[117]
Lovastatin	DM9OZWQ	Arteriosclerosis	BD40	Approved	[22]
Lovastatin acid	DMGCQ4E	N. A.	N. A.	Approved	[15]
Maraviroc	DMTL94F	Human immunodeficiency virus infection	1C62	Approved	[27]
Mefloquine	DMWT905	Malaria	1F40-1F45	Approved	[118]
Melphalan	DMOLNHF	Hematologic disease	3C0Z	Approved	[119]
Meperidine	DMX4GND	Pain	MG30-MG3Z	Approved	[120]
Mequitazine	DMAFBCY	Allergic rhinitis	CA08.0	Approved	[16]
Methadone	DMTW6IU	Advanced cancer	2A00-2F9Z	Approved	[121]
Methotrexate	DM2TEOL	Anterior urethra cancer		Approved	[22]
Methylprednisolone	DM4BDON	Acute adrenal insufficiency		Approved	[122]
Methysergide	DM1EF73	Migraine	8A80	Approved	[16]
Midazolam	DMXOELT	Agitation	6A70.3	Approved	[68]
Midostaurin	DMI6E0R	Acute myeloid leukaemia	2A60	Approved	[15]
Mitomycin	DMH0ZJE	Breast cancer	2C60-2C65	Approved	[123]
Mitoxantrone	DMM39BF	Acute myelogenous leukaemia	2A41	Approved	[22]
Morphine	DMRMS0L	Advanced cancer	2A00-2F9Z	Approved	[124]
Mycophenolate mofetil	DMPQAGE	Hepatosplenic T-cell lymphoma		Approved	[125]
Nadolol	DMW6GVL	Angina pectoris	BA40	Approved	[27]
Nalbuphine	DMOSQGU	Pain	MG30-MG3Z	Approved	[16]
Naloxegol	DML0B41	Opioid-induced constipation	DB32.1	Approved	[27]
Neostigmine	DM6T2J3	Myasthenia gravis	8C6Y	Approved	[28]
Nevirapine	DM6HX9B	Human immunodeficiency virus infection	1C62	Approved	[15]
Nicardipine	DMCDYW7	High blood pressure	BA00	Approved	[70]
Nifedipine	DMSVOZT	Angina pectoris	BA40	Approved	[22]
Nilotinib	DM7HXWT	Chronic myelogenous leukaemia	2A20.0	Approved	[44]
Nimodipine	DMQ0RKZ	Cerebral vasospasm	BA85.Z	Approved	[15]
Nisoldipine	DM7ISKJ	Hypertension	BA00-BA04	Approved	[22]
Nitrendipine	DM21C09	Hypertension	BA00-BA04	Approved	[22]
Nizatidine	DMGFV3Z	Acid-reflux disorder	DA22	Approved	[126]
Norfloxacin	DMIZ6W2	Acute gonococcal cervicitis		Approved	[15]
Olanzapine	DMPFN6Y	Bipolar depression		Approved	[23]
Olaparib	DM8QB1D	Ovarian cancer	2C73	Approved	[127]
Olmesartan medoxomil	DMWBHRY	High blood pressure	BA00	Approved	[44]
Olopatadine	DMKMWQG	Allergic conjunctivitis	9A60.02	Approved	[15]
Omadacycline	DMR2J95	Acute bacterial skin infection	1C41	Approved	[128]
Omeprazole	DM471KJ	Cystic fibrosis	CA25	Approved	[68]
Ondansetron	DMOTQ1I	Chemotherapy-induced nausea	MD90	Approved	[118]
Oseltamivir	DMGO72P	Influenza	1E30-1E32	Approved	[129]
Oxcarbazepine	DM5PU6O	Epilepsy	8A60-8A68	Approved	[130]
Paclitaxel	DMLB81S	Breast carcinoma		Approved	[131]
Palbociclib	DMD7L94	Breast cancer	2C60-2C65	Approved	[132]
Paliperidone	DM7NPJS	Psychotic disorder	6A20-6A25	Approved	[133]
Panobinostat	DM58WKG	Chronic graft versus host disease		Approved	[134]
Pantoprazole	DMSVOCZ	Gastrinoma	2C10.1	Approved	[68]
Paroxetine	DM5PVQE	Anxiety disorder	6B00-6B0Z	Approved	[28]
Pazopanib HCl	DM6U9CQ	Renal cell carcinoma	2C90	Approved	[135]
Pemirolast	DML97WV	Allergic conjunctivitis	9A60.02	Approved	[15]
Pentazocine	DM1XBHS	Pain	MG30-MG3Z	Approved	[22]
Perazine	DM2AOTZ	Psychotic disorder	6A20-6A25	Approved	[23]
Perphenazine	DMA4MRX	Schizophrenia	6A20	Approved	[23]
Phenobarbital	DMXZOCG	Cluster headache	8A81.0	Approved	[130]
Phenprocoumon	DMDO279	Myocardial infarction	BA41-BA43	Approved	[136]
Phenytoin	DMNOKBV	Epilepsy	8A60-8A68	Approved	[130]
Pibrentasvir	DM27BL1	N. A.	N. A.	Approved	[27]
Pimozide	DMW83TP	Schizophrenia	6A20	Approved	[15]
Pirarubicin	DMGTW1I	Breast cancer	2C60-2C65	Approved	[15]
Pirenzepine	DMP6M1N	Peptic ulcer	DA61	Approved	[16]
Pomalidomide	DMTGBAX	Plasma cell myeloma	2A83.1	Approved	[137]
Ponatinib	DMYGJQO	Acute lymphoblastic leukaemia	2A85	Approved	[138]
Posaconazole	DMUL5EW	Aspergillosis	1F20	Approved	[44]
Pravastatin	DM6A0X7	Adult acute monocytic leukemia		Approved	[27]
Prazosin	DMCD9YG	Benign prostatic hyperplasia	GA90	Approved	[139]
Prednisolone	DMQ8FR2	Acute adrenal insufficiency		Approved	[140]
Prednisone	DM2HG4X	Acute asthma	CA23	Approved	[37]
Progesterone	DMUY35B	Amenorrhea	GA20.0	Approved	[71]
Propafenone	DMPIBJK	Tachyarrhythmias	BC71	Approved	[22]
Propranolol	DM79NTF	Angina pectoris	BA40	Approved	[27]
Protriptyline	DMNHTZI	Depression	6A70-6A7Z	Approved	[16]
Quercetin	DM3NC4M	Obesity	5B81	Approved	[141]
Quetiapine	DM1N62C	Anorexia nervosa cachexia	6B80	Approved	[23]
Quinine	DMSWYF5	Malaria	1F40-1F45	Approved	[22]
R0-93877	DMM4U9G	Constipation	DD91.1	Approved	[142]
Raloxifene	DMDKF3M	Osteoporosis	FB83.0	Approved	[143]
Ramosetron	DMH7GN8	Diarrhea-predominant irritable bowel syndrome	DD91.01	Approved	[144]
Ranitidine	DM0GUSX	Gastric ulcer	DA60	Approved	[22]
Ranolazine	DM0C9IL	Acute coronary syndrome	BA41	Approved	[145]
Regorafenib	DMHSY1I	Gastrointestinal stromal tumour	2B5B	Approved	[146]
Relugolix	DMK7IWL	Prostate cancer	2C82.0	Approved	[44]
Reserpine	DM6VM38	Hypertension	BA00-BA04	Approved	[28]
Rifampin	DMA8J1G	Tuberculosis	1B10-1B1Z	Approved	[22]
Rifaximin	DMW1TV2	Bacterial infection	1A00-1C4Z	Approved	[147]
Riociguat	DMXBLMP	Chronic thromboembolic pulmonary hypertension		Approved	[148]
Risperidone	DMN6DXL	Bipolar I disorder		Approved	[149]
Ritonavir	DMU764S	Human immunodeficiency virus infection	1C62	Approved	[150]
Rivaroxaban	DMQMBZ1	Deep vein thrombosis	BD71	Approved	[151]
Romidepsin	DMT5GNL	Cutaneous T-cell lymphoma	2B01	Approved	[152]
Rosuvastatin	DMMIQ7G	Arteriosclerosis	BD40	Approved	[153]
S-licarbazepine	DMDIZCS	N. A.	N. A.	Approved	[82]
Saphris	DM5VP0F	N. A.	N. A.	Approved	[15]
Saquinavir	DMG814N	Human immunodeficiency virus infection	1C62	Approved	[154]
Saxagliptin	DMGXENV	Type-2 diabetes	5A11	Approved	[27]
Sertraline	DM0FB1J	Coronary heart disease	BA80.Z	Approved	[28]
SILODOSIN	DMJSBT6	Benign prostatic hyperplasia	GA90	Approved	[155]
Simeprevir	DMLUA9D	Chronic HCV-1 infection	1E51.1	Approved	[44]
Simvastatin	DM30SGU	Arteriosclerosis	BD40	Approved	[22]
Sirolimus	DMGW1ID	Advanced cancer	2A00-2F9Z	Approved	[156]
Sitagliptin	DMGDKXN	Cystic fibrosis	CA25	Approved	[27]
Sofosbuvir	DMQI86A	Hepatitis C	1E51	Approved	[157]
Sorafenib	DMS8IFC	Adenocarcinoma	2D40	Approved	[158]
Sparfloxacin	DMB4HCT	Bacterial infection	1A00-1C4Z	Approved	[22]
Sumatriptan	DMVYXR8	Cluster headache	8A81.0	Approved	[159]
Sunitinib	DMCBJSR	Acute undifferentiated leukemia		Approved	[160]
Sunitinib malate	DMN8E5D	N. A.	N. A.	Approved	[161]
Tacrine	DM51FY6	Alzheimer disease	8A20	Approved	[162]
Tacrolimus	DMZ7XNQ	Graft-versus-host disease	4B24	Approved	[22]
Tadalafil	DMJZHT1	Benign prostatic hyperplasia	GA90	Approved	[163]
Talazoparib	DM1KS78	Breast cancer	2C60-2C65	Approved	[164]
Tamoxifen	DMLB0EZ	Breast cancer	2C60-2C65	Approved	[22]
Telaprevir	DMMRV29	Hepatitis C virus infection	1E51.1	Approved	[41]
Telithromycin	DMZ4P3A	Bacterial infection	1A00-1C4Z	Approved	[165]
Temsirolimus	DMS104F	Renal cell carcinoma	2C90	Approved	[166]
Teniposide	DMLW57T	Acute lymphoblastic leukaemia	2A85	Approved	[22]
Tenofovir	DM1IS6U	Chronic hepatitis B virus infection		Approved	[44]
Tenofovir alafenamide	DMTQF4A	Hiv infectious disease		Approved	[167]
Tenoxicam	DMVAZP9	Rheumatoid arthritis	FA20	Approved	[15]
Testosterone	DM7HUNW	Hot flushes	GA30	Approved	[68]
Tetracycline	DMZA017	Acne vulgaris	ED80	Approved	[22]
Thiamphenicol	DMDRKH2	Bacterial infection	1A00-1C4Z	Approved	[54]
Thioridazine	DM35M8J	Schizophrenia	6A20	Approved	[28]
Timolol	DM3NXRU	High blood pressure	BA00	Approved	[49]
Tolvaptan	DMIWFRL	Autosomal dominant polycystic kidney disease	GB81	Approved	[168]
Topiramate	DM82Z30	Alcohol dependence	6C40.2	Approved	[169]
Topotecan	DMP6G8T	Central nervous system neoplasm		Approved	[170]
Toremifene	DMQYUWG	Breast cancer	2C60-2C65	Approved	[58]
Tramadol	DMRQD04	Osteoarthritis	FA00-FA05	Approved	[171]
Tretinoin	DM49DUI	Acne vulgaris	ED80	Approved	[25]
Trifluoperazine	DMKBYWI	Anxiety		Approved	[22]
Triflupromazine	DMKFQJP	Nausea	MD90	Approved	[15]
Trimethoprim	DMM7CHK	Acute otitis media	AB00	Approved	[28]
Triprolidine	DM7SWIA	Allergic rhinitis	CA08.0	Approved	[172]
Trospium chloride	DM32XZT	Discovery agent	N.A.	Approved	[173]
Vecuronium	DMP0UK2	Spasm	MB47.3	Approved	[118]
Velpatasvir	DMGF8ZQ	N. A.	N. A.	Approved	[27]
Vemurafenib	DM62UG5	Melanoma	2C30	Approved	[174]
Venetoclax	DM8I94Y	Chronic lymphocytic leukaemia	2A82.0	Approved	[175]
Verapamil	DMA7PEW	Angina pectoris	BA40	Approved	[176]
Vibegron	DMFR201	Overactive bladder	GC50.0	Approved	[44]
Vildagliptin	DMYN59P	Type-2 diabetes	5A11	Approved	[177]
Vinblastine	DM5TVS3	Advanced cancer	2A00-2F9Z	Approved	[178]
Vincristine	DMINOX3	Acute lymphoblastic leukaemia	2A85	Approved	[179]
Vindesine	DMVR628	Acute lymphoblastic leukaemia	2A85	Approved	[15]
Vinorelbine	DMVXFYE	Advanced cancer	2A00-2F9Z	Approved	[180]
Voxilaprevir	DMAI83D	N. A.	N. A.	Approved	[27]
VRX496	DMIO4V5	Acquired immune deficiency syndrome	1C62.3	Approved	[181]
Y-25130	DMDPM7R	Nausea and vomiting	MD90	Approved	[15]
Zidovudine	DM4KI7O	Human immunodeficiency virus infection	1C62	Approved	[14]
Ziprasidone	DMM58JY	Bipolar disorder	6A60	Approved	[28]
Zolmitriptan	DM1IB4Q	Migraine	8A80	Approved	[28]
Beclomethasone dipropionate	DM5NW1E	Allergic rhinitis	CA08.0	Phase 4	[35]
Berberine	DMC5Q8X	N. A.	N. A.	Phase 4	[182]
Dihydrotestosterone	DM3S8XC	Prostate hyperplasia	GA90	Phase 4	[183]
Ebastine	DMH21D9	N. A.	N. A.	Phase 4	[15]
Guanfacine	DMPN5IH	Attention deficit hyperactivity disorder	6A05.Z	Phase 4	[184]
Ombitasvir	DMQIMTK	Hepatitis C	1E51	Phase 4	[27]
Tenofovir disoproxil	DM62IPN	N. A.	N. A.	Phase 4	[15]
------------------------------------------------------------------------------------


⏷ Show the Full List of 339 Approved Drug(s)

29 Clinical Trial Drug(s) Transported by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ABT-263	DMNE56X	Myelofibrosis	2A20.2	Phase 3	[185]
Asimadoline	DMND3AB	Diarrhea-predominant irritable bowel syndrome	DD91.01	Phase 3	[22]
Crocin	DM5F24X	N. A.	N. A.	Phase 3	[25]
Curcumin	DMQPH29	Solid tumour/cancer	2A00-2F9Z	Phase 3	[22]
MELAGATRAN	DM4W8RE	N. A.	N. A.	Phase 3	[15]
Morphine-6-glucuronide	DMPVW6H	Pain	MG30-MG3Z	Phase 3	[15]
Pazufloxacin	DMHXTAQ	Conjunctivitis	9A60	Phase 3	[186]
Simvastatin acid	DM18QHT	N. A.	N. A.	Phase 3	[187]
Sitafloxacin	DMTV5XC	Escherichia coli infection	1A03	Phase 2/3	[15]
(Z)-endoxifen	DMGDOS2	N. A.	N. A.	Phase 2	[188]
Afimoxifene	DMFORDT	Breast cancer	2C60-2C65	Phase 2	[58]
Arverapamil	DML27AE	Irritable bowel syndrome	DD91.0	Phase 2	[189]
Bisantrene	DMW76V0	N. A.	N. A.	Phase 2	[22]
BMS 650032	DMQI43G	Hepatitis C virus infection	1E51.1	Phase 2	[44]
CKD602	DMW9F1G	Solid tumour/cancer	2A00-2F9Z	Phase 2	[15]
CP-122721	DMSWLM5	Major depressive disorder	6A70.3	Phase 2	[190]
Dolastatin 10	DM0QDC9	N. A.	N. A.	Phase 2	[191]
Fucoxanthin	DMPQFTA	Metabolic syndrome x	5C50-5D2Z	Phase 2	[25]
Gallopamil	DMXBR27	Asthma	CA23	Phase 2	[15]
GS-5885	DMSL3DX	Hepatitis C virus infection	1E51.1	Phase 2	[27]
ONO-6126	DMRT28X	Chronic obstructive pulmonary disease	CA22	Phase 2	[192]
Paritaprevir	DM4N7BT	Hepatitis C	1E51	Phase 2	[27]
R-roscovitine	DMSH108	Non-small-cell lung cancer	2C25.Y	Phase 2	[193]
ABT-333	DM7TOWX	Hepatitis C virus infection	1E51.1	Phase 1	[27]
Genz 644282	DMTGN0U	N. A.	N. A.	Phase 1	[194]
Mibefradil	DMU9VDS	Glioblastoma multiforme	2A00.0	Phase 1	[15]
NARINGENIN	DMHAZLM	N. A.	N. A.	Phase 1	[141]
Norbuprenorphine	DM2ILSJ	N. A.	N. A.	Phase 1	[195]
Sphingosine-1-phosphate	DMJCQKA	Acne vulgaris	ED80	Phase 1	[196]
------------------------------------------------------------------------------------


⏷ Show the Full List of 29 Clinical Trial Drug(s)

20 Discontinued Drug(s) Transported by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Alprenolol	DMYJ8Z3	Hypertension	BA00-BA04	Withdrawn from market	[68]
Astemizole	DM2HN6Q	Allergic rhinitis	CA08.0	Withdrawn from market	[28]
Isoxicam	DMMS2J5	Osteoarthritis	FA00-FA05	Withdrawn from market	[15]
Roxithromycin	DMVMIK2	Bacterial infection	1A00-1C4Z	Withdrawn from market	[165]
Terfenadine	DM4KLPT	Allergy	4A80-4A85	Withdrawn from market	[22]
Ximelagatran	DMABRJL	Coagulation defect	3B10.0	Withdrawn from market	[15]
Flesinoxan	DMOIP7R	Anxiety disorder	6B00-6B0Z	Discontinued in Phase 3	[197]
Valspodar	DMXRU9M	Acute myeloid leukaemia	2A60	Discontinued in Phase 3	[22]
DE-081	DM3AVO1	Conjunctivitis	9A60	Discontinued in Phase 2	[198]
Dexniguldipine	DMLZIT2	Solid tumour/cancer	2A00-2F9Z	Discontinued in Phase 2	[192]
Droloxifene	DM9JPUD	Breast cancer	2C60-2C65	Discontinued in Phase 2	[15]
Radafaxine	DMARQE0	Major depressive disorder	6A70.3	Discontinued in Phase 2	[45]
S-9788	DMER3I9	Solid tumour/cancer	2A00-2F9Z	Discontinued in Phase 2	[15]
Tolafentrine	DMEROU4	Chronic obstructive pulmonary disease	CA22	Discontinued in Phase 2	[68]
PAFENOLOL	DM6LQGO	Hypertension	BA00-BA04	Discontinued in Phase 1	[15]
Rhodamine-123	DMQAK6T	Prostate cancer	2C82.0	Discontinued in Phase 1	[70]
ABT-737	DML0DBV	N. A.	N. A.	Terminated	[185]
Bisbenzimide (Hoechst 33258)	DMKRBL2	Solid tumour/cancer	2A00-2F9Z	Terminated	[22]
Calphostin C	DM9X2D0	N. A.	N. A.	Terminated	[15]
NIGULDIPINE	DMSPWMF	N. A.	N. A.	Terminated	[15]
------------------------------------------------------------------------------------


⏷ Show the Full List of 20 Discontinued Drug(s)

15 Preclinical Drug(s) Transported by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Abamectin B1A	DMRSATG	N. A.	N. A.	Preclinical	[199]
BMS-3870032	DMCWIBU	N. A.	N. A.	Preclinical	[15]
Bouvardin	DM5O3HC	N. A.	N. A.	Preclinical	[192]
Bunitrolol	DMT4532	N. A.	N. A.	Preclinical	[200]
Cephaeline	DM1ZFCS	N. A.	N. A.	Preclinical	[192]
Coelenterazine	DMG3BE1	N. A.	N. A.	Preclinical	[201]
Desmethylsertraline	DM2I76R	N. A.	N. A.	Preclinical	[45]
Epothilone A	DMX2FZS	N. A.	N. A.	Preclinical	[15]
Metildigoxin	DMDPV82	N. A.	N. A.	Preclinical	[44]
Metkephamid	DMDU8KC	N. A.	N. A.	Preclinical	[192]
MG-132	DMKA2YS	N. A.	N. A.	Preclinical	[202]
N-desethyl sunitinib	DM5ATJ0	N. A.	N. A.	Preclinical	[203]
Nonactin	DMKF2H0	N. A.	N. A.	Preclinical	[64]
Puromycin	DMDKLB5	N. A.	N. A.	Preclinical	[204]
Selamectin	DM5LU3N	N. A.	N. A.	Preclinical	[199]
------------------------------------------------------------------------------------


⏷ Show the Full List of 15 Preclinical Drug(s)

22 Investigative Drug(s) Transported by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(11-BETA)-11,21-DIHYDROXY-PREGN-4-ENE-3,20-DIONE	DMTPQ84	Discovery agent	N.A.	Investigative	[58]
azidopine	DMD0LCA	Discovery agent	N.A.	Investigative	[22]
Bcecf-Am	DMPG1LJ	N. A.	N. A.	Investigative	[22]
biotin	DMKMCE1	Discovery agent	N.A.	Investigative	[205]
Cholesterol	DMR3J6S	Discovery agent	N.A.	Investigative	[206]
cycloheximide	DMGDA3C	Discovery agent	N.A.	Investigative	[25]
FLUPENTIXOLE	DMELB5S	Discovery agent	N.A.	Investigative	[22]
G418	DMKTJBU	Discovery agent	N.A.	Investigative	[204]
GNF-PF-5411	DMZNAEQ	Discovery agent	N.A.	Investigative	[15]
Leupeptin	DMU075F	Malaria	1F40-1F45	Investigative	[22]
Nafoxidine	DM0FROP	Discovery agent	N.A.	Investigative	[58]
Nogalamycin	DM50TCG	Discovery agent	N.A.	Investigative	[192]
Okadaic acid	DM47CO1	Discovery agent	N.A.	Investigative	[192]
paraquat	DMR8O3X	Discovery agent	N.A.	Investigative	[22]
prostaglandin A2	DMWC4X8	Discovery agent	N.A.	Investigative	[207]
Staurosporine	DM0E9BR	Discovery agent	N.A.	Investigative	[15]
Substance P	DMQ6W4I	Discovery agent	N.A.	Investigative	[209]
talinolol	DMRTD16	Discovery agent	N.A.	Investigative	[210]
Tiapamil	DMWSI0H	Cardiovascular disease	BA00-BE2Z	Investigative	[22]
Tyrphostin ag-1478	DM87ZIH	Discovery agent	N.A.	Investigative	[211]
Valinomycin	DMW4TYV	N. A.	N. A.	Investigative	[70]
[3H]spiperone	DMWHEV8	Discovery agent	N.A.	Investigative	[15]
------------------------------------------------------------------------------------


⏷ Show the Full List of 22 Investigative Drug(s)

1 Investigative Agents Transported by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Silvestrol	DM5JKNF	Middle East Respiratory Syndrome (MERS)	1D64	Investigative	[208]
------------------------------------------------------------------------------------

References

1	VX-710 (biricodar) increases drug retention and enhances chemosensitivity in resistant cells overexpressing P-glycoprotein, multidrug resistance protein, and breast cancer resistance protein. Clin Cancer Res. 2004 Mar 1;10(5):1826-34.
2	In vitro activities of the novel bicyclolides modithromycin (EDP-420, EP-013420, S-013420) and EDP-322 against MDR clinical Neisseria gonorrhoeae isolates and international reference strains. J Antimicrob Chemother. 2015 Jan;70(1):173-7.
3	Mechanisms of tetrandrine and 5-bromotetrandrine in reversing multidrug resistance may relate to down-regulation of multidrug resistance associated protein 7 expression. Zhongguo Shi Yan Xue Ye Xue Za Zhi. 2012 Jun;20(3):558-63.
4	A pharmacodynamic study of the P-glycoprotein antagonist CBT-1 in combination with paclitaxel in solid tumors. Oncologist.2012;17(4):512.
5	A Phase I trial of a potent P-glycoprotein inhibitor, zosuquidar trihydrochloride (LY335979), administered intravenously in combination with doxoru... Clin Cancer Res. 2004 May 15;10(10):3265-72.
6	ClinicalTrials.gov (NCT00003847) VX-710, Doxorubicin, and Vincristine for the Treatment of Patients With Recurrent Small Cell Lung Cancer. U.S. National Institutes of Health.
7	In vitro activity of S 9788 on a multidrug-resistant leukemic cell line and on normal hematopoietic cells-reversal of multidrug resistance by sera from phase I-treated patients. Cancer Chemother Pharmacol. 1995;36(3):195-203.
8	Inhibition of P-glycoprotein (ABCB1)- and multidrug resistance-associated protein 1 (ABCC1)-mediated transport by the orally administered inhibitor, CBT-1((R)).Biochem Pharmacol.2008 Mar 15;75(6):1302-12.
9	2-[(3-Methoxyphenylethyl)phenoxy]-based ABCB1 inhibitors: effect of different basic side-chains on their biological properties. J Med Chem. 2008 Dec 11;51(23):7602-13.
10	A phase I pharmacokinetic study of the P-glycoprotein inhibitor, ONT-093, in combination with paclitaxel in patients with advanced cancer. Invest New Drugs. 2005 Aug;23(4):311-5.
11	Communication between multiple drug binding sites on P-glycoprotein. Mol Pharmacol. 2000 Sep;58(3):624-32.
12	Identification of a terphenyl derivative that blocks the cell cycle in the G0-G1 phase and induces differentiation in leukemia cells. J Med Chem. 2006 May 18;49(10):3012-8.
13	Functional assay and structure-activity relationships of new third-generation P-glycoprotein inhibitors. Bioorg Med Chem. 2008 Mar 1;16(5):2448-62.
14	The transport of anti-HIV drugs across blood-CNS interfaces: summary of current knowledge and recommendations for further research. Antiviral Res. 2009 May;82(2):A99-109.
15	Human intestinal transporter database: QSAR modeling and virtual profiling of drug uptake, efflux and interactions. Pharm Res. 2013 Apr;30(4):996-1007.
16	Passive permeability and P-glycoprotein-mediated efflux differentiate central nervous system (CNS) and non-CNS marketed drugs. J Pharmacol Exp Ther. 2002 Dec;303(3):1029-37.
17	ATP-dependent transport of amphiphilic cations across the hepatocyte canalicular membrane mediated by mdr1 P-glycoprotein. FEBS Lett. 1994 Apr 25;343(2):168-72.
18	The anthelminthic agent albendazole does not interact with p-glycoprotein. Drug Metab Dispos. 2002 Apr;30(4):365-9.
19	MDR1 genotype-dependent regulation of the aldosterone system in humans. Pharmacogenet Genomics. 2007 Feb;17(2):137-44.
20	Effects of the inhibition of intestinal P-glycoprotein on aliskiren pharmacokinetics in cynomolgus monkeys. Biopharm Drug Dispos. 2015 Jan;36(1):15-33.
21	Potential for pharmacokinetic interactions between ambrisentan and cyclosporine. Clin Pharmacol Ther. 2010 Oct;88(4):513-20.
22	Mammalian drug efflux transporters of the ATP binding cassette (ABC) family in multidrug resistance: A review of the past decade. Cancer Lett. 2016 Jan 1;370(1):153-64.
23	Identification of P-glycoprotein substrates and inhibitors among psychoactive compounds--implications for pharmacokinetics of selected substrates. J Pharm Pharmacol. 2004 Aug;56(8):967-75.
24	Caco-2 permeability, P-glycoprotein transport ratios and brain penetration of heterocyclic drugs. Int J Pharm. 2003 Sep 16;263(1-2):113-22.
25	Carotenoids reverse multidrug resistance in cancer cells by interfering with ABC-transporters. Phytomedicine. 2012 Aug 15;19(11):977-87.
26	Effect of Rifampin on the Pharmacokinetics of Apixaban, an Oral Direct Inhibitor of Factor Xa. Am J Cardiovasc Drugs. 2016 Apr;16(2):119-27.
27	Tarascon Pocket Pharmacopoeia 2018 Classic Shirt-Pocket Edition.
28	Improving the prediction of the brain disposition for orally administered drugs using BDDCS. Adv Drug Deliv Rev. 2012 Jan;64(1):95-109.
29	The impact of P-glycoprotein and breast cancer resistance protein on the brain pharmacokinetics and pharmacodynamics of a panel of MEK inhibitors. Int J Cancer. 2018 Jan 15;142(2):381-391.
30	Arsenic trioxide induces apoptosis equally in T lymphoblastoid leukemia MOLT-4 cells and P-gp-expressing daunorubicin-resistant MOLT-4 cells. Cancer Chemother Pharmacol. 2003 Feb;51(2):119-26.
31	Interaction of digoxin with antihypertensive drugs via MDR1. Life Sci. 2002 Feb 15;70(13):1491-500.
32	Meta-analysis of contribution of genetic polymorphisms in drug-metabolizing enzymes or transporters to axitinib pharmacokinetics. Eur J Clin Pharmacol. 2012 May;68(5):645-55.
33	Baloxavir Marboxil FDA label
34	Prediction of Transporter-Mediated Drug-Drug Interactions for Baricitinib. Clin Transl Sci. 2017 Nov;10(6):509-519.
35	Oral and inhaled corticosteroids: differences in P-glycoprotein (ABCB1) mediated efflux. Toxicol Appl Pharmacol. 2012 May 1;260(3):294-302.
36	P-glycoprotein-mediated transport of digitoxin, alpha-methyldigoxin and beta-acetyldigoxin. Naunyn Schmiedebergs Arch Pharmacol. 2001 Mar;363(3):337-43.
37	Structural determinants of P-glycoprotein-mediated transport of glucocorticoids. Pharm Res. 2003 Nov;20(11):1794-803.
38	Profile of betrixaban and its potential in the prevention and treatment of venous thromboembolism. Vasc Health Risk Manag. 2015 Jun 26;11:343-51.
39	Breast cancer resistance protein (BCRP/ABCG2) and P-glycoprotein (P-gp/ABCB1) transport afatinib and restrict its oral availability and brain accumulation. Pharmacol Res. 2017 Jun;120:43-50.
40	Effects of the ABCG2 and ABCB1 drug transporter polymorphisms on the pharmacokinetics of bicalutamide in humans. Clin Chim Acta. 2015 Jan 1;438:7-11.
41	Drug interactions and protease inhibitors used in the treatment of hepatitis C: how to manage? Eur J Clin Pharmacol. 2014 Jul;70(7):775-89.
42	CNS uptake of bortezomib is enhanced by P-glycoprotein inhibition: implications for spinal muscular atrophy. Neurobiol Dis. 2016 Apr;88:118-24.
43	In vitro and in vivo identification of ABCB1 as an efflux transporter of bosutinib. J Hematol Oncol. 2015 Jul 7;8:81.
44	KEGG: new perspectives on genomes, pathways, diseases and drugs. Nucleic Acids Res. 2017 Jan 4;45(D1):D353-D361. (dg:DG01665)
45	Sertraline and its metabolite desmethylsertraline, but not bupropion or its three major metabolites, have high affinity for P-glycoprotein. Biol Pharm Bull. 2008 Feb;31(2):231-4.
46	Polymorphisms of the drug transporter gene ABCB1 predict side effects of treatment with cabergoline in patients with PRL adenomas. Eur J Endocrinol. 2012 Sep;167(3):327-35.
47	In vitro and physiologically-based pharmacokinetic based assessment of drug-drug interaction potential of canagliflozin. Br J Clin Pharmacol. 2017 May;83(5):1082-1096.
48	Identification of an ABCB1 (P-glycoprotein)-positive carfilzomib-resistant myeloma subpopulation by the pluripotent stem cell fluorescent dye CDy1. Am J Hematol. 2013 Apr;88(4):265-72.
49	Relationship between urinary sodium excretion and pioglitazone-induced edema. J Diabetes Investig. 2010 Oct 19;1(5):208-11.
50	Cepharanthin, a multidrug resistant modifier, is a substrate for P-glycoprotein. J Pharmacol Exp Ther. 1995 Oct;275(1):73-8.
51	P-glycoprotein Mediates Ceritinib Resistance in Anaplastic Lymphoma Kinase-rearranged Non-small Cell Lung Cancer. EBioMedicine. 2015 Dec 12;3:54-66.
52	Identification of the hepatic efflux transporters of organic anions using double-transfected Madin-Darby canine kidney II cells expressing human organic anion-transporting polypeptide 1B1 (OATP1B1)/multidrug resistance-associated protein 2, OATP1B1/multidrug resistance 1, and OATP1B1/breast cancer resistance protein. J Pharmacol Exp Ther. 2005 Sep;314(3):1059-67.
53	Stereoselective and multiple carrier-mediated transport of cetirizine across Caco-2 cell monolayers with potential drug interaction. Chirality. 2010 Jul;22(7):684-92.
54	Active Mediated Transport of Chloramphenicol and Thiamphenicol in a Calu-3 Lung Epithelial Cell Model. J Pharm Sci. 2018 Apr;107(4):1178-1184.
55	Contribution of down-regulation of intestinal and hepatic cytochrome P450 3A to increased absorption of cyclosporine A in a rat nephrosis model. J Pharmacol Exp Ther. 2008 Nov;327(2):592-9.
56	ABCB1 gene polymorphisms are associated with fatal intoxications involving venlafaxine but not citalopram. Int J Legal Med. 2013 May;127(3):579-86.
57	Efflux pump inhibitors: targeting mycobacterial efflux systems to enhance TB therapy. J Antimicrob Chemother. 2016 Jan;71(1):17-26.
58	Antiestrogens and steroid hormones: substrates of the human P-glycoprotein. Biochem Pharmacol. 1994 Jul 19;48(2):287-92.
59	Impact of P-glycoprotein on clopidogrel absorption. Clin Pharmacol Ther. 2006 Nov;80(5):486-501.
60	Nilotinib (AMN107, Tasigna) reverses multidrug resistance by inhibiting the activity of the ABCB1/Pgp and ABCG2/BCRP/MXR transporters. Biochem Pharmacol. 2009 Jul 15;78(2):153-61.
61	Increased oral availability and brain accumulation of the ALK inhibitor crizotinib by coadministration of the P-glycoprotein (ABCB1) and breast cancer resistance protein (ABCG2) inhibitor elacridar. Int J Cancer. 2014 Mar 15;134(6):1484-94.
62	Influence of ABCB11 and HNF4 genes on daclatasvir plasma concentration: preliminary pharmacogenetic data from the Kineti-C study. J Antimicrob Chemother. 2017 Oct 1;72(10):2846-2849.
63	Mechanisms limiting distribution of the threonine-protein kinase B-RaF(V600E) inhibitor dabrafenib to the brain: implications for the treatment of melanoma brain metastases. J Pharmacol Exp Ther. 2013 Mar;344(3):655-64.
64	Potential role of drug transporters in the pathogenesis of medically intractable epilepsy. Epilepsia. 2005 Feb;46(2):224-35.
65	Impact of drug transporters on cellular resistance towards saquinavir and darunavir. J Antimicrob Chemother. 2010 Nov;65(11):2319-28.
66	Comparison of ATP-binding cassette transporter interactions with the tyrosine kinase inhibitors imatinib, nilotinib, and dasatinib. Drug Metab Dispos. 2010 Aug;38(8):1371-80.
67	Interrelationship between substrates and inhibitors of human CYP3A and P-glycoprotein. Pharm Res. 1999 Mar;16(3):408-14.
68	A novel screening strategy to identify ABCB1 substrates and inhibitors. Naunyn Schmiedebergs Arch Pharmacol. 2009 Jan;379(1):11-26.
69	P-glycoprotein limits the brain penetration of nonsedating but not sedating H1-antagonists. Drug Metab Dispos. 2003 Mar;31(3):312-8.
70	Modulation of drug-stimulated ATPase activity of human MDR1/P-glycoprotein by cholesterol. Biochem J. 2007 Jan 15;401(2):597-605.
71	Comparative studies on in vitro methods for evaluating in vivo function of MDR1 P-glycoprotein. Pharm Res. 2001 Dec;18(12):1660-8.
72	Can the enhanced renal clearance of antibiotics in cystic fibrosis patients be explained by P-glycoprotein transport? Pharm Res. 2002 Apr;19(4):457-62.
73	The association of ABCB1 polymorphisms and elevated serum digitoxin concentrations in geriatric patients. Eur J Clin Pharmacol. 2008 Apr;64(4):367-72.
74	MDR1 function is sensitive to the phosphorylation state of myosin regulatory light chain. Biochem Biophys Res Commun. 2010 Jul 16;398(1):7-12.
75	Interaction of cytochrome P450 3A inhibitors with P-glycoprotein. J Pharmacol Exp Ther. 2002 Oct;303(1):323-32.
76	Effect of ABCB1 C3435T polymorphism on docetaxel pharmacokinetics according to menopausal status in breast cancer patients. Br J Cancer. 2010 Aug 10;103(4):560-6.
77	MDR1 (ABCB1) G1199A (Ser400Asn) polymorphism alters transepithelial permeability and sensitivity to anticancer agents. Cancer Chemother Pharmacol. 2009 Jun;64(1):183-8.
78	Edoxaban drug-drug interactions with ketoconazole, erythromycin, and cyclosporine. Br J Clin Pharmacol. 2016 Dec;82(6):1591-1600.
79	Influx and efflux transport of H1-antagonist epinastine across the blood-brain barrier. Drug Metab Dispos. 2004 May;32(5):519-24.
80	Effect of the ATP-binding cassette drug transporters ABCB1, ABCG2, and ABCC2 on erlotinib hydrochloride (Tarceva) disposition in in vitro and in vivo pharmacokinetic studies employing Bcrp1-/-/Mdr1a/1b-/- (triple-knockout) and wild-type mice. Mol Cancer Ther. 2008 Aug;7(8):2280-7.
81	Enhanced corneal absorption of erythromycin by modulating P-glycoprotein and MRP mediated efflux with corticosteroids. Pharm Res. 2009 May;26(5):1270-82.
82	In vitro transport profile of carbamazepine, oxcarbazepine, eslicarbazepine acetate, and their active metabolites by human P-glycoprotein. Epilepsia. 2011 Oct;52(10):1894-904.
83	P-glycoprotein (P-gp/MDR1)-mediated efflux of sex-steroid hormones and modulation of P-gp expression in vitro. Pharm Res. 2004 Jul;21(7):1284-93.
84	Efflux ratio cannot assess P-glycoprotein-mediated attenuation of absorptive transport: asymmetric effect of P-glycoprotein on absorptive and secretory transport across Caco-2 cell monolayers. Pharm Res. 2003 Aug;20(8):1200-9.
85	Closer to the Site of Action: Everolimus Concentrations in Peripheral Blood Mononuclear Cells Correlate Well With Whole Blood Concentrations. Ther Drug Monit. 2015 Oct;37(5):675-80.
86	Pharmacokinetic and pharmacodynamic interactions between the immunosuppressant sirolimus and the lipid-lowering drug ezetimibe in healthy volunteers. Clin Pharmacol Ther. 2010 Jun;87(6):663-7.
87	The influence of CYP3A5*3 and BCRPC421A genetic polymorphisms on the pharmacokinetics of felodipine in healthy Chinese volunteers. J Clin Pharm Ther. 2017 Jun;42(3):345-349.
88	Blood-brain barrier permeation and efflux exclusion of anticholinergics used in the treatment of overactive bladder. Drugs Aging. 2012 Apr 1;29(4):259-73.
89	Effect of itraconazole on the pharmacokinetics and pharmacodynamics of fexofenadine in relation to the MDR1 genetic polymorphism. Clin Pharmacol Ther. 2005 Aug;78(2):191-201.
90	Fluoxetine and reversal of multidrug resistance. Cancer Lett. 2006 Jun 18;237(2):180-7.
91	Folate transporter expression decreases in the human placenta throughout pregnancy and in pre-eclampsia. Pregnancy Hypertens. 2012 Apr;2(2):123-31.
92	Interaction of gatifloxacin with efflux transporters: a possible mechanism for drug resistance. Int J Pharm. 2010 Aug 16;395(1-2):114-21.
93	Gefitinib-phenytoin interaction is not correlated with the C-erythromycin breath test in healthy male volunteers. Br J Clin Pharmacol. 2009 Aug;68(2):226-37.
94	Increased sensitivity to gemcitabine of P-glycoprotein and multidrug resistance-associated protein-overexpressing human cancer cell lines. Br J Cancer. 2003 Jun 16;88(12):1963-70.
95	Upregulation of cellular glutathione levels in human ABCB5- and murine Abcb5-transfected cells. BMC Pharmacol Toxicol. 2015 Dec 15;16:37.
96	Effects of plant sterols on human multidrug transporters ABCB1 and ABCC1. Biochem Biophys Res Commun. 2008 May 2;369(2):363-8.
97	P-Glycoprotein (MDR1/ABCB1) Restricts Brain Penetration of the Bruton's Tyrosine Kinase Inhibitor Ibrutinib, While Cytochrome P450-3A (CYP3A) Limits Its Oral Bioavailability. Mol Pharm. 2018 Nov 5;15(11):5124-5134.
98	Amonafide L-malate is not a substrate for multidrug resistance proteins in secondary acute myeloid leukemia. Leukemia. 2008 Nov;22(11):2110-5.
99	Association of genetic polymorphisms in the influx transporter SLCO1B3 and the efflux transporter ABCB1 with imatinib pharmacokinetics in patients with chronic myeloid leukemia. Ther Drug Monit. 2011 Apr;33(2):244-50.
100	HIV-1 protease inhibitors are substrates for the MDR1 multidrug transporter. Biochemistry. 1998 Mar 17;37(11):3594-601.
101	Indomethacin induces apoptosis via a MRP1-dependent mechanism in doxorubicin-resistant small-cell lung cancer cells overexpressing MRP1. Br J Cancer. 2007 Oct 22;97(8):1077-83.
102	The skin cancer chemotherapeutic agent ingenol-3-angelate (PEP005) is a substrate for the epidermal multidrug transporter (ABCB1) and targets tumor vasculature. Cancer Res. 2010 Jun 1;70(11):4509-19.
103	Effects of Ketoconazole and Rifampicin on the Pharmacokinetics of Nintedanib in Healthy Subjects. Eur J Drug Metab Pharmacokinet. 2018 Oct;43(5):533-541.
104	Intestinal transport of irinotecan in Caco-2 cells and MDCK II cells overexpressing efflux transporters Pgp, cMOAT, and MRP1. Drug Metab Dispos. 2002 Jul;30(7):763-70.
105	Investigation of the effects of the CFTR potentiator ivacaftor on human P-glycoprotein (ABCB1). Sci Rep. 2017 Dec 13;7(1):17481.
106	MDR1-deficient genotype in Collie dogs hypersensitive to the P-glycoprotein substrate ivermectin. Eur J Pharmacol. 2003 Jan 24;460(2-3):85-91.
107	DrugBank 5.0: a major update to the DrugBank database for 2018. Nucleic Acids Res. 2018 Jan 4;46(D1):D1074-D1082. (ID: DB14568)
108	Ixabepilone, a novel microtubule-targeting agent for breast cancer, is a substrate for P-glycoprotein (P-gp/MDR1/ABCB1) but not breast cancer resistance protein (BCRP/ABCG2). J Pharmacol Exp Ther. 2011 May;337(2):423-32.
109	Pharmacogenetics of antidepressants. Front Pharmacol. 2011 Feb 16;2:6.
110	Several major antiepileptic drugs are substrates for human P-glycoprotein. Neuropharmacology. 2008 Dec;55(8):1364-75.
111	DrugBank 5.0: a major update to the DrugBank database for 2018. Nucleic Acids Res. 2018 Jan 4;46(D1):D1074-D1082. (ID: DB00480)
112	Influence of CYP3A4/5 and ABC transporter polymorphisms on lenvatinib plasma trough concentrations in Japanese patients with thyroid cancer. Sci Rep. 2019 Apr 1;9(1):5404.
113	Differences in the transport of the antiepileptic drugs phenytoin, levetiracetam and carbamazepine by human and mouse P-glycoprotein. Neuropharmacology. 2007 Feb;52(2):333-46.
114	P-glycoprotein differentially affects escitalopram, levomilnacipran, vilazodone and vortioxetine transport at the mouse blood-brain barrier inivo. Neuropharmacology. 2016 Apr;103:104-11.
115	In vitro P-glycoprotein assays to predict the in vivo interactions of P-glycoprotein with drugs in the central nervous system. Drug Metab Dispos. 2008 Feb;36(2):268-75.
116	Effects of cytochrome P450 3A (CYP3A) and the drug transporters P-glycoprotein (MDR1/ABCB1) and MRP2 (ABCC2) on the pharmacokinetics of lopinavir. Br J Pharmacol. 2010 Jul;160(5):1224-33.
117	Active transport of the angiotensin-II antagonist losartan and its main metabolite EXP 3174 across MDCK-MDR1 and caco-2 cell monolayers. Br J Pharmacol. 2000 Mar;129(6):1235-43.
118	Polymorphisms in human MDR1 (P-glycoprotein): recent advances and clinical relevance. Clin Pharmacol Ther. 2004 Jan;75(1):13-33.
119	Multidrug resistance protein-mediated transport of chlorambucil and melphalan conjugated to glutathione. Br J Cancer. 1998;77(2):201-9.
120	Opioids and efflux transporters. Part 3: P-glycoprotein substrate activity of 3-hydroxyl addition to meperidine analogs. Bioorg Med Chem Lett. 2008 Jun 15;18(12):3638-40.
121	In vitro P-glycoprotein-mediated transport of (R)-, (S)-, (R,S)-methadone, LAAM and their main metabolites. Pharmacology. 2007;80(4):304-11.
122	Secretory transport of methylprednisolone possibly mediated by P-glycoprotein in Caco-2 cells. Biol Pharm Bull. 2002 Mar;25(3):393-6.
123	In vivo expansion of MDR1-transduced cells accompanied by a post-transplantation chemotherapy regimen with mitomycin C and methotrexate. J Gene Med. 2010 Jul;12(7):596-603.
124	Genetic variability and clinical efficacy of morphine. Acta Anaesthesiol Scand. 2005 Aug;49(7):902-8.
125	Influence of drug transporters and UGT polymorphisms on pharmacokinetics of phenolic glucuronide metabolite of mycophenolic acid in Japanese renal transplant recipients. Ther Drug Monit. 2008 Oct;30(5):559-64.
126	DrugBank 5.0: a major update to the DrugBank database for 2018. Nucleic Acids Res. 2018 Jan 4;46(D1):D1074-D1082. (ID: DB00585)
127	Overexpressed ABCB1 Induces Olaparib-Taxane Cross-Resistance in Advanced Prostate Cancer. Transl Oncol. 2019 May 7;12(7):871-878.
128	DrugBank 5.0: a major update to the DrugBank database for 2018. Nucleic Acids Res. 2018 Jan 4;46(D1):D1074-D1082. (ID: DB12455)
129	Nonclinical pharmacokinetics of oseltamivir and oseltamivir carboxylate in the central nervous system. Antimicrob Agents Chemother. 2009 Nov;53(11):4753-61.
130	The transport of antiepileptic drugs by P-glycoprotein. Adv Drug Deliv Rev. 2012 Jul;64(10):930-42.
131	Kinetics of P-glycoprotein-mediated efflux of paclitaxel. J Pharmacol Exp Ther. 2001 Sep;298(3):1236-42.
132	Efflux transporters at the blood-brain barrier limit delivery and efficacy of cyclin-dependent kinase 4/6 inhibitor palbociclib (PD-0332991) in an orthotopic brain tumor model. J Pharmacol Exp Ther. 2015 Nov;355(2):264-71.
133	Invega (paliperidone) extended release tablets FDA Label
134	Panobinostat for the treatment of multiple myeloma: the evidence to date. J Blood Med. 2015 Oct 8;6:269-76.
135	Bioavailability, metabolism and disposition of oral pazopanib in patients with advanced cancer. Xenobiotica. 2013 May;43(5):443-53.
136	Role of P-glycoprotein in the uptake/efflux transport of oral vitamin K antagonists and rivaroxaban through the Caco-2 cell model. Basic Clin Pharmacol Toxicol. 2013 Oct;113(4):259-65.
137	DrugBank 5.0: a major update to the DrugBank database for 2018. Nucleic Acids Res. 2018 Jan 4;46(D1):D1074-D1082. (ID: DB08910)
138	DrugBank 5.0: a major update to the DrugBank database for 2018. Nucleic Acids Res. 2018 Jan 4;46(D1):D1074-D1082. (ID: DB08901)
139	Evidence for two nonidentical drug-interaction sites in the human P-glycoprotein. Proc Natl Acad Sci U S A. 1997 Sep 30;94(20):10594-9.
140	The role of the efflux transporter P-glycoprotein in brain penetration of prednisolone. J Endocrinol. 2002 Oct;175(1):251-60.
141	Flavonoid permeability across an in situ model of the blood-brain barrier. Free Radic Biol Med. 2004 Mar 1;36(5):592-604.
142	Resolor, INN-prucalopride
143	Influence of hepatic and intestinal efflux transporters and their genetic variants on the pharmacokinetics and pharmacodynamics of raloxifene in osteoporosis treatment. Transl Res. 2012 Oct;160(4):298-308.
144	Contribution of P-glycoprotein to efflux of ramosetron, a 5-HT3 receptor antagonist, across the blood-brain barrier. J Pharm Pharmacol. 2002 Aug;54(8):1055-63.
145	Ranolazine-tacrolimus interaction. Ann Pharmacother. 2010 Nov;44(11):1844-9.
146	Brain and Testis Accumulation of Regorafenib is Restricted by Breast Cancer Resistance Protein (BCRP/ABCG2) and P-glycoprotein (P-GP/ABCB1). Pharm Res. 2015 Jul;32(7):2205-16.
147	Advantageous Solubility-Permeability Interplay When Using Amorphous Solid Dispersion (ASD) Formulation for the BCS Class IV P-gp Substrate Rifaximin: Simultaneous Increase of Both the Solubility and the Permeability. AAPS J. 2017 May;19(3):806-813.
148	Pharmacokinetic interaction profile of riociguat, a new soluble guanylate cyclase stimulator, initro. Pulm Pharmacol Ther. 2014 Aug;28(2):130-7.
149	Effect of verapamil on pharmacokinetics and pharmacodynamics of risperidone: in vivo evidence of involvement of P-glycoprotein in risperidone disposition. Clin Pharmacol Ther. 2005 Jul;78(1):43-51.
150	MDR1 G1199A polymorphism alters permeability of HIV protease inhibitors across P-glycoprotein-expressing epithelial cells. AIDS. 2005 Oct 14;19(15):1617-25.
151	Downregulation of ABCB1 gene in patients with total hip or knee arthroplasty influences pharmacokinetics of rivaroxaban: a population pharmacokinetic-pharmacodynamic study. Eur J Clin Pharmacol. 2019 Feb 6.
152	Population pharmacokinetics of romidepsin in patients with cutaneous T-cell lymphoma and relapsed peripheral T-cell lymphoma. Clin Cancer Res. 2009 Feb 15;15(4):1496-503.
153	Involvement of multiple transporters in the hepatobiliary transport of rosuvastatin. Drug Metab Dispos. 2008 Oct;36(10):2014-23.
154	Predicting P-glycoprotein effects on oral absorption: correlation of transport in Caco-2 with drug pharmacokinetics in wild-type and mdr1a(-/-) mice in vivo. Pharm Res. 2004 May;21(5):819-26.
155	The influence of UGT2B7, UGT1A8, MDR1, ALDH, ADH, CYP3A4 and CYP3A5 genetic polymorphisms on the pharmacokinetics of silodosin in healthy Chinese volunteers. Drug Metab Pharmacokinet. 2013;28(3):239-43.
156	Pharmacogenetics of tacrolimus and sirolimus in renal transplant patients: from retrospective analyses to prospective studies. Transplant Proc. 2007 Sep;39(7):2142-4.
157	Cytochrome P450 3A Induction Predicts P-glycoprotein Induction; Part 2: Prediction of Decreased Substrate Exposure After Rifabutin or Carbamazepine. Clin Pharmacol Ther. 2018 Dec;104(6):1191-1198.
158	Breast cancer resistance protein and P-glycoprotein limit sorafenib brain accumulation. Mol Cancer Ther. 2010 Feb;9(2):319-26.
159	HT29-MTX and Caco-2/TC7 monolayers as predictive models for human intestinal absorption: role of the mucus layer. J Pharm Sci. 2001 Oct;90(10):1608-19. Comparative Study
160	Interaction of the multikinase inhibitors sorafenib and sunitinib with solute carriers and ATP-binding cassette transporters. Clin Cancer Res. 2009 Oct 1;15(19):6062-9.
161	JNK-AKT-NF-kB controls P-glycoprotein expression to attenuate the cytotoxicity of deoxynivalenol in mammalian cells. Biochem Pharmacol. 2018 Oct;156:120-134.
162	Tacrine sinusoidal uptake and biliary excretion in sandwich-cultured primary rat hepatocytes. J Pharm Pharm Sci. 2014;17(3):427-38.
163	In Vitro P-Glycoprotein-Mediated Transport of Tadalafil: A Comparison with Sildenafil. Biol Pharm Bull. 2017;40(8):1314-1319.
164	DrugBank 5.0: a major update to the DrugBank database for 2018. Nucleic Acids Res. 2018 Jan 4;46(D1):D1074-D1082. (ID: DB11760)
165	Differences in assessment of macrolide interaction with human MDR1 (ABCB1, P-gp) using rhodamine-123 efflux, ATPase activity and cellular accumulation assays. Eur J Pharm Sci. 2010 Sep 11;41(1):86-95.
166	Association of NR1I2, CYP3A5 and ABCB1 genetic polymorphisms with variability of temsirolimus pharmacokinetics and toxicity in patients with metastatic bladder cancer. Cancer Chemother Pharmacol. 2017 Sep;80(3):653-659.
167	Pharmacokinetics of Tenofovir Alafenamide When Coadministered With Other HIV Antiretrovirals. J Acquir Immune Defic Syndr. 2018 Aug 1;78(4):465-472.
168	In vitro P-glycoprotein interactions and steady-state pharmacokinetic interactions between tolvaptan and digoxin in healthy subjects. J Clin Pharmacol. 2011 May;51(5):761-9.
169	The antiepileptic drug topiramate is a substrate for human P-glycoprotein but not multidrug resistance proteins. Pharm Res. 2009 Nov;26(11):2464-70.
170	Involvement of P-glycoprotein, multidrug resistance protein 2 and breast cancer resistance protein in the transport of belotecan and topotecan in Caco-2 and MDCKII cells. Pharm Res. 2008 Nov;25(11):2601-12.
171	Tramadol hydrochloride: pharmacokinetics, pharmacodynamics, adverse side effects, co-administration of drugs and new drug delivery systems. Biomed Pharmacother. 2015 Mar;70:234-8.
172	Central nervous system pharmacokinetics of the Mdr1 P-glycoprotein substrate CP-615,003: intersite differences and implications for human receptor occupancy projections from cerebrospinal fluid exposures. Drug Metab Dispos. 2007 Aug;35(8):1341-9.
173	Expression of drug transporters and drug metabolizing enzymes in the bladder urothelium in man and affinity of the bladder spasmolytic trospium chloride to transporters likely involved in its pharmacokinetics. Mol Pharm. 2015 Jan 5;12(1):171-8.
174	Differential effects of the oncogenic BRAF inhibitor PLX4032 (vemurafenib) and its progenitor PLX4720 on ABCB1 function. J Pharm Pharm Sci. 2014;17(1):154-68.
175	Venclexta FDA label
176	Improved expression and purification of human multidrug resistance protein MDR1 from baculovirus-infected insect cells. Protein Expr Purif. 2009 Jul;66(1):7-14.
177	Pharmacokinetics of dipeptidylpeptidase-4 inhibitors. Diabetes Obes Metab. 2010 Aug;12(8):648-58.
178	Xenopus laevis oocytes expressing human P-glycoprotein: probing trans- and cis-inhibitory effects on [3H]vinblastine and [3H]digoxin efflux. Pharmacol Res. 2010 Jan;61(1):76-84.
179	L-type calcium channel blockers reverse docetaxel and vincristine-induced multidrug resistance independent of ABCB1 expression in human lung cancer cell lines. Toxicol Lett. 2010 Feb 15;192(3):408-18.
180	Rational use of in vitro P-glycoprotein assays in drug discovery. J Pharmacol Exp Ther. 2001 Nov;299(2):620-8.
181	Pharmacogenetics of long-term responses to antiretroviral regimens containing Efavirenz and/or Nelfinavir: an Adult Aids Clinical Trials Group Study. J Infect Dis. 2005 Dec 1;192(11):1931-42.
182	P-glycoprotein-mediated transport of berberine across Caco-2 cell monolayers. J Pharm Sci. 2002 Dec;91(12):2614-21.
183	P-glycoprotein increases the efflux of the androgen dihydrotestosterone and reduces androgen responsive gene activity in prostate tumor cells. Prostate. 2004 Apr 1;59(1):77-90.
184	An in vitro evaluation of guanfacine as a substrate for P-glycoprotein. Neuropsychiatr Dis Treat. 2011;7:501-5.
185	The B-cell lymphoma 2 (BCL2)-inhibitors, ABT-737 and ABT-263, are substrates for P-glycoprotein. Biochem Biophys Res Commun. 2011 May 6;408(2):344-9.
186	Possible involvement of P-glycoprotein in renal excretion of pazufloxacin in rats. Eur J Pharmacol. 2004 Oct 6;501(1-3):151-9.
187	Interactions of human P-glycoprotein with simvastatin, simvastatin acid, and atorvastatin. Pharm Res. 2004 Sep;21(9):1686-91.
188	P-glycoprotein (ABCB1) transports the primary active tamoxifen metabolites endoxifen and 4-hydroxytamoxifen and restricts their brain penetration. J Pharmacol Exp Ther. 2011 Jun;337(3):710-7.
189	Characterization of the major metabolites of verapamil as substrates and inhibitors of P-glycoprotein. J Pharmacol Exp Ther. 2000 May;293(2):376-82.
190	P-glycoprotein efflux at the blood-brain barrier mediates differences in brain disposition and pharmacodynamics between two structurally related neurokinin-1 receptor antagonists. J Pharmacol Exp Ther. 2001 Sep;298(3):1252-9.
191	Competition of hydrophobic peptides, cytotoxic drugs, and chemosensitizers on a common P-glycoprotein pharmacophore as revealed by its ATPase activity. J Biol Chem. 1996 Feb 9;271(6):3163-71.
192	Fingerprint-based in silico models for the prediction of P-glycoprotein substrates and inhibitors. Bioorg Med Chem. 2012 Sep 15;20(18):5388-95.
193	ATP-binding cassette B1 transports seliciclib (R-roscovitine), a cyclin-dependent kinase inhibitor. Drug Metab Dispos. 2010 Nov;38(11):2000-6.
194	Molecular and cellular pharmacology of the novel noncamptothecin topoisomerase I inhibitor Genz-644282. Mol Cancer Ther. 2011 Aug;10(8):1490-9.
195	Interaction of drugs of abuse and maintenance treatments with human P-glycoprotein (ABCB1) and breast cancer resistance protein (ABCG2). Int J Neuropsychopharmacol. 2010 Aug;13(7):905-15.
196	Lipid dependence of ABC transporter localization and function. Chem Phys Lipids. 2009 Oct;161(2):57-64.
197	Active efflux of the 5-HT(1A) receptor agonist flesinoxan via P-glycoprotein at the blood-brain barrier. Eur J Pharm Sci. 2001 Aug;14(1):81-6.
198	Altered drug disposition of the platelet activating factor antagonist apafant in mdr1a knockout mice. Eur J Pharm Sci. 2002 Aug;16(3):119-28.
199	Interaction of macrocyclic lactones with P-glycoprotein: structure-affinity relationship. Eur J Pharm Sci. 2007 Jan;30(1):84-94.
200	Contribution of P-glycoprotein to bunitrolol efflux across blood-brain barrier. Biopharm Drug Dispos. 1999 Mar;20(2):85-90.
201	Imaging reversal of multidrug resistance in living mice with bioluminescence: MDR1 P-glycoprotein transports coelenterazine. Proc Natl Acad Sci U S A. 2004 Feb 10;101(6):1702-7.
202	Increased ABCB1 expression in TP-110-resistant RPMI-8226 cells. Biosci Biotechnol Biochem. 2010;74(9):1913-9.
203	P-glycoprotein (ABCB1) and breast cancer resistance protein (ABCG2) restrict brain accumulation of the active sunitinib metabolite N-desethyl sunitinib. J Pharmacol Exp Ther. 2012 Apr;341(1):164-73.
204	ATP-binding cassette transporters as pitfalls in selection of transgenic cells. Anal Biochem. 2010 Apr 15;399(2):246-50.
205	Functional characterization of sodium-dependent multivitamin transporter in MDCK-MDR1 cells and its utilization as a target for drug delivery. Mol Pharm. 2006 May-Jun;3(3):329-39.
206	Cholesterol interaction with the daunorubicin binding site of P-glycoprotein. Biochem Biophys Res Commun. 2000 Oct 5;276(3):909-16.
207	Unveiling the role of multidrug resistance proteins in hypertension. Hypertension. 2009 Aug;54(2):210-6.
208	Resistance to the translation initiation inhibitor silvestrol is mediated by ABCB1/P-glycoprotein overexpression in acute lymphoblastic leukemia cells. AAPS J. 2011 Sep;13(3):357-64.
209	Transport of somatostatin and substance P by human P-glycoprotein. FEBS Lett. 2004 Sep 10;574(1-3):55-61.
210	Grapefruit juice-drug interactions: Grapefruit juice and its components inhibit P-glycoprotein (ABCB1) mediated transport of talinolol in Caco-2 cells. J Pharm Sci. 2007 Oct;96(10):2808-17.
211	Inhibiting the function of ABCB1 and ABCG2 by the EGFR tyrosine kinase inhibitor AG1478. Biochem Pharmacol. 2009 Mar 1;77(5):781-93.